US20220106401A1

US20220106401A1 - ANTI-EpCAM ANTIBODIES, COMPOSITIONS COMPRISING ANTI-EpCAM ANTIBODIES AND METHODS OF MAKING AND USING ANTI-EpCAM ANTIBODIES

Info

Publication number: US20220106401A1
Application number: US17/394,556
Authority: US
Inventors: Ryan Stafford; Alice Yam; John Lee; Stephanie Armstrong; Aaron Sato
Original assignee: Sutro Biopharma Inc
Current assignee: Sutro Biopharma Inc
Priority date: 2015-07-31
Filing date: 2021-08-05
Publication date: 2022-04-07
Also published as: EP3328897A1; US20190002581A1; US11098131B2; WO2017023704A1

Abstract

Provided herein are antibodies that selectively bind to EpCAM and its isoforms and homologs, and compositions comprising the antibodies. Also provided are methods of using the antibodies, such as therapeutic and diagnostic methods.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

This application is a Continuation application of U.S. patent application Ser. No. 15/748,634, filed on Jan. 29, 2018, which is the U.S. entry under 35 U.S.C. § 371 of International Patent Application No. PCT/US2016/044564, filed on Jul. 28, 2016, which claims the benefit of U.S. Provisional Patent Application No. 62/199,924, filed on Jul. 15, 2015. Each of the foregoing applications is incorporated herein by reference in its entirety.

REFERENCE TO SEQUENCE LISTING SUBMITTED VIA EFS-WEB

This application includes an electronically submitted sequence listing in .txt format. The .txt file contains a sequence listing entitled “108843_00362-Sequence Listing.txt,” created on Aug. 3, 2021, and is 300 kilobytes in size. The sequence listing contained in this .txt file is part of the specification and is incorporated herein by reference in its entirety.

FIELD

Provided herein are antibodies with binding specificity for epithelial cell adhesion molecule (EpCAM) and compositions comprising the antibodies, including pharmaceutical compositions, diagnostic compositions, and kits. Also provided are methods of making anti-EpCAM antibodies, and methods of using anti-EpCAM antibodies, for example, for therapeutic, diagnostic purposes, and research purposes.

BACKGROUND

EpCAM is a type I transmembrane glycoprotein that mediates calcium-independent homotypic epithelial cell-cell adhesion. See Litvinov et al., J. Cell. Biol., 1994, 125:437-446, incorporated by reference in its entirety. EpCAM is also involved in cell signaling, migration, proliferation, and differentiation. See Maetzel et al., Nature Cell Biol., 2009, 11:162-171; Osta et al., Cancer Res., 2004, 64:5818-5824; and Litvinov et al., Am. J. Pathol., 1996, 148:865-875, each of which is incorporated by reference in its entirety.
EpCAM has oncogenic potential via its capacity to upregulate at least c-Myc, E-FABP, and cyclins A and E. See Munz et al., Oncogene, 2004, 23:5748-5758, incorporated by reference in its entirety. Because EpCAM is expressed exclusively in epithelia and epithelial-derived neoplasms, it can be used as diagnostic marker for some cancers. It may also be a useful prognostic marker for certain tumor types. See Munz et al., Cancer Res., 2009, 69:5627-5629 and Baeuerle and Gires, Br. J. Cancer, 2007, 96:417-423, each of which is incorporated by reference in its entirety.
EpCAM is known to be overexpressed in some cancers, and therefore represents a potential target for cancer therapy. See Osta et al., supra.; Haisma et al., Gene Therapy, 1999, 6:1469-1474; Heideman et al., Cancer Gene Ther., 2001, 8:342-351; and Seimetz et al., Cancer Treatment Reviews, 2010, 36:458-467, each of which is incorporated by reference in its entirety. Most known EpCAM antibodies bind an epitope encoded by EpCAM exon 2. See Münz et al., Cancer Cell Int., 2010, 10:44. One known EpCAM antibody, adecatumumab, binds outside exon 2 at an epitope encoded by EpCAM exon 5. See id. However, adecatumumab does not have significant binding affinity for cynomolgus EpCAM. See id. Cynomolgous cross-reactivity is advantageous because it facilitates evaluation of the potential toxicity of antibodies in a primate model, without exposing human subjects to molecules of unknown toxicity.
There is a need for targeted delivery of therapeutics to tumor cells in a manner that provides a localized therapeutic effect while minimizing or eliminating systemic side-effects. More particularly, in light of the overexpression of EpCAM in various cancers, there is a need for therapeutics that specifically target cancer cells over expressing EpCAM. Particularly advantageous therapeutics would bind epitopes outside those encoded by exon 2 of EpCAM and would cross-react with cynomolgus EpCAM.

SUMMARY

Provided herein are antibodies that specifically bind to EpCAM. In some embodiments, the antibodies bind human EpCAM. In some embodiments, the antibodies also bind homologs of human EpCAM. In some aspects, the homolog is a cynomolgus monkey homolog. In some aspects, the antibodies do not bind a murine homolog. In some embodiments, the antibodies bind to human EpCAM and a cynomolgus monkey homolog, but not a murine homolog.
In some embodiments, the antibodies comprise at least one CDR sequence defined by a consensus sequence provided in this disclosure. In some embodiments, the antibodies comprise an illustrative CDR, V_H, or V_Lsequence provided in this disclosure, or a variant thereof. In some aspects, the variant is a variant with one or more conservative amino acid substitutions.
Also provided are compositions comprising the antibodies. In some embodiments, the composition is a pharmaceutical composition. In some embodiments, the pharmaceutical composition is for the treatment or diagnosis of a disease or condition, as described further elsewhere in this disclosure. In some embodiments, the pharmaceutical composition is a composition for parenteral administration.
This disclosure also provides methods of making the anti-EpCAM antibodies provided herein. The antibodies can be made, for example, in any suitable cell or organism. The antibodies can also be made in a cell-free reaction mixture.
Also provided are methods of using the anti-EpCAM antibodies provided herein. In some embodiments, the method of use is a method of treatment. In some embodiments, the method of use is a diagnostic method. In some embodiments, the method of use is an analytical method. In some embodiments, the method of use is a method of purifying and/or quantifying EpCAM.
In some embodiments, the antibodies are used to treat a disease or condition. In some aspects, the disease or condition is a cancer.

BRIEF DESCRIPTION OF THE DRAWINGS

FIGS. 1A-1C provide an alignment of the “1304,” “1464,” and “1557” V_Hsequences provided herein.

FIGS. 2A and 2B provide an alignment of the “1332” V_Hsequences provided herein.

FIGS. 3A and 3B provide an alignment of the “1304,” “1464,” and “1557” V_Lsequences provided herein.

FIGS. 4A and 4B provide an alignment of the “1332” V_Lsequences provided herein.

DETAILED DESCRIPTION

1. Definitions

Unless otherwise defined, all terms of art, notations and other scientific terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a difference over what is generally understood in the art. The techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodologies by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd ed. (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer-defined protocols and conditions unless otherwise noted.
As used herein, the singular forms “a,” “an,” and “the” include the plural referents unless the context clearly indicates otherwise.
The term “about” indicates and encompasses an indicated value and a range above and below that value. In certain embodiments, the term “about” indicates the designated value±10%, ±5%, or ±1%. In certain embodiments, the term “about” indicates the designated value±one standard deviation of that value.
The term “combinations thereof” includes every possible combination of elements to which the term refers to. For example, a sentence stating that “if α₂is A, then α₃is not D; as is not S; or α₆is not S; or combinations thereof” includes the following combinations when α₂is A: (1) α₃is not D; (2) as is not S; (3) α₆is not S; (4) α₃is not D; as is not S; and α₆is not S; (5) α₃is not D and as is not S; (6) α₃is not D and α₆is not S; and (7) as is not S and α₆is not S.
The terms “EpCAM” and “EpCAM antigen” are used interchangeably herein. EpCAM is also known by a variety of synonyms, including CD326, Ep-CAM, 17-1A, HEA125, MK-1, GA733-2, EGP-2, EGP34, KSA, TROP-1, ESA, and KS1/4, among others. Unless specified otherwise, the terms include any variants, isoforms and species homologs of human EpCAM that are naturally expressed by cells, or that are expressed by cells transfected with an EpCAM gene. EpCAM proteins include, for example, human EpCAM (GI: 15928632; SEQ ID NO: 1). In some embodiments, EpCAM proteins include cynomolgus monkey EpCAM (GI: 544483249; SEQ ID NO: 2). In some embodiments, EpCAM proteins include murine EpCAM (GI: 112293275; SEQ ID NO: 3). However, as discussed in detail elsewhere in this disclosure, in some embodiments the antibodies provided herein do not bind murine EpCAM proteins. The antibodies provided herein bind to an extracellular domain of EpCAM.
The term “immunoglobulin” refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an “intact immunoglobulin,” all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul, Fundamental Immunology 7th ed., Ch. 5 (2013) Lippincott Williams & Wilkins, Philadelphia, Pa. Briefly, each heavy chain typically comprises a heavy chain variable region (V_H) and a heavy chain constant region (CH). The heavy chain constant region typically comprises three domains, abbreviated C_H1, C_H2, and C_H3. Each light chain typically comprises a light chain variable region (V_L) and a light chain constant region. The light chain constant region typically comprises one domain, abbreviated CL.
The term “antibody” describes a type of immunoglobulin molecule and is used herein in its broadest sense. An antibody specifically includes intact antibodies (e.g., intact immunoglobulins), and antibody fragments. Antibodies comprise at least one antigen-binding domain. One example of an antigen-binding domain is an antigen binding domain formed by a V_H-V_Ldimer. An “EpCAM antibody,” “anti-EpCAM antibody,” “EpCAM Ab,” “EpCAM-specific antibody” or “anti-EpCAM Ab” is an antibody, as described herein, which binds specifically to the antigen EpCAM. In some embodiments, the antibody binds the extracellular domain of EpCAM.
The V_Hand V_Lregions may be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called “complementarity determining regions” (CDRs)) interspersed with regions that are more conserved. The more conserved regions are called framework regions (FRs). Each V_Hand V_Lgenerally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. The CDRs are involved in antigen binding, and influence antigen specificity and binding affinity of the antibody. See Kabat et al., Sequences of Proteins of Immunological Interest 5th ed. (1991) Public Health Service, National Institutes of Health, Bethesda, Md., incorporated by reference in its entirety.
The light chain from any vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.
The heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated α, δ, ε, γ, and μ, respectively. The IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1, and IgA2.
The amino acid sequence boundaries of a CDR can be determined by one of skill in the art using any of a number of known numbering schemes, including those described by Kabat et al., supra (“Kabat” numbering scheme); Al-Lazikani et al., 1997, J. Mol. Biol., 273:927-948 (“Chothia” numbering scheme); MacCallum et al., 1996, J. Mol. Biol. 262:732-745 (“Contact” numbering scheme); Lefranc et al., Dev. Comp. Immunol., 2003, 27:55-77 (“IMGT” numbering scheme); and Honegge and Plückthun, J. Mol. Biol., 2001, 309:657-70 (“AHo” numbering scheme), each of which is incorporated by reference in its entirety.
Table 1 provides the positions of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3 as identified by the Kabat and Chothia schemes. For CDR-H1, residue numbering is provided using both the Kabat and Chothia numbering schemes.
Unless otherwise specified, the numbering scheme used for identification of a particular CDR herein is the Kabat/Chothia numbering scheme. Where the residues encompassed by these two numbering schemes diverge (e.g., CDR-H1 and/or CDR-H2), the numbering scheme is specified as either Kabat or Chothia. For convenience, CDR-H3 is sometimes referred to herein as either Kabat or Chothia. However, this is not intended to imply differences in sequence where they do not exist, and one of skill in the art can readily confirm whether the sequences are the same or different by examining the sequences.
CDRs may be assigned, for example, using antibody numbering software, such as Abnum, available at http://www.bioinf org.uk/abs/abnum/, and described in Abhinandan and Martin, Immunology, 2008, 45:3832-3839, incorporated by reference in its entirety.

TABLE 1

Residues in CDRs according to
Kabat and Chothia numbering schemes.

CDR	Kabat	Chothia

Ll	L24-L34	L24-L34
L2	L50-L56	L50-L56
L3	L89-L97	L89-L97
H1 (Kabat Numbering)	H31-H35B	H26-H32 or H34*
H1 (Chothia Numbering)	H31-H35	H26-H32
H2	H50-H65	H52-H56
H3	H95-H102	H95-H102

*The C-terminus of CDR-H1, when numbered using the Kabat numbering convention, varies between H32 and H34, depending on the length of the CDR, as illustrated in FIGS. 1A-1C.

The “EU numbering scheme” is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra). Unless stated otherwise, the EU numbering scheme is used to refer to residues in antibody heavy chain constant regions described herein.
An “antibody fragment” comprises a portion of an intact antibody, such as the antigen binding or variable region of an intact antibody. Antibody fragments include, for example, Fv fragments, Fab fragments, F(ab′)₂fragments, Fab′ fragments, scFv (sFv) fragments, and scFv-Fc fragments.
“Fv” fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
“Fab” fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (Cm) of the heavy chain. Fab fragments may be generated, for example, by recombinant methods or by papain digestion of a full-length antibody.
“F(ab′)₂” fragments contain two Fab′ fragments joined, near the hinge region, by disulfide bonds. F(ab′)₂fragments may be generated, for example, by recombinant methods or by pepsin digestion of an intact antibody. The F(ab′) fragments can be dissociated, for example, by treatment with ß-mercaptoethanol.
“Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise a V_Hdomain and a V_Ldomain in a single polypeptide chain. The V_Hand V_Lare generally linked by a peptide linker. See Plückthun A. (1994). In some embodiments, the linker is SEQ ID NO: 283. Antibodies from Escherichia coli. In Rosenberg M. & Moore G. P. (Eds.), The Pharmacology of Monoclonal Antibodies vol. 113 (pp. 269-315). Springer-Verlag, New York, incorporated by reference in its entirety.
“scFv-Fc” fragments comprise an scFv attached to an Fc domain. For example, an Fc domain may be attached to the C-terminal of the scFv. The Fc domain may follow the V_Hor V_L, depending on the orientation of the variable domains in the scFv (i.e., V_H-V_Lor V_L-V_H). Any suitable Fc domain known in the art or described herein may be used. In some cases, the Fc domain comprises an IgG1 Fc domain. In some embodiments, the IgG1 Fc domain comprises SEQ ID NO: 279, or a portion thereof, or SEQ ID NO: 280. SEQ ID NO: 279 provides the sequence of C_H1, C_H2, and C_H3of the human IgG1 constant region. SEQ ID NO: 280 provides the sequence of the constant region used in the illustrative scFv-Fc antibodies provided herein.
The term “monoclonal antibody” refers to an antibody from a population of substantially homogeneous antibodies. A population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody. Such variants are generally present in only minor amounts. A monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies. For example, the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones. The selected antibody can be further altered, for example, to improve affinity for the target (“affinity maturation”), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.
The term “chimeric antibody” refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
“Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody. A humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody). The donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity, affinity, or biological effect. In some instances, selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody. Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function. For further details, see Jones et al., Nature, 1986, 321:522-525; Riechmann et al., Nature, 1988, 332:323-329; and Presta, Curr. Op. Struct Biol., 1992, 2:593-596, each of which is incorporated by reference in its entirety.
A “human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.
An “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials. In some embodiments, an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator. In some embodiments, an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain. An isolated antibody includes an antibody in situ within recombinant cells, since at least one component of the antibody's natural environment is not present. In some aspects, an isolated antibody is prepared by at least one purification step.
In some embodiments, an isolated antibody is purified to at least 80%, 85%, 90%, 95%, or 99% by weight. In some embodiments, an isolated antibody is purified to at least 80%, 85%, 90%, 95%, or 99% by volume. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by weight. In some embodiments, an isolated antibody is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% by volume.
“Affinity” refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can be represented by the dissociation constant (K_D). Affinity can be measured by common methods known in the art, including those described herein. Affinity can be determined, for example, using surface plasmon resonance (SPR) technology, such as a Biacore® instrument. In some embodiments, the affinity is determined at 25° C.
With regard to the binding of an antibody to a target molecule, the terms “specific binding,” “specifically binds to,” “specific for,” “selectively binds,” and “selective for” a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non-selective interaction. Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. Specific binding can also be determined by competition with a control molecule that mimics the antibody binding site on the target. In that case, specific binding is indicated if the binding of the antibody to the target is competitively inhibited by the control molecule.
The term “k_d” (sec⁻¹), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the k_offvalue.
The term “k_a” (M⁻¹×sec⁻¹), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the k_onvalue.
The term “K_D” (M), as used herein, refers to the dissociation equilibrium constant of a particular antibody-antigen interaction. K_D=k_d/k_a.
The term “K_A” (M⁻¹), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction. K_A=k_a/k_d.
An “affinity matured” antibody is one with one or more alterations in one or more CDRs or FRs that result in an improvement in the affinity of the antibody for its antigen, compared to a parent antibody which does not possess the alteration(s). In one embodiment, an affinity matured antibody has nanomolar or picomolar affinity for the target antigen. Affinity matured antibodies may be produced using a variety of methods known in the art. For example, Marks et al. (Bio/Technology, 1992, 10:779-783, incorporated by reference in its entirety) describes affinity maturation by V_Hand V_Ldomain shuffling. Random mutagenesis of CDR and/or framework residues is described by, for example, Barbas et al. (Proc. Nat. Acad. Sci. USA., 1994, 91:3809-3813); Schier et al., Gene, 1995, 169:147-155; Yelton et al., J. Immunol., 1995, 155:1994-2004; Jackson et al., J. Immunol., 1995, 154:3310-33199; and Hawkins et al, J. Mol. Biol., 1992, 226:889-896, each of which is incorporated by reference in its entirety.
When used herein in the context of two or more antibodies, the term “competes with” or “cross-competes with” indicates that the two or more antibodies compete for binding to an antigen (e.g., EpCAM). In one exemplary assay, EpCAM is coated on a plate and allowed to bind a first antibody, after which a second, labeled antibody is added. If the presence of the first antibody reduces binding of the second antibody, then the antibodies compete. In another exemplary assay, a first antibody is coated on a plate and allowed to bind the antigen, and then the second antibody is added. The term “competes with” also includes combinations of antibodies where one antibody reduces binding of another antibody, but where no competition is observed when the antibodies are added in the reverse order. However, in some embodiments, the first and second antibodies inhibit binding of each other, regardless of the order in which they are added. In some embodiments, one antibody reduces binding of another antibody to its antigen by at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%.
The term “epitope” means a portion of an antigen capable of specific binding to an antibody. Epitopes frequently consist of surface-accessible amino acid residues and/or sugar side chains and may have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents. An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding. The epitope to which an antibody binds can be determined using known techniques for epitope determination such as, for example, testing for antibody binding to EpCAM variants with different point-mutations, or to chimeric EpCAM variants as described further in the Examples provided herein.
Percent “identity” between a polypeptide sequence and a reference sequence, is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, CLUSTAL OMEGA, or MUSCLE software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
A “conservative substitution” or a “conservative amino acid substitution,” refers to the substitution an amino acid with a chemically or functionally similar amino acid. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as “conservatively modified variants.” By way of example, the groups of amino acids provided in Tables 2-4 are, in some embodiments, considered conservative substitutions for one another.

TABLE 2

Selected groups of amino acids that are considered
conservative substitutions for one another, in certain embodiments.

Acidic Residues	D and E
Basic Residues	K, R, and H
Hydrophilic Uncharged Residues	S, T, N, and Q
Aliphatic Uncharged Residues	G, A, V, L, and I
Non-polar Uncharged Residues	C, M, and P
Aromatic Residues	F, Y, and W

TABLE 3

Additional selected groups of amino acids that are considered
conservative substitutions for one another, in certain embodiments.

	Group 1	A, S, and T
	Group 2	D and E
	Group 3	N and Q
	Group 4	R and K
	Group 5	I, L, and M
	Group 6	F, Y, and W

TABLE 4

Further selected groups of amino acids that are considered
conservative substitutions for one another, in certain embodiments.

Group A	A and G
Group B	D and E
Group C	N and Q
Group D	R, K, and H
Group E	I, L, M, V
Group F	F, Y, and W
Group G	S and T
Group H	C and M

Additional conservative substitutions may be found, for example, in Creighton, Proteins: Structures and Molecular Properties 2nd ed. (1993) W. H. Freeman & Co., New York, N.Y. An antibody generated by making one or more conservative substitutions of amino acid residues in a parent antibody is referred to as a “conservatively modified variant.”
The term “amino acid” refers to the twenty common naturally occurring amino acids. Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gln; Q), Glycine (Gly; G); histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
“Treating” or “treatment” of any disease or disorder refers, in certain embodiments, to ameliorating a disease or disorder that exists in a subject. In another embodiment, “treating” or “treatment” includes ameliorating at least one physical parameter, which may be indiscernible by the subject. In yet another embodiment, “treating” or “treatment” includes modulating the disease or disorder, either physically (e.g., stabilization of a discernible symptom) or physiologically (e.g., stabilization of a physical parameter) or both. In yet another embodiment, “treating” or “treatment” includes delaying or preventing the onset of the disease or disorder.
As used herein, the term “therapeutically effective amount” or “effective amount” refers to an amount of an antibody or composition that when administered to a subject is effective to treat a disease or disorder.
As used herein, the term “subject” means a mammalian subject. Exemplary subjects include, but are not limited to humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, avians, goats, and sheep. In certain embodiments, the subject is a human. In some embodiments, the subject has a cancer that can be treated or diagnosed with an antibody provided herein. In some embodiments, the cancer is a cancer of epithelial origin.

2. Antibodies

Provided herein are antibodies that selectively bind human EpCAM. In some aspects, the antibody selectively binds to the extracellular domain of human EpCAM. In some embodiments, the antibody selectively binds to a portion of the EpCAM protein encoded by an exon selected from exons 4-7 of the EpCAM gene. In some embodiments, the antibody does not bind the portion of the EpCAM protein encoded by exon 2 of the EpCAM gene.
In some embodiments, the antibody binds to a homolog of human EpCAM. In some aspects, the antibody binds to a homolog of human EpCAM from a species selected from monkeys, mice, dogs, cats, rats, cows, horses, goats and sheep. In some aspects, the homolog is a cynomolgus monkey homolog. In some aspects, the antibody does not bind a murine homolog.
In some embodiments, the antibody has one or more CDRs having particular lengths, in terms of the number of amino acid residues. In some embodiments, the Chothia CDR-H1 of the antibody is 6, 7, or 8 residues in length. In some embodiments, the Kabat CDR-H1 of the antibody is 4, 5, or 6 residues in length. In some embodiments, the Chothia CDR-H2 of the antibody is 5, 6, or 7 residues in length. In some embodiments, the Kabat CDR-H2 of the antibody is 16, 17, or 18 residues in length. In some embodiments, the Kabat/Chothia CDR-H3 of the antibody is 9, 10, 11, 12, or 13 residues in length.
In some aspects, the Kabat/Chothia CDR-L1 of the antibody is 11, 12, 13, 14, 15, 16, 17, or 18 residues in length. In some aspects, the Kabat/Chothia CDR-L2 of the antibody is 6, 7, or 8 residues in length. In some aspects, the Kabat/Chothia CDR-L3 of the antibody is 8, 9, or 10 residues in length.
In some embodiments, the antibody comprises a light chain. In some aspects, the light chain is a kappa light chain. In some aspects, the light chain is a lambda light chain.
In some embodiments, the antibody comprises a heavy chain. In some aspects, the heavy chain is an IgA. In some aspects, the heavy chain is an IgD. In some aspects, the heavy chain is an IgE. In some aspects, the heavy chain is an IgG. In some aspects, the heavy chain is an IgM. In some aspects, the heavy chain is an IgG1. In some aspects, the heavy chain is an IgG2. In some aspects, the heavy chain is an IgG3. In some aspects, the heavy chain is an IgG4. In some aspects, the heavy chain is an IgA1. In some aspects, the heavy chain is an IgA2.
In some embodiments, the antibody is an antibody fragment. In some aspects, the antibody fragment is an Fv fragment. In some aspects, the antibody fragment is a Fab fragment. In some aspects, the antibody fragment is a F(ab′)2 fragment. In some aspects, the antibody fragment is a Fab′ fragment. In some aspects, the antibody fragment is an scFv (sFv) fragment. In some aspects, the antibody fragment is an scFv-Fc fragment.
In some embodiments, the scFv-Fc fragment comprises a constant region wherein the constant region comprises SEQ ID NO: 280. The constant region in SEQ ID NO: 280 differs from the human IgG1 constant region of SEQ ID NO: 279 in several respects. First, the sequence in SEQ ID NO: 280 comprises the linker AAGSDQ (SEQ ID NO: 284). SEQ ID NO: 280 also does not comprise the CH1 domain of the IgG1 constant region. SEQ ID NO: 280 further comprises a C220S (EU numbering system) mutation, which removes an unpaired cysteine reside that is not needed when the light chain constant region is not present (e.g., in an scFv-Fc format). SEQ ID NO: 280 further comprises two, optional, P to S mutations (P230S and P238S by the EU numbering system). Either or both of these serine residues can be reverted to the naturally occurring proline residues. Finally, SEQ ID NO: 280 comprises an aspartic acid (D) residue at EU position 356 and a leucine (L) residue at EU position 358. In contrast, SEQ ID NO: 279 comprises glutamic acid (E) in EU position 356 and methionine (M) in EU position 358. In some embodiments, the antibodies provided herein comprise constant regions comprising D356/L358, E356/M358, D356/M358, or E356/L358 (EU numbering). However, a skilled person will recognize that the antibodies provide herein may comprise any suitable constant region and that the constant region sequences provided herein are for illustrative purposes.
In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody is a polyclonal antibody.
In some embodiments, the antibody is a chimeric antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a human antibody.
In some embodiments, the antibody is an affinity matured antibody. In some aspects, the antibody is an affinity matured antibody derived from an illustrative sequence provided in this disclosure.
In some embodiments, the antibody inhibits the binding of EpCAM to one or more of its ligands. In some aspects, the antibody inhibits the binding of EpCAM to a ligand selected from a second EpCAM molecule, claudin-7, CD44v4-v7, E-cadherin, and CD9.
The antibodies provided herein may be useful for the treatment of a variety of diseases and conditions including cancers. In particular, the antibodies provided herein may be useful for the treatment of cancers of epithelial origin.
2.1. CDR-H3 Sequences
In some embodiments, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a CDR-H3 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the CDR-H3 sequence is a CDR-H3 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the CDR-H3 sequence is a CDR-H3 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128.
In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 306-310. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 306. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 307. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 308. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 309. In some aspects, the CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 310.
2.2. V_HSequences Comprising Illustrative CDRs
In some embodiments, the antibody comprises a V_Hsequence comprising one or more CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-H sequences provided in this disclosure, and variants thereof. In some embodiments, the CDR-H sequences comprise, consist of, or consist essentially of one or more CDR-H sequences provided in a V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.1. V_HSequences Comprising Illustrative Kabat CDRs
In some embodiments, the antibody comprises a V_Hsequence comprising one or more Kabat CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Kabat CDR-H sequences provided in this disclosure, and variants thereof 2.2.1.1. Kabat CDR-H3
In some embodiments, the antibody comprises a V_Hsequence comprising a CDR-H3 sequence, wherein the CDR-H3 sequence comprises, consists of, or consists essentially of a Kabat CDR-H3 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H3 sequence of a scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of a scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H3 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128.
2.2.1.2. Kabat CDR-H2
In some embodiments, the antibody comprises a V_Hsequence comprising a CDR-H2 sequence, wherein the CDR-H2 sequence comprises, consists of, or consists essentially of a Kabat CDR-H2 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the Kabat CDR-H2 sequence is a Kabat CDR-H2 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H3 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 79. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 80. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 81. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 82. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 83. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 84. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 85. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 86. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 87. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 88. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 89. In some aspects, the antibody comprises a VII sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 90. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 91. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 92. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 93. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 94. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 95. In some aspects, the antibody comprises a VII sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 96. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 97. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 98. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 99. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 100. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 101. In some aspects, the antibody comprises a VII sequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 102. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 103.
2.2.1.3. Kabat CDR-H1
In some embodiments, the antibody comprises a V_Hsequence comprising a CDR-H1 sequence, wherein the CDR-H1 sequence comprises, consists of, or consists essentially of a Kabat CDR-H1 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the Kabat CDR-H1 sequence is a Kabat CDR-H1 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Kabat CDR-H3 sequence is a Kabat CDR-H1 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 29. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 30. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 31. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 32. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 33. In some aspects, the antibody comprises a VII sequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 34. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 35. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 36. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 37. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 38. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 39. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 40. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 41. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 42. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 43. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 44. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 45. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 46. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 47. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 48. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 49. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 50. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 51. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 52. In some aspects, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 53.
2.2.1.4. Kabat CDR-H3+Kabat CDR-H2
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.1.5. Kabat CDR-H3+Kabat CDR-H1
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53. In some aspects, the Kabat CDR-H3 sequence and the Kabat CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H3 and Kabat CDR-H1 are both from a single illustrative V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.1.6. Kabat CDR-H1+Kabat CDR-H2
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53 and a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103. In some aspects, the Kabat CDR-H1 sequence and the Kabat CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1 and Kabat CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.1.7. Kabat CDR-H1+Kabat CDR-H2+Kabat CDR-H3
In some embodiments, the antibody comprises a V_Hsequence comprising a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 29-53, a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 79-103, and a Kabat CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the Kabat CDR-H1 sequence, Kabat CDR-H2 sequence, and Kabat CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Kabat CDR-H1, Kabat CDR-H2, and Kabat CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.1.8. Variants of V_HSequences Comprising Illustrative Kabat CDRs
In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H3 sequence provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H3 sequences provided in this disclosure. In some aspects, the Kabat CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the Kabat CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Kabat CDR-H1 sequence provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Kabat CDR-H1 sequences provided in this disclosure. In some aspects, the Kabat CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.2.1.9. Excluded V_HSequences Comprising Kabat CDRs
In some embodiments, the V_Hsequences provided herein do not comprise certain Kabat CDR-H3, CDR-H2, and/or CDR-H1 sequences.
In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 306-310. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 306. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 307. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 308. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 309. In some aspects, the Kabat CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 310.
In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 301-305. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 301. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 302. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 303. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 304. In some aspects, the Kabat CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 305.
In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 291-295. In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 291. In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 292. In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 293. In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 294. In some aspects, the Kabat CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 295.
2.2.2. V_HSequences Comprising Illustrative Chothia CDRs
In some embodiments, the antibody comprises a V_Hsequence comprising one or more Chothia CDR-H sequences comprising, consisting of, or consisting essentially of one or more illustrative Chothia CDR-H sequences provided in this disclosure, and variants thereof.
2.2.2.1. Chothia CDR-H3
In some embodiments, the antibody comprises a V_Hsequence comprising a CDR-H3 sequence, wherein the CDR-H3 sequence comprises, consists of, or consists essentially of a Chothia CDR-H3 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the Chothia CDR-H3 sequence is a Chothia CDR-H3 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Chothia CDR-H3 sequence is a Chothia CDR-H3 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 104. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 105. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 106. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 107. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 108. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 109. In some aspects, the antibody comprises a VII sequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 110. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 111. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 112. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 113. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 114. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 115. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 116. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 117. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 118. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 119. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 120. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 121. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 122. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 123. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 124. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 125. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 126. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 127. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 128.
2.2.2.2. Chothia CDR-H2
In some embodiments, the antibody comprises a V_Hsequence comprising a CDR-H2 sequence, wherein the CDR-H2 sequence comprises, consists of, or consists essentially of a Chothia CDR-H2 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the Chothia CDR-H2 sequence is a Chothia CDR-H2 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Chothia CDR-H2 sequence is a Chothia CDR-H2 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 54. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 55. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 56. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 57. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 58. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 59. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 60. In some aspects, the antibody comprises a VII sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 61. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 62. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 63. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 64. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 65. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 66. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 67. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 68. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 69. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 70. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 71. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 72. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 73. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 74. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 75. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 76. In some aspects, the antibody comprises a VII sequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 77. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 78.
2.2.2.3. Chothia CDR-H1
In some embodiments, the antibody comprises a V_Hsequence comprising a CDR-H1 sequence, wherein the CDR-H1 sequence comprises, consists of, or consists essentially of a Chothia CDR-H1 sequence of an illustrative antibody or V_Hsequence provided herein. In some aspects, the Chothia CDR-H1 sequence is a Chothia CDR-H1 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the Chothia CDR-H1 sequence is a Chothia CDR-H1 sequence of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 4. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 5. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 6. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 7. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 8. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 9. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 10. In some aspects, the antibody comprises a VII sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 11. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 12. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 13. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 14. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 15. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 16. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 17. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 18. In some aspects, the antibody comprises a VII sequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 19. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 20. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 21. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 22. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 23. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 24. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 25. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 26. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 27. In some aspects, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 28.
2.2.2.4. Chothia CDR-H3+Chothia CDR-H2
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H2 are both from a single illustrative VII sequence selected from SEQ ID NOs: 229-253.
2.2.2.5. Chothia CDR-H3+Chothia CDR-H1
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128, and a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28. In some aspects, the Chothia CDR-H3 sequence and the Chothia CDR-H1 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H3 and Chothia CDR-H1 are both from a single illustrative VII sequence selected from SEQ ID NOs: 229-253.
2.2.2.6. Chothia CDR-H1+Chothia CDR-H2
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28 and a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78. In some aspects, the Chothia CDR-H1 sequence and the Chothia CDR-H2 sequence are both from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H1 and Chothia CDR-H2 are both from a single illustrative V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.2.7. Chothia CDR-H1+Chothia CDR-H2+Chothia CDR-H3
In some embodiments, the antibody comprises a V_Hsequence comprising a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 4-28, a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 54-78, and a Chothia CDR-H3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 104-128. In some aspects, the Chothia CDR-H1 sequence, Chothia CDR-H2 sequence, and Chothia CDR-H3 sequence are all from a single illustrative V_Hsequence provided in this disclosure. For example, in some aspects, the Chothia CDR-H1, Chothia CDR-H2, and Chothia CDR-H3 are all from a single illustrative V_Hsequence selected from SEQ ID NOs: 229-253.
2.2.2.8. Variants of V_HSequences Comprising Illustrative Chothia CDRs
In some embodiments, the V_Hsequences provided herein comprise a variant of an illustrative Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequence provided in this disclosure.
In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H3 sequence provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H3 sequences provided in this disclosure. In some aspects, the Chothia CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H2 sequence provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H2 sequences provided in this disclosure. In some aspects, the Chothia CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia CDR-H1 sequence provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia CDR-H1 sequences provided in this disclosure. In some aspects, the Chothia CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.2.2.9. Excluded V_HSequences Comprising Chothia CDRs
In some embodiments, the V_Hsequences provided herein do not comprise certain Chothia CDR-H3, CDR-H2, and/or CDR-H1 sequences.
In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 306-310. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 306. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 307. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 308. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 309. In some aspects, the Chothia CDR-H3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 310.
In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 296-300. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 296. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 297. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 298. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 299. In some aspects, the Chothia CDR-H2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 300.
In some aspects, the Chothia CDR-H1 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 286-290. In some aspects, the Chothia CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 286. In some aspects, the Chothia CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 287. In some aspects, the Chothia CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 288. In some aspects, the Chothia CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 289. In some aspects, the Chothia CDR-H1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 290.
2.3. V_HSequences
In some embodiments, the antibody comprises, consists of, or consists essentially of a V_Hsequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some embodiments, the antibody comprises, consists of, or consists essentially of a V_Hsequence provided in SEQ ID NOs.: 229-253.
In some embodiments, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 229-253. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 229. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 230. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 231. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 232. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 233. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 234. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 235. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 236. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 237. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 238. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 239. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 240. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 241. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 242. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 243. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 244. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 245. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 246. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 247. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 248. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 249. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 250. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 251. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 252. In some aspects, the antibody comprises a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 253.
2.3.1. Variants of V_HSequences
In some embodiments, the V_Hsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Hsequence provided in this disclosure.
In some aspects, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some aspects, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V_Hsequences provided in this disclosure.
In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of any of the illustrative V_Hsequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.3.2. Excluded V_HSequences
In some embodiments, the V_Hsequences provided herein do not comprise certain V_Hsequences.
In some aspects, the V_Hsequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 326-330. In some aspects, the V_Hsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 326. In some aspects, the V_Hsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 327. In some aspects, the V_Hsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 328. In some aspects, the V_Hsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 329. In some aspects, the V_Hsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 330.
2.4. CDR-L3 Sequences
In some embodiments, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a CDR-L3 sequence of an illustrative antibody or V_Lsequence provided herein. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of a V_Lsequence provided in SEQ ID NOs.: 254-278.
In some embodiments, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 201. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 202. In some aspects, the antibody comprises a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 203.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 321-325. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 321. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 322. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 323. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 324. In some aspects the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 325.
2.5. V_LSequences Comprising Illustrative CDRs
In some embodiments, the antibody comprises a V_Lsequence comprising one or more CDR-L sequences comprising, consisting of, or consisting essentially of one or more illustrative CDR-L sequences provided in this disclosure, and variants thereof.
2.5.1. CDR-L3
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence, wherein the CDR-L3 sequence comprises, consists of, or consists essentially of a CDR-L3 sequence of an illustrative antibody or V_Lsequence provided herein. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the CDR-L3 sequence is a CDR-L3 sequence of a V_Lsequence provided in SEQ ID NOs.: 254-278.
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 179. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 180. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 181. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 182. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 183. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 184. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 185. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 186. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 187. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 188. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 189. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 190. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 191. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 192. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 193. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 194. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 195. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 196. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 197. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 198. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 199. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 200. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 201. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 202. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 203.
2.5.2. CDR-L2
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence, wherein the CDR-L2 sequence comprises, consists of, or consists essentially of a CDR-L2 sequence of an illustrative antibody or V_Lsequence provided herein. In some aspects, the CDR-L2 sequence is a CDR-L2 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the CDR-L2 sequence is a CDR-L2 sequence of a V_Lsequence provided in SEQ ID NOs.: 254-278.
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 154. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 155. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 156. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 157. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 158. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 159. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 160. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 161. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 162. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 163. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 164. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 165. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 166. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 167. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 168. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 169. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 170. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 171. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 172. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 173. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 174. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 175. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 176. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 177. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 178.
2.5.3. CDR-L1
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence, wherein the CDR-L1 sequence comprises, consists of, or consists essentially of a CDR-L1 sequence of an illustrative antibody or V_Lsequence provided herein. In some aspects, the CDR-L1 sequence is a CDR-L1 sequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some aspects, the CDR-L1 sequence is a CDR-L1 sequence of a V_Lsequence provided in SEQ ID NOs.: 254-278.
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 129. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 130. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 131. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 132. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 133. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 134. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 135. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 136. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 137. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 138. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 139. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 140. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 141. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 142. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 143. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 144. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 145. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 146. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 147. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 148. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 149. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 150. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 151. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 152. In some aspects, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NO: 153.
2.5.4. CDR-L3+CDR-L2
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178. In some aspects, the CDR-L3 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOs: 254-278.
2.5.5. CDR-L3+CDR-L1
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203 and a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153. In some aspects, the CDR-L3 sequence and the CDR-L1 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some aspects, the CDR-L3 and CDR-L1 are both from a single illustrative V_Lsequence selected from SEQ ID NOs: 254-278.
2.5.6. CDR-L1+CDR-L2
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153 and a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178. In some aspects, the CDR-L1 sequence and the CDR-L2 sequence are both from a single illustrative V_Lsequence provided in this disclosure. For example, in some aspects, the CDR-L1 and CDR-L2 are both from a single illustrative V_Lsequence selected from SEQ ID NOs: 254-278.
2.5.7. CDR-L1+CDR-L2+CDR-L3
In some embodiments, the antibody comprises a V_Lsequence comprising a CDR-L1 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 129-153, a CDR-L2 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 154-178, and a CDR-L3 sequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 179-203. In some aspects, the CDR-L1 sequence, CDR-L2 sequence, and CDR-L3 sequence are all from a single illustrative V_Lsequence provided in this disclosure. For example, in some aspects, the CDR-L1, CDR-L2, and CDR-L3 are all from a single illustrative V_Lsequence selected from SEQ ID NOs: 254-278.
2.5.8. Variants of V_LSequences Comprising Illustrative CDR-Ls
In some embodiments, the V_Lsequences provided herein comprise a variant of an illustrative CDR-L3, CDR-L2, and/or CDR-L1 sequence provided in this disclosure.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L1 sequences provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.5.9. Excluded V_LSequences Comprising CDR-Ls
In some embodiments, the V_Lsequences provided herein do not comprise certain CDR-L3, CDR-L2, and/or CDR-L1 sequences.
In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 321-325. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 321. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 322. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 323. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 324. In some aspects, the CDR-L3 sequence does not comprise, consist of, or consist essentially of SEQ ID NOs: 325.
In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 316-320. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 316. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 317. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 318. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 319. In some aspects, the CDR-L2 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 320.
In some aspects, the CDR-L1 sequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 311-315. In some aspects, the CDR-L1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 311. In some aspects, the CDR-L1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 312. In some aspects, the CDR-L1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 313. In some aspects, the CDR-L1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 314. In some aspects, the CDR-L1 sequence does not comprise, consist of, or consist essentially of SEQ ID NO: 315.
2.6. V_LSequences
In some embodiments, the antibody comprises, consists of, or consists essentially of a V_Lsequence of an scFv-Fc sequence provided in SEQ ID NOs.: 204-228 or of an scFv sequence provided in SEQ ID NOs.: 337-361. In some embodiments, the antibody comprises, consists of, or consists essentially of a V_Lsequence provided in SEQ ID NOs.: 254-278.
In some embodiments, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of a sequence selected from SEQ ID NOs: 254-278. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 254. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 255. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 256. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 257. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 258. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 259. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 260. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 261. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 262. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 263. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 264. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 265. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 266. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 267. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 268. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 269. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 270. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 271. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 272. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 273. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 274. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 275. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 276. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 277. In some aspects, the antibody comprises a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NO: 278.
2.6.1. Variants of V_LSequences
In some embodiments, the V_Lsequences provided herein comprise, consist of, or consist essentially of a variant of an illustrative V_Lsequence provided in this disclosure.
In some aspects, the V_Lsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Lsequence provided in this disclosure. In some aspects, the V_Lsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V_Lsequences provided in this disclosure.
In some embodiments, the V_Lsequence comprises, consists of, or consists essentially of any of the illustrative V_Lsequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.6.2. Excluded V_LSequences
In some embodiments, the V_Lsequences provided herein do not comprise certain V_Lsequences.
In some aspects, the V_Lsequence does not comprise, consist of, or consist essentially of a sequence selected from SEQ ID NOs: 331-335. In some aspects, the V_Lsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 331. In some aspects, the V_Lsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 332. In some aspects, the V_Lsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 333. In some aspects, the V_Lsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 334. In some aspects, the V_Lsequence does not comprise, consist of, or consist essentially of SEQ ID NO: 335.
2.7. Pairs
2.7.1. CDR-H3-CDR-L3 Pairs
In some embodiments, the antibody comprises a CDR-H3 sequence and a CDR-L3 sequence. In some aspects, the CDR-H3 sequence is part of a V_Hand the CDR-L3 sequence is part of a V_L.
In some aspects, the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 104-128, and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 104 and SEQ ID NO: 179; SEQ ID NO: 104 and SEQ ID NO: 180; SEQ ID NO: 104 and SEQ ID NO: 181; SEQ ID NO: 104 and SEQ ID NO: 182; SEQ ID NO: 104 and SEQ ID NO: 183; SEQ ID NO: 104 and SEQ ID NO: 184; SEQ ID NO: 104 and SEQ ID NO: 185; SEQ ID NO: 104 and SEQ ID NO: 186; SEQ ID NO: 104 and SEQ ID NO: 187; SEQ ID NO: 104 and SEQ ID NO: 188; SEQ ID NO: 104 and SEQ ID NO: 189; SEQ ID NO: 104 and SEQ ID NO: 190; SEQ ID NO: 104 and SEQ ID NO: 191; SEQ ID NO: 104 and SEQ ID NO: 192; SEQ ID NO: 104 and SEQ ID NO: 193; SEQ ID NO: 104 and SEQ ID NO: 194; SEQ ID NO: 104 and SEQ ID NO: 195; SEQ ID NO: 104 and SEQ ID NO: 196; SEQ ID NO: 104 and SEQ ID NO: 197; SEQ ID NO: 104 and SEQ ID NO: 198; SEQ ID NO: 104 and SEQ ID NO: 199; SEQ ID NO: 104 and SEQ ID NO: 200; SEQ ID NO: 104 and SEQ ID NO: 201; SEQ ID NO: 104 and SEQ ID NO: 202; and SEQ ID NO: 104 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 105 and SEQ ID NO: 179; SEQ ID NO: 105 and SEQ ID NO: 180; SEQ ID NO: 105 and SEQ ID NO: 181; SEQ ID NO: 105 and SEQ ID NO: 182; SEQ ID NO: 105 and SEQ ID NO: 183; SEQ ID NO: 105 and SEQ ID NO: 184; SEQ ID NO: 105 and SEQ ID NO: 185; SEQ ID NO: 105 and SEQ ID NO: 186; SEQ ID NO: 105 and SEQ ID NO: 187; SEQ ID NO: 105 and SEQ ID NO: 188; SEQ ID NO: 105 and SEQ ID NO: 189; SEQ ID NO: 105 and SEQ ID NO: 190; SEQ ID NO: 105 and SEQ ID NO: 191; SEQ ID NO: 105 and SEQ ID NO: 192; SEQ ID NO: 105 and SEQ ID NO: 193; SEQ ID NO: 105 and SEQ ID NO: 194; SEQ ID NO: 105 and SEQ ID NO: 195; SEQ ID NO: 105 and SEQ ID NO: 196; SEQ ID NO: 105 and SEQ ID NO: 197; SEQ ID NO: 105 and SEQ ID NO: 198; SEQ ID NO: 105 and SEQ ID NO: 199; SEQ ID NO: 105 and SEQ ID NO: 200; SEQ ID NO: 105 and SEQ ID NO: 201; SEQ ID NO: 105 and SEQ ID NO: 202; and SEQ ID NO: 105 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 106 and SEQ ID NO: 179; SEQ ID NO: 106 and SEQ ID NO: 180; SEQ ID NO: 106 and SEQ ID NO: 181; SEQ ID NO: 106 and SEQ ID NO: 182; SEQ ID NO: 106 and SEQ ID NO: 183; SEQ ID NO: 106 and SEQ ID NO: 184; SEQ ID NO: 106 and SEQ ID NO: 185; SEQ ID NO: 106 and SEQ ID NO: 186; SEQ ID NO: 106 and SEQ ID NO: 187; SEQ ID NO: 106 and SEQ ID NO: 188; SEQ ID NO: 106 and SEQ ID NO: 189; SEQ ID NO: 106 and SEQ ID NO: 190; SEQ ID NO: 106 and SEQ ID NO: 191; SEQ ID NO: 106 and SEQ ID NO: 192; SEQ ID NO: 106 and SEQ ID NO: 193; SEQ ID NO: 106 and SEQ ID NO: 194; SEQ ID NO: 106 and SEQ ID NO: 195; SEQ ID NO: 106 and SEQ ID NO: 196; SEQ ID NO: 106 and SEQ ID NO: 197; SEQ ID NO: 106 and SEQ ID NO: 198; SEQ ID NO: 106 and SEQ ID NO: 199; SEQ ID NO: 106 and SEQ ID NO: 200; SEQ ID NO: 106 and SEQ ID NO: 201; SEQ ID NO: 106 and SEQ ID NO: 202; and SEQ ID NO: 106 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 107 and SEQ ID NO: 179; SEQ ID NO: 107 and SEQ ID NO: 180; SEQ ID NO: 107 and SEQ ID NO: 181; SEQ ID NO: 107 and SEQ ID NO: 182; SEQ ID NO: 107 and SEQ ID NO: 183; SEQ ID NO: 107 and SEQ ID NO: 184; SEQ ID NO: 107 and SEQ ID NO: 185; SEQ ID NO: 107 and SEQ ID NO: 186; SEQ ID NO: 107 and SEQ ID NO: 187; SEQ ID NO: 107 and SEQ ID NO: 188; SEQ ID NO: 107 and SEQ ID NO: 189; SEQ ID NO: 107 and SEQ ID NO: 190; SEQ ID NO: 107 and SEQ ID NO: 191; SEQ ID NO: 107 and SEQ ID NO: 192; SEQ ID NO: 107 and SEQ ID NO: 193; SEQ ID NO: 107 and SEQ ID NO: 194; SEQ ID NO: 107 and SEQ ID NO: 195; SEQ ID NO: 107 and SEQ ID NO: 196; SEQ ID NO: 107 and SEQ ID NO: 197; SEQ ID NO: 107 and SEQ ID NO: 198; SEQ ID NO: 107 and SEQ ID NO: 199; SEQ ID NO: 107 and SEQ ID NO: 200; SEQ ID NO: 107 and SEQ ID NO: 201; SEQ ID NO: 107 and SEQ ID NO: 202; and SEQ ID NO: 107 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 108 and SEQ ID NO: 179; SEQ ID NO: 108 and SEQ ID NO: 180; SEQ ID NO: 108 and SEQ ID NO: 181; SEQ ID NO: 108 and SEQ ID NO: 182; SEQ ID NO: 108 and SEQ ID NO: 183; SEQ ID NO: 108 and SEQ ID NO: 184; SEQ ID NO: 108 and SEQ ID NO: 185; SEQ ID NO: 108 and SEQ ID NO: 186; SEQ ID NO: 108 and SEQ ID NO: 187; SEQ ID NO: 108 and SEQ ID NO: 188; SEQ ID NO: 108 and SEQ ID NO: 189; SEQ ID NO: 108 and SEQ ID NO: 190; SEQ ID NO: 108 and SEQ ID NO: 191; SEQ ID NO: 108 and SEQ ID NO: 192; SEQ ID NO: 108 and SEQ ID NO: 193; SEQ ID NO: 108 and SEQ ID NO: 194; SEQ ID NO: 108 and SEQ ID NO: 195; SEQ ID NO: 108 and SEQ ID NO: 196; SEQ ID NO: 108 and SEQ ID NO: 197; SEQ ID NO: 108 and SEQ ID NO: 198; SEQ ID NO: 108 and SEQ ID NO: 199; SEQ ID NO: 108 and SEQ ID NO: 200; SEQ ID NO: 108 and SEQ ID NO: 201; SEQ ID NO: 108 and SEQ ID NO: 202; and SEQ ID NO: 108 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 109 and SEQ ID NO: 179; SEQ ID NO: 109 and SEQ ID NO: 180; SEQ ID NO: 109 and SEQ ID NO: 181; SEQ ID NO: 109 and SEQ ID NO: 182; SEQ ID NO: 109 and SEQ ID NO: 183; SEQ ID NO: 109 and SEQ ID NO: 184; SEQ ID NO: 109 and SEQ ID NO: 185; SEQ ID NO: 109 and SEQ ID NO: 186; SEQ ID NO: 109 and SEQ ID NO: 187; SEQ ID NO: 109 and SEQ ID NO: 188; SEQ ID NO: 109 and SEQ ID NO: 189; SEQ ID NO: 109 and SEQ ID NO: 190; SEQ ID NO: 109 and SEQ ID NO: 191; SEQ ID NO: 109 and SEQ ID NO: 192; SEQ ID NO: 109 and SEQ ID NO: 193; SEQ ID NO: 109 and SEQ ID NO: 194; SEQ ID NO: 109 and SEQ ID NO: 195; SEQ ID NO: 109 and SEQ ID NO: 196; SEQ ID NO: 109 and SEQ ID NO: 197; SEQ ID NO: 109 and SEQ ID NO: 198; SEQ ID NO: 109 and SEQ ID NO: 199; SEQ ID NO: 109 and SEQ ID NO: 200; SEQ ID NO: 109 and SEQ ID NO: 201; SEQ ID NO: 109 and SEQ ID NO: 202; and SEQ ID NO: 109 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 110 and SEQ ID NO: 179; SEQ ID NO: 110 and SEQ ID NO: 180; SEQ ID NO: 110 and SEQ ID NO: 181; SEQ ID NO: 110 and SEQ ID NO: 182; SEQ ID NO: 110 and SEQ ID NO: 183; SEQ ID NO: 110 and SEQ ID NO: 184; SEQ ID NO: 110 and SEQ ID NO: 185; SEQ ID NO: 110 and SEQ ID NO: 186; SEQ ID NO: 110 and SEQ ID NO: 187; SEQ ID NO: 110 and SEQ ID NO: 188; SEQ ID NO: 110 and SEQ ID NO: 189; SEQ ID NO: 110 and SEQ ID NO: 190; SEQ ID NO: 110 and SEQ ID NO: 191; SEQ ID NO: 110 and SEQ ID NO: 192; SEQ ID NO: 110 and SEQ ID NO: 193; SEQ ID NO: 110 and SEQ ID NO: 194; SEQ ID NO: 110 and SEQ ID NO: 195; SEQ ID NO: 110 and SEQ ID NO: 196; SEQ ID NO: 110 and SEQ ID NO: 197; SEQ ID NO: 110 and SEQ ID NO: 198; SEQ ID NO: 110 and SEQ ID NO: 199; SEQ ID NO: 110 and SEQ ID NO: 200; SEQ ID NO: 110 and SEQ ID NO: 201; SEQ ID NO: 110 and SEQ ID NO: 202; and SEQ ID NO: 110 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 111 and SEQ ID NO: 179; SEQ ID NO: 111 and SEQ ID NO: 180; SEQ ID NO: 111 and SEQ ID NO: 181; SEQ ID NO: 111 and SEQ ID NO: 182; SEQ ID NO: 111 and SEQ ID NO: 183; SEQ ID NO: 111 and SEQ ID NO: 184; SEQ ID NO: 111 and SEQ ID NO: 185; SEQ ID NO: 111 and SEQ ID NO: 186; SEQ ID NO: 111 and SEQ ID NO: 187; SEQ ID NO: 111 and SEQ ID NO: 188; SEQ ID NO: 111 and SEQ ID NO: 189; SEQ ID NO: 111 and SEQ ID NO: 190; SEQ ID NO: 111 and SEQ ID NO: 191; SEQ ID NO: 111 and SEQ ID NO: 192; SEQ ID NO: 111 and SEQ ID NO: 193; SEQ ID NO: 111 and SEQ ID NO: 194; SEQ ID NO: 111 and SEQ ID NO: 195; SEQ ID NO: 111 and SEQ ID NO: 196; SEQ ID NO: 111 and SEQ ID NO: 197; SEQ ID NO: 111 and SEQ ID NO: 198; SEQ ID NO: 111 and SEQ ID NO: 199; SEQ ID NO: 111 and SEQ ID NO: 200; SEQ ID NO: 111 and SEQ ID NO: 201; SEQ ID NO: 111 and SEQ ID NO: 202; and SEQ ID NO: 111 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 112 and SEQ ID NO: 179; SEQ ID NO: 112 and SEQ ID NO: 180; SEQ ID NO: 112 and SEQ ID NO: 181; SEQ ID NO: 112 and SEQ ID NO: 182; SEQ ID NO: 112 and SEQ ID NO: 183; SEQ ID NO: 112 and SEQ ID NO: 184; SEQ ID NO: 112 and SEQ ID NO: 185; SEQ ID NO: 112 and SEQ ID NO: 186; SEQ ID NO: 112 and SEQ ID NO: 187; SEQ ID NO: 112 and SEQ ID NO: 188; SEQ ID NO: 112 and SEQ ID NO: 189; SEQ ID NO: 112 and SEQ ID NO: 190; SEQ ID NO: 112 and SEQ ID NO: 191; SEQ ID NO: 112 and SEQ ID NO: 192; SEQ ID NO: 112 and SEQ ID NO: 193; SEQ ID NO: 112 and SEQ ID NO: 194; SEQ ID NO: 112 and SEQ ID NO: 195; SEQ ID NO: 112 and SEQ ID NO: 196; SEQ ID NO: 112 and SEQ ID NO: 197; SEQ ID NO: 112 and SEQ ID NO: 198; SEQ ID NO: 112 and SEQ ID NO: 199; SEQ ID NO: 112 and SEQ ID NO: 200; SEQ ID NO: 112 and SEQ ID NO: 201; SEQ ID NO: 112 and SEQ ID NO: 202; and SEQ ID NO: 112 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 113 and SEQ ID NO: 179; SEQ ID NO: 113 and SEQ ID NO: 180; SEQ ID NO: 113 and SEQ ID NO: 181; SEQ ID NO: 113 and SEQ ID NO: 182; SEQ ID NO: 113 and SEQ ID NO: 183; SEQ ID NO: 113 and SEQ ID NO: 184; SEQ ID NO: 113 and SEQ ID NO: 185; SEQ ID NO: 113 and SEQ ID NO: 186; SEQ ID NO: 113 and SEQ ID NO: 187; SEQ ID NO: 113 and SEQ ID NO: 188; SEQ ID NO: 113 and SEQ ID NO: 189; SEQ ID NO: 113 and SEQ ID NO: 190; SEQ ID NO: 113 and SEQ ID NO: 191; SEQ ID NO: 113 and SEQ ID NO: 192; SEQ ID NO: 113 and SEQ ID NO: 193; SEQ ID NO: 113 and SEQ ID NO: 194; SEQ ID NO: 113 and SEQ ID NO: 195; SEQ ID NO: 113 and SEQ ID NO: 196; SEQ ID NO: 113 and SEQ ID NO: 197; SEQ ID NO: 113 and SEQ ID NO: 198; SEQ ID NO: 113 and SEQ ID NO: 199; SEQ ID NO: 113 and SEQ ID NO: 200; SEQ ID NO: 113 and SEQ ID NO: 201; SEQ ID NO: 113 and SEQ ID NO: 202; and SEQ ID NO: 113 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 114 and SEQ ID NO: 179; SEQ ID NO: 114 and SEQ ID NO: 180; SEQ ID NO: 114 and SEQ ID NO: 181; SEQ ID NO: 114 and SEQ ID NO: 182; SEQ ID NO: 114 and SEQ ID NO: 183; SEQ ID NO: 114 and SEQ ID NO: 184; SEQ ID NO: 114 and SEQ ID NO: 185; SEQ ID NO: 114 and SEQ ID NO: 186; SEQ ID NO: 114 and SEQ ID NO: 187; SEQ ID NO: 114 and SEQ ID NO: 188; SEQ ID NO: 114 and SEQ ID NO: 189; SEQ ID NO: 114 and SEQ ID NO: 190; SEQ ID NO: 114 and SEQ ID NO: 191; SEQ ID NO: 114 and SEQ ID NO: 192; SEQ ID NO: 114 and SEQ ID NO: 193; SEQ ID NO: 114 and SEQ ID NO: 194; SEQ ID NO: 114 and SEQ ID NO: 195; SEQ ID NO: 114 and SEQ ID NO: 196; SEQ ID NO: 114 and SEQ ID NO: 197; SEQ ID NO: 114 and SEQ ID NO: 198; SEQ ID NO: 114 and SEQ ID NO: 199; SEQ ID NO: 114 and SEQ ID NO: 200; SEQ ID NO: 114 and SEQ ID NO: 201; SEQ ID NO: 114 and SEQ ID NO: 202; and SEQ ID NO: 114 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 115 and SEQ ID NO: 179; SEQ ID NO: 115 and SEQ ID NO: 180; SEQ ID NO: 115 and SEQ ID NO: 181; SEQ ID NO: 115 and SEQ ID NO: 182; SEQ ID NO: 115 and SEQ ID NO: 183; SEQ ID NO: 115 and SEQ ID NO: 184; SEQ ID NO: 115 and SEQ ID NO: 185; SEQ ID NO: 115 and SEQ ID NO: 186; SEQ ID NO: 115 and SEQ ID NO: 187; SEQ ID NO: 115 and SEQ ID NO: 188; SEQ ID NO: 115 and SEQ ID NO: 189; SEQ ID NO: 115 and SEQ ID NO: 190; SEQ ID NO: 115 and SEQ ID NO: 191; SEQ ID NO: 115 and SEQ ID NO: 192; SEQ ID NO: 115 and SEQ ID NO: 193; SEQ ID NO: 115 and SEQ ID NO: 194; SEQ ID NO: 115 and SEQ ID NO: 195; SEQ ID NO: 115 and SEQ ID NO: 196; SEQ ID NO: 115 and SEQ ID NO: 197; SEQ ID NO: 115 and SEQ ID NO: 198; SEQ ID NO: 115 and SEQ ID NO: 199; SEQ ID NO: 115 and SEQ ID NO: 200; SEQ ID NO: 115 and SEQ ID NO: 201; SEQ ID NO: 115 and SEQ ID NO: 202; and SEQ ID NO: 115 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 116 and SEQ ID NO: 179; SEQ ID NO: 116 and SEQ ID NO: 180; SEQ ID NO: 116 and SEQ ID NO: 181; SEQ ID NO: 116 and SEQ ID NO: 182; SEQ ID NO: 116 and SEQ ID NO: 183; SEQ ID NO: 116 and SEQ ID NO: 184; SEQ ID NO: 116 and SEQ ID NO: 185; SEQ ID NO: 116 and SEQ ID NO: 186; SEQ ID NO: 116 and SEQ ID NO: 187; SEQ ID NO: 116 and SEQ ID NO: 188; SEQ ID NO: 116 and SEQ ID NO: 189; SEQ ID NO: 116 and SEQ ID NO: 190; SEQ ID NO: 116 and SEQ ID NO: 191; SEQ ID NO: 116 and SEQ ID NO: 192; SEQ ID NO: 116 and SEQ ID NO: 193; SEQ ID NO: 116 and SEQ ID NO: 194; SEQ ID NO: 116 and SEQ ID NO: 195; SEQ ID NO: 116 and SEQ ID NO: 196; SEQ ID NO: 116 and SEQ ID NO: 197; SEQ ID NO: 116 and SEQ ID NO: 198; SEQ ID NO: 116 and SEQ ID NO: 199; SEQ ID NO: 116 and SEQ ID NO: 200; SEQ ID NO: 116 and SEQ ID NO: 201; SEQ ID NO: 116 and SEQ ID NO: 202; and SEQ ID NO: 116 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 117 and SEQ ID NO: 179; SEQ ID NO: 117 and SEQ ID NO: 180; SEQ ID NO: 117 and SEQ ID NO: 181; SEQ ID NO: 117 and SEQ ID NO: 182; SEQ ID NO: 117 and SEQ ID NO: 183; SEQ ID NO: 117 and SEQ ID NO: 184; SEQ ID NO: 117 and SEQ ID NO: 185; SEQ ID NO: 117 and SEQ ID NO: 186; SEQ ID NO: 117 and SEQ ID NO: 187; SEQ ID NO: 117 and SEQ ID NO: 188; SEQ ID NO: 117 and SEQ ID NO: 189; SEQ ID NO: 117 and SEQ ID NO: 190; SEQ ID NO: 117 and SEQ ID NO: 191; SEQ ID NO: 117 and SEQ ID NO: 192; SEQ ID NO: 117 and SEQ ID NO: 193; SEQ ID NO: 117 and SEQ ID NO: 194; SEQ ID NO: 117 and SEQ ID NO: 195; SEQ ID NO: 117 and SEQ ID NO: 196; SEQ ID NO: 117 and SEQ ID NO: 197; SEQ ID NO: 117 and SEQ ID NO: 198; SEQ ID NO: 117 and SEQ ID NO: 199; SEQ ID NO: 117 and SEQ ID NO: 200; SEQ ID NO: 117 and SEQ ID NO: 201; SEQ ID NO: 117 and SEQ ID NO: 202; and SEQ ID NO: 117 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 118 and SEQ ID NO: 179; SEQ ID NO: 118 and SEQ ID NO: 180; SEQ ID NO: 118 and SEQ ID NO: 181; SEQ ID NO: 118 and SEQ ID NO: 182; SEQ ID NO: 118 and SEQ ID NO: 183; SEQ ID NO: 118 and SEQ ID NO: 184; SEQ ID NO: 118 and SEQ ID NO: 185; SEQ ID NO: 118 and SEQ ID NO: 186; SEQ ID NO: 118 and SEQ ID NO: 187; SEQ ID NO: 118 and SEQ ID NO: 188; SEQ ID NO: 118 and SEQ ID NO: 189; SEQ ID NO: 118 and SEQ ID NO: 190; SEQ ID NO: 118 and SEQ ID NO: 191; SEQ ID NO: 118 and SEQ ID NO: 192; SEQ ID NO: 118 and SEQ ID NO: 193; SEQ ID NO: 118 and SEQ ID NO: 194; SEQ ID NO: 118 and SEQ ID NO: 195; SEQ ID NO: 118 and SEQ ID NO: 196; SEQ ID NO: 118 and SEQ ID NO: 197; SEQ ID NO: 118 and SEQ ID NO: 198; SEQ ID NO: 118 and SEQ ID NO: 199; SEQ ID NO: 118 and SEQ ID NO: 200; SEQ ID NO: 118 and SEQ ID NO: 201; SEQ ID NO: 118 and SEQ ID NO: 202; and SEQ ID NO: 118 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 119 and SEQ ID NO: 179; SEQ ID NO: 119 and SEQ ID NO: 180; SEQ ID NO: 119 and SEQ ID NO: 181; SEQ ID NO: 119 and SEQ ID NO: 182; SEQ ID NO: 119 and SEQ ID NO: 183; SEQ ID NO: 119 and SEQ ID NO: 184; SEQ ID NO: 119 and SEQ ID NO: 185; SEQ ID NO: 119 and SEQ ID NO: 186; SEQ ID NO: 119 and SEQ ID NO: 187; SEQ ID NO: 119 and SEQ ID NO: 188; SEQ ID NO: 119 and SEQ ID NO: 189; SEQ ID NO: 119 and SEQ ID NO: 190; SEQ ID NO: 119 and SEQ ID NO: 191; SEQ ID NO: 119 and SEQ ID NO: 192; SEQ ID NO: 119 and SEQ ID NO: 193; SEQ ID NO: 119 and SEQ ID NO: 194; SEQ ID NO: 119 and SEQ ID NO: 195; SEQ ID NO: 119 and SEQ ID NO: 196; SEQ ID NO: 119 and SEQ ID NO: 197; SEQ ID NO: 119 and SEQ ID NO: 198; SEQ ID NO: 119 and SEQ ID NO: 199; SEQ ID NO: 119 and SEQ ID NO: 200; SEQ ID NO: 119 and SEQ ID NO: 201; SEQ ID NO: 119 and SEQ ID NO: 202; and SEQ ID NO: 119 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 120 and SEQ ID NO: 179; SEQ ID NO: 120 and SEQ ID NO: 180; SEQ ID NO: 120 and SEQ ID NO: 181; SEQ ID NO: 120 and SEQ ID NO: 182; SEQ ID NO: 120 and SEQ ID NO: 183; SEQ ID NO: 120 and SEQ ID NO: 184; SEQ ID NO: 120 and SEQ ID NO: 185; SEQ ID NO: 120 and SEQ ID NO: 186; SEQ ID NO: 120 and SEQ ID NO: 187; SEQ ID NO: 120 and SEQ ID NO: 188; SEQ ID NO: 120 and SEQ ID NO: 189; SEQ ID NO: 120 and SEQ ID NO: 190; SEQ ID NO: 120 and SEQ ID NO: 191; SEQ ID NO: 120 and SEQ ID NO: 192; SEQ ID NO: 120 and SEQ ID NO: 193; SEQ ID NO: 120 and SEQ ID NO: 194; SEQ ID NO: 120 and SEQ ID NO: 195; SEQ ID NO: 120 and SEQ ID NO: 196; SEQ ID NO: 120 and SEQ ID NO: 197; SEQ ID NO: 120 and SEQ ID NO: 198; SEQ ID NO: 120 and SEQ ID NO: 199; SEQ ID NO: 120 and SEQ ID NO: 200; SEQ ID NO: 120 and SEQ ID NO: 201; SEQ ID NO: 120 and SEQ ID NO: 202; and SEQ ID NO: 120 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 121 and SEQ ID NO: 179; SEQ ID NO: 121 and SEQ ID NO: 180; SEQ ID NO: 121 and SEQ ID NO: 181; SEQ ID NO: 121 and SEQ ID NO: 182; SEQ ID NO: 121 and SEQ ID NO: 183; SEQ ID NO: 121 and SEQ ID NO: 184; SEQ ID NO: 121 and SEQ ID NO: 185; SEQ ID NO: 121 and SEQ ID NO: 186; SEQ ID NO: 121 and SEQ ID NO: 187; SEQ ID NO: 121 and SEQ ID NO: 188; SEQ ID NO: 121 and SEQ ID NO: 189; SEQ ID NO: 121 and SEQ ID NO: 190; SEQ ID NO: 121 and SEQ ID NO: 191; SEQ ID NO: 121 and SEQ ID NO: 192; SEQ ID NO: 121 and SEQ ID NO: 193; SEQ ID NO: 121 and SEQ ID NO: 194; SEQ ID NO: 121 and SEQ ID NO: 195; SEQ ID NO: 121 and SEQ ID NO: 196; SEQ ID NO: 121 and SEQ ID NO: 197; SEQ ID NO: 121 and SEQ ID NO: 198; SEQ ID NO: 121 and SEQ ID NO: 199; SEQ ID NO: 121 and SEQ ID NO: 200; SEQ ID NO: 121 and SEQ ID NO: 201; SEQ ID NO: 121 and SEQ ID NO: 202; and SEQ ID NO: 121 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 122 and SEQ ID NO: 179; SEQ ID NO: 122 and SEQ ID NO: 180; SEQ ID NO: 122 and SEQ ID NO: 181; SEQ ID NO: 122 and SEQ ID NO: 182; SEQ ID NO: 122 and SEQ ID NO: 183; SEQ ID NO: 122 and SEQ ID NO: 184; SEQ ID NO: 122 and SEQ ID NO: 185; SEQ ID NO: 122 and SEQ ID NO: 186; SEQ ID NO: 122 and SEQ ID NO: 187; SEQ ID NO: 122 and SEQ ID NO: 188; SEQ ID NO: 122 and SEQ ID NO: 189; SEQ ID NO: 122 and SEQ ID NO: 190; SEQ ID NO: 122 and SEQ ID NO: 191; SEQ ID NO: 122 and SEQ ID NO: 192; SEQ ID NO: 122 and SEQ ID NO: 193; SEQ ID NO: 122 and SEQ ID NO: 194; SEQ ID NO: 122 and SEQ ID NO: 195; SEQ ID NO: 122 and SEQ ID NO: 196; SEQ ID NO: 122 and SEQ ID NO: 197; SEQ ID NO: 122 and SEQ ID NO: 198; SEQ ID NO: 122 and SEQ ID NO: 199; SEQ ID NO: 122 and SEQ ID NO: 200; SEQ ID NO: 122 and SEQ ID NO: 201; SEQ ID NO: 122 and SEQ ID NO: 202; and SEQ ID NO: 122 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 123 and SEQ ID NO: 179; SEQ ID NO: 123 and SEQ ID NO: 180; SEQ ID NO: 123 and SEQ ID NO: 181; SEQ ID NO: 123 and SEQ ID NO: 182; SEQ ID NO: 123 and SEQ ID NO: 183; SEQ ID NO: 123 and SEQ ID NO: 184; SEQ ID NO: 123 and SEQ ID NO: 185; SEQ ID NO: 123 and SEQ ID NO: 186; SEQ ID NO: 123 and SEQ ID NO: 187; SEQ ID NO: 123 and SEQ ID NO: 188; SEQ ID NO: 123 and SEQ ID NO: 189; SEQ ID NO: 123 and SEQ ID NO: 190; SEQ ID NO: 123 and SEQ ID NO: 191; SEQ ID NO: 123 and SEQ ID NO: 192; SEQ ID NO: 123 and SEQ ID NO: 193; SEQ ID NO: 123 and SEQ ID NO: 194; SEQ ID NO: 123 and SEQ ID NO: 195; SEQ ID NO: 123 and SEQ ID NO: 196; SEQ ID NO: 123 and SEQ ID NO: 197; SEQ ID NO: 123 and SEQ ID NO: 198; SEQ ID NO: 123 and SEQ ID NO: 199; SEQ ID NO: 123 and SEQ ID NO: 200; SEQ ID NO: 123 and SEQ ID NO: 201; SEQ ID NO: 123 and SEQ ID NO: 202; and SEQ ID NO: 123 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 124 and SEQ ID NO: 179; SEQ ID NO: 124 and SEQ ID NO: 180; SEQ ID NO: 124 and SEQ ID NO: 181; SEQ ID NO: 124 and SEQ ID NO: 182; SEQ ID NO: 124 and SEQ ID NO: 183; SEQ ID NO: 124 and SEQ ID NO: 184; SEQ ID NO: 124 and SEQ ID NO: 185; SEQ ID NO: 124 and SEQ ID NO: 186; SEQ ID NO: 124 and SEQ ID NO: 187; SEQ ID NO: 124 and SEQ ID NO: 188; SEQ ID NO: 124 and SEQ ID NO: 189; SEQ ID NO: 124 and SEQ ID NO: 190; SEQ ID NO: 124 and SEQ ID NO: 191; SEQ ID NO: 124 and SEQ ID NO: 192; SEQ ID NO: 124 and SEQ ID NO: 193; SEQ ID NO: 124 and SEQ ID NO: 194; SEQ ID NO: 124 and SEQ ID NO: 195; SEQ ID NO: 124 and SEQ ID NO: 196; SEQ ID NO: 124 and SEQ ID NO: 197; SEQ ID NO: 124 and SEQ ID NO: 198; SEQ ID NO: 124 and SEQ ID NO: 199; SEQ ID NO: 124 and SEQ ID NO: 200; SEQ ID NO: 124 and SEQ ID NO: 201; SEQ ID NO: 124 and SEQ ID NO: 202; and SEQ ID NO: 124 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 125 and SEQ ID NO: 179; SEQ ID NO: 125 and SEQ ID NO: 180; SEQ ID NO: 125 and SEQ ID NO: 181; SEQ ID NO: 125 and SEQ ID NO: 182; SEQ ID NO: 125 and SEQ ID NO: 183; SEQ ID NO: 125 and SEQ ID NO: 184; SEQ ID NO: 125 and SEQ ID NO: 185; SEQ ID NO: 125 and SEQ ID NO: 186; SEQ ID NO: 125 and SEQ ID NO: 187; SEQ ID NO: 125 and SEQ ID NO: 188; SEQ ID NO: 125 and SEQ ID NO: 189; SEQ ID NO: 125 and SEQ ID NO: 190; SEQ ID NO: 125 and SEQ ID NO: 191; SEQ ID NO: 125 and SEQ ID NO: 192; SEQ ID NO: 125 and SEQ ID NO: 193; SEQ ID NO: 125 and SEQ ID NO: 194; SEQ ID NO: 125 and SEQ ID NO: 195; SEQ ID NO: 125 and SEQ ID NO: 196; SEQ ID NO: 125 and SEQ ID NO: 197; SEQ ID NO: 125 and SEQ ID NO: 198; SEQ ID NO: 125 and SEQ ID NO: 199; SEQ ID NO: 125 and SEQ ID NO: 200; SEQ ID NO: 125 and SEQ ID NO: 201; SEQ ID NO: 125 and SEQ ID NO: 202; and SEQ ID NO: 125 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 126 and SEQ ID NO: 179; SEQ ID NO: 126 and SEQ ID NO: 180; SEQ ID NO: 126 and SEQ ID NO: 181; SEQ ID NO: 126 and SEQ ID NO: 182; SEQ ID NO: 126 and SEQ ID NO: 183; SEQ ID NO: 126 and SEQ ID NO: 184; SEQ ID NO: 126 and SEQ ID NO: 185; SEQ ID NO: 126 and SEQ ID NO: 186; SEQ ID NO: 126 and SEQ ID NO: 187; SEQ ID NO: 126 and SEQ ID NO: 188; SEQ ID NO: 126 and SEQ ID NO: 189; SEQ ID NO: 126 and SEQ ID NO: 190; SEQ ID NO: 126 and SEQ ID NO: 191; SEQ ID NO: 126 and SEQ ID NO: 192; SEQ ID NO: 126 and SEQ ID NO: 193; SEQ ID NO: 126 and SEQ ID NO: 194; SEQ ID NO: 126 and SEQ ID NO: 195; SEQ ID NO: 126 and SEQ ID NO: 196; SEQ ID NO: 126 and SEQ ID NO: 197; SEQ ID NO: 126 and SEQ ID NO: 198; SEQ ID NO: 126 and SEQ ID NO: 199; SEQ ID NO: 126 and SEQ ID NO: 200; SEQ ID NO: 126 and SEQ ID NO: 201; SEQ ID NO: 126 and SEQ ID NO: 202; and SEQ ID NO: 126 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 127 and SEQ ID NO: 179; SEQ ID NO: 127 and SEQ ID NO: 180; SEQ ID NO: 127 and SEQ ID NO: 181; SEQ ID NO: 127 and SEQ ID NO: 182; SEQ ID NO: 127 and SEQ ID NO: 183; SEQ ID NO: 127 and SEQ ID NO: 184; SEQ ID NO: 127 and SEQ ID NO: 185; SEQ ID NO: 127 and SEQ ID NO: 186; SEQ ID NO: 127 and SEQ ID NO: 187; SEQ ID NO: 127 and SEQ ID NO: 188; SEQ ID NO: 127 and SEQ ID NO: 189; SEQ ID NO: 127 and SEQ ID NO: 190; SEQ ID NO: 127 and SEQ ID NO: 191; SEQ ID NO: 127 and SEQ ID NO: 192; SEQ ID NO: 127 and SEQ ID NO: 193; SEQ ID NO: 127 and SEQ ID NO: 194; SEQ ID NO: 127 and SEQ ID NO: 195; SEQ ID NO: 127 and SEQ ID NO: 196; SEQ ID NO: 127 and SEQ ID NO: 197; SEQ ID NO: 127 and SEQ ID NO: 198; SEQ ID NO: 127 and SEQ ID NO: 199; SEQ ID NO: 127 and SEQ ID NO: 200; SEQ ID NO: 127 and SEQ ID NO: 201; SEQ ID NO: 127 and SEQ ID NO: 202; and SEQ ID NO: 127 and SEQ ID NO: 203.
In some aspects, the CDR-H3-CDR-L3 pairs are selected from SEQ ID NO: 128 and SEQ ID NO: 179; SEQ ID NO: 128 and SEQ ID NO: 180; SEQ ID NO: 128 and SEQ ID NO: 181; SEQ ID NO: 128 and SEQ ID NO: 182; SEQ ID NO: 128 and SEQ ID NO: 183; SEQ ID NO: 128 and SEQ ID NO: 184; SEQ ID NO: 128 and SEQ ID NO: 185; SEQ ID NO: 128 and SEQ ID NO: 186; SEQ ID NO: 128 and SEQ ID NO: 187; SEQ ID NO: 128 and SEQ ID NO: 188; SEQ ID NO: 128 and SEQ ID NO: 189; SEQ ID NO: 128 and SEQ ID NO: 190; SEQ ID NO: 128 and SEQ ID NO: 191; SEQ ID NO: 128 and SEQ ID NO: 192; SEQ ID NO: 128 and SEQ ID NO: 193; SEQ ID NO: 128 and SEQ ID NO: 194; SEQ ID NO: 128 and SEQ ID NO: 195; SEQ ID NO: 128 and SEQ ID NO: 196; SEQ ID NO: 128 and SEQ ID NO: 197; SEQ ID NO: 128 and SEQ ID NO: 198; SEQ ID NO: 128 and SEQ ID NO: 199; SEQ ID NO: 128 and SEQ ID NO: 200; SEQ ID NO: 128 and SEQ ID NO: 201; SEQ ID NO: 128 and SEQ ID NO: 202; and SEQ ID NO: 128 and SEQ ID NO: 203.
2.7.1.1. Variants of CDR-H3-CDR-L3 Pairs
In some embodiments, the CDR-H3-CDR-L3 pairs provided herein comprise a variant of an illustrative CDR-H3 and/or CDR-L1 sequence provided in this disclosure.
In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.1.2. Excluded CDR-H3-CDR-L3 Pairs
In some embodiments, the CDR-H3-CDR-L3 pairs provided herein do not comprise certain CDR-H3-CDR-L3 pairs.
In some aspects, the CDR-H3 sequence is not selected from SEQ ID NOs: 306-310, and the CDR-L3 sequence is not selected from SEQ ID NOs: 321-325.
In some aspects, the CDR-H3-CDR-L3 pairs are not selected from SEQ ID NO: 306 and SEQ ID NO: 321; SEQ ID NO: 306 and SEQ ID NO: 322; SEQ ID NO: 306 and SEQ ID NO: 323; SEQ ID NO: 306 and SEQ ID NO: 324; and SEQ ID NO: 306 and SEQ ID NO: 325.
In some aspects, the CDR-H3-CDR-L3 pairs are not selected from SEQ ID NO: 307 and SEQ ID NO: 321; SEQ ID NO: 307 and SEQ ID NO: 322; SEQ ID NO: 307 and SEQ ID NO: 323; SEQ ID NO: 307 and SEQ ID NO: 324; and SEQ ID NO: 307 and SEQ ID NO: 325.
In some aspects, the CDR-H3-CDR-L3 pairs are not selected from SEQ ID NO: 308 and SEQ ID NO: 321; SEQ ID NO: 308 and SEQ ID NO: 322; SEQ ID NO: 308 and SEQ ID NO: 323; SEQ ID NO: 308 and SEQ ID NO: 324; and SEQ ID NO: 308 and SEQ ID NO: 325.
In some aspects, the CDR-H3-CDR-L3 pairs are not selected from SEQ ID NO: 309 and SEQ ID NO: 321; SEQ ID NO: 309 and SEQ ID NO: 322; SEQ ID NO: 309 and SEQ ID NO: 323; SEQ ID NO: 309 and SEQ ID NO: 324; and SEQ ID NO: 309 and SEQ ID NO: 325.
In some aspects, the CDR-H3-CDR-L3 pairs are not selected from SEQ ID NO: 310 and SEQ ID NO: 321; SEQ ID NO: 310 and SEQ ID NO: 322; SEQ ID NO: 310 and SEQ ID NO: 323; SEQ ID NO: 310 and SEQ ID NO: 324; and SEQ ID NO: 310 and SEQ ID NO: 325.
2.7.2. CDR-H1-CDR-L1 Pairs
In some embodiments, the antibody comprises a CDR-H1 sequence and a CDR-L1 sequence. In some aspects, the CDR-H1 sequence is part of a V_Hand the CDR-L1 sequence is part of a V_L.
In some aspects, the CDR-H1 sequence is a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 4-28, and the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153.
In some aspects, the CDR-H1 sequence is a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 29-53, and the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153.
2.7.2.1. Variants of CDR-H1-CDR-L1 Pairs
In some embodiments, the CDR-H1-CDR-L1 pairs provided herein comprise a variant of an illustrative CDR-H1 and/or CDR-L1 sequence provided in this disclosure.
In some aspects, the CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H1 sequence provided in this disclosure. In some aspects, the CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H1 sequences provided in this disclosure. In some aspects, the CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L1 sequences provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.2.2. Excluded CDR-H1-CDR-L1 Pairs
In some embodiments, the CDR-H1-CDR-L1 pairs provided herein do not comprise certain CDR-H1-CDR-L1 pairs.
In some aspects, the Chothia CDR-H1 sequence is not selected from SEQ ID NOs: 286-290, and the CDR-L1 sequence is not selected from SEQ ID NOs: 311-315. In some aspects, the Kabat CDR-H1 sequence is not selected from SEQ ID NOs: 290-295, and the CDR-L1 sequence is not selected from SEQ ID NOs: 311-315.
2.7.3. CDR-H2-CDR-L2 Pairs
In some embodiments, the antibody comprises a CDR-H2 sequence and a CDR-L2 sequence. In some aspects, the CDR-H2 sequence is part of a V_Hand the CDR-L2 sequence is part of a V_L.
In some aspects, the CDR-H2 sequence is a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 54-78, and the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178.
In some aspects, the CDR-H1 sequence is a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 79-103, and the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178.
2.7.3.1. Variants of CDR-H2-CDR-L2 Pairs
In some embodiments, the CDR-H2-CDR-L2 pairs provided herein comprise a variant of an illustrative CDR-H2 and/or CDR-L2 sequence provided in this disclosure.
In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H2 sequence provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H2 sequences provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.3.2. Excluded CDR-H2-CDR-L2 Pairs
In some embodiments, the CDR-H2-CDR-L2 pairs provided herein do not comprise certain CDR-H2-CDR-L2 pairs.
In some aspects, the Chothia CDR-H2 sequence is not selected from SEQ ID NOs: 296-300, and the CDR-L2 sequence is not selected from SEQ ID NOs: 316-320. In some aspects, the Kabat CDR-H2 sequence is not selected from SEQ ID NOs: 301-305, and the CDR-L2 sequence is not selected from SEQ ID NOs: 316-320.
2.7.4. V_HV_LPairs
In some embodiments, the antibody comprises a V_Hsequence and a V_Lsequence.
In some aspects, the V_Hsequence is a V_Hsequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 229-253, and the V_Lsequence is a V_Lsequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 254-278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 229 and SEQ ID NO: 254; SEQ ID NO: 229 and SEQ ID NO: 255; SEQ ID NO: 229 and SEQ ID NO: 256; SEQ ID NO: 229 and SEQ ID NO: 257; SEQ ID NO: 229 and SEQ ID NO: 258; SEQ ID NO: 229 and SEQ ID NO: 259; SEQ ID NO: 229 and SEQ ID NO: 260; SEQ ID NO: 229 and SEQ ID NO: 261; SEQ ID NO: 229 and SEQ ID NO: 262; SEQ ID NO: 229 and SEQ ID NO: 263; SEQ ID NO: 229 and SEQ ID NO: 264; SEQ ID NO: 229 and SEQ ID NO: 265; SEQ ID NO: 229 and SEQ ID NO: 266; SEQ ID NO: 229 and SEQ ID NO: 267; SEQ ID NO: 229 and SEQ ID NO: 268; SEQ ID NO: 229 and SEQ ID NO: 269; SEQ ID NO: 229 and SEQ ID NO: 270; SEQ ID NO: 229 and SEQ ID NO: 271; SEQ ID NO: 229 and SEQ ID NO: 272; SEQ ID NO: 229 and SEQ ID NO: 273; SEQ ID NO: 229 and SEQ ID NO: 274; SEQ ID NO: 229 and SEQ ID NO: 275; SEQ ID NO: 229 and SEQ ID NO: 276; SEQ ID NO: 229 and SEQ ID NO: 277; and SEQ ID NO: 229 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 230 and SEQ ID NO: 254; SEQ ID NO: 230 and SEQ ID NO: 255; SEQ ID NO: 230 and SEQ ID NO: 256; SEQ ID NO: 230 and SEQ ID NO: 257; SEQ ID NO: 230 and SEQ ID NO: 258; SEQ ID NO: 230 and SEQ ID NO: 259; SEQ ID NO: 230 and SEQ ID NO: 260; SEQ ID NO: 230 and SEQ ID NO: 261; SEQ ID NO: 230 and SEQ ID NO: 262; SEQ ID NO: 230 and SEQ ID NO: 263; SEQ ID NO: 230 and SEQ ID NO: 264; SEQ ID NO: 230 and SEQ ID NO: 265; SEQ ID NO: 230 and SEQ ID NO: 266; SEQ ID NO: 230 and SEQ ID NO: 267; SEQ ID NO: 230 and SEQ ID NO: 268; SEQ ID NO: 230 and SEQ ID NO: 269; SEQ ID NO: 230 and SEQ ID NO: 270; SEQ ID NO: 230 and SEQ ID NO: 271; SEQ ID NO: 230 and SEQ ID NO: 272; SEQ ID NO: 230 and SEQ ID NO: 273; SEQ ID NO: 230 and SEQ ID NO: 274; SEQ ID NO: 230 and SEQ ID NO: 275; SEQ ID NO: 230 and SEQ ID NO: 276; SEQ ID NO: 230 and SEQ ID NO: 277; and SEQ ID NO: 230 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 231 and SEQ ID NO: 254; SEQ ID NO: 231 and SEQ ID NO: 255; SEQ ID NO: 231 and SEQ ID NO: 256; SEQ ID NO: 231 and SEQ ID NO: 257; SEQ ID NO: 231 and SEQ ID NO: 258; SEQ ID NO: 231 and SEQ ID NO: 259; SEQ ID NO: 231 and SEQ ID NO: 260; SEQ ID NO: 231 and SEQ ID NO: 261; SEQ ID NO: 231 and SEQ ID NO: 262; SEQ ID NO: 231 and SEQ ID NO: 263; SEQ ID NO: 231 and SEQ ID NO: 264; SEQ ID NO: 231 and SEQ ID NO: 265; SEQ ID NO: 231 and SEQ ID NO: 266; SEQ ID NO: 231 and SEQ ID NO: 267; SEQ ID NO: 231 and SEQ ID NO: 268; SEQ ID NO: 231 and SEQ ID NO: 269; SEQ ID NO: 231 and SEQ ID NO: 270; SEQ ID NO: 231 and SEQ ID NO: 271; SEQ ID NO: 231 and SEQ ID NO: 272; SEQ ID NO: 231 and SEQ ID NO: 273; SEQ ID NO: 231 and SEQ ID NO: 274; SEQ ID NO: 231 and SEQ ID NO: 275; SEQ ID NO: 231 and SEQ ID NO: 276; SEQ ID NO: 231 and SEQ ID NO: 277; and SEQ ID NO: 231 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 232 and SEQ ID NO: 254; SEQ ID NO: 232 and SEQ ID NO: 255; SEQ ID NO: 232 and SEQ ID NO: 256; SEQ ID NO: 232 and SEQ ID NO: 257; SEQ ID NO: 232 and SEQ ID NO: 258; SEQ ID NO: 232 and SEQ ID NO: 259; SEQ ID NO: 232 and SEQ ID NO: 260; SEQ ID NO: 232 and SEQ ID NO: 261; SEQ ID NO: 232 and SEQ ID NO: 262; SEQ ID NO: 232 and SEQ ID NO: 263; SEQ ID NO: 232 and SEQ ID NO: 264; SEQ ID NO: 232 and SEQ ID NO: 265; SEQ ID NO: 232 and SEQ ID NO: 266; SEQ ID NO: 232 and SEQ ID NO: 267; SEQ ID NO: 232 and SEQ ID NO: 268; SEQ ID NO: 232 and SEQ ID NO: 269; SEQ ID NO: 232 and SEQ ID NO: 270; SEQ ID NO: 232 and SEQ ID NO: 271; SEQ ID NO: 232 and SEQ ID NO: 272; SEQ ID NO: 232 and SEQ ID NO: 273; SEQ ID NO: 232 and SEQ ID NO: 274; SEQ ID NO: 232 and SEQ ID NO: 275; SEQ ID NO: 232 and SEQ ID NO: 276; SEQ ID NO: 232 and SEQ ID NO: 277; and SEQ ID NO: 232 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 233 and SEQ ID NO: 254; SEQ ID NO: 233 and SEQ ID NO: 255; SEQ ID NO: 233 and SEQ ID NO: 256; SEQ ID NO: 233 and SEQ ID NO: 257; SEQ ID NO: 233 and SEQ ID NO: 258; SEQ ID NO: 233 and SEQ ID NO: 259; SEQ ID NO: 233 and SEQ ID NO: 260; SEQ ID NO: 233 and SEQ ID NO: 261; SEQ ID NO: 233 and SEQ ID NO: 262; SEQ ID NO: 233 and SEQ ID NO: 263; SEQ ID NO: 233 and SEQ ID NO: 264; SEQ ID NO: 233 and SEQ ID NO: 265; SEQ ID NO: 233 and SEQ ID NO: 266; SEQ ID NO: 233 and SEQ ID NO: 267; SEQ ID NO: 233 and SEQ ID NO: 268; SEQ ID NO: 233 and SEQ ID NO: 269; SEQ ID NO: 233 and SEQ ID NO: 270; SEQ ID NO: 233 and SEQ ID NO: 271; SEQ ID NO: 233 and SEQ ID NO: 272; SEQ ID NO: 233 and SEQ ID NO: 273; SEQ ID NO: 233 and SEQ ID NO: 274; SEQ ID NO: 233 and SEQ ID NO: 275; SEQ ID NO: 233 and SEQ ID NO: 276; SEQ ID NO: 233 and SEQ ID NO: 277; and SEQ ID NO: 233 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 234 and SEQ ID NO: 254; SEQ ID NO: 234 and SEQ ID NO: 255; SEQ ID NO: 234 and SEQ ID NO: 256; SEQ ID NO: 234 and SEQ ID NO: 257; SEQ ID NO: 234 and SEQ ID NO: 258; SEQ ID NO: 234 and SEQ ID NO: 259; SEQ ID NO: 234 and SEQ ID NO: 260; SEQ ID NO: 234 and SEQ ID NO: 261; SEQ ID NO: 234 and SEQ ID NO: 262; SEQ ID NO: 234 and SEQ ID NO: 263; SEQ ID NO: 234 and SEQ ID NO: 264; SEQ ID NO: 234 and SEQ ID NO: 265; SEQ ID NO: 234 and SEQ ID NO: 266; SEQ ID NO: 234 and SEQ ID NO: 267; SEQ ID NO: 234 and SEQ ID NO: 268; SEQ ID NO: 234 and SEQ ID NO: 269; SEQ ID NO: 234 and SEQ ID NO: 270; SEQ ID NO: 234 and SEQ ID NO: 271; SEQ ID NO: 234 and SEQ ID NO: 272; SEQ ID NO: 234 and SEQ ID NO: 273; SEQ ID NO: 234 and SEQ ID NO: 274; SEQ ID NO: 234 and SEQ ID NO: 275; SEQ ID NO: 234 and SEQ ID NO: 276; SEQ ID NO: 234 and SEQ ID NO: 277; and SEQ ID NO: 234 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 235 and SEQ ID NO: 254; SEQ ID NO: 235 and SEQ ID NO: 255; SEQ ID NO: 235 and SEQ ID NO: 256; SEQ ID NO: 235 and SEQ ID NO: 257; SEQ ID NO: 235 and SEQ ID NO: 258; SEQ ID NO: 235 and SEQ ID NO: 259; SEQ ID NO: 235 and SEQ ID NO: 260; SEQ ID NO: 235 and SEQ ID NO: 261; SEQ ID NO: 235 and SEQ ID NO: 262; SEQ ID NO: 235 and SEQ ID NO: 263; SEQ ID NO: 235 and SEQ ID NO: 264; SEQ ID NO: 235 and SEQ ID NO: 265; SEQ ID NO: 235 and SEQ ID NO: 266; SEQ ID NO: 235 and SEQ ID NO: 267; SEQ ID NO: 235 and SEQ ID NO: 268; SEQ ID NO: 235 and SEQ ID NO: 269; SEQ ID NO: 235 and SEQ ID NO: 270; SEQ ID NO: 235 and SEQ ID NO: 271; SEQ ID NO: 235 and SEQ ID NO: 272; SEQ ID NO: 235 and SEQ ID NO: 273; SEQ ID NO: 235 and SEQ ID NO: 274; SEQ ID NO: 235 and SEQ ID NO: 275; SEQ ID NO: 235 and SEQ ID NO: 276; SEQ ID NO: 235 and SEQ ID NO: 277; and SEQ ID NO: 235 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 236 and SEQ ID NO: 254; SEQ ID NO: 236 and SEQ ID NO: 255; SEQ ID NO: 236 and SEQ ID NO: 256; SEQ ID NO: 236 and SEQ ID NO: 257; SEQ ID NO: 236 and SEQ ID NO: 258; SEQ ID NO: 236 and SEQ ID NO: 259; SEQ ID NO: 236 and SEQ ID NO: 260; SEQ ID NO: 236 and SEQ ID NO: 261; SEQ ID NO: 236 and SEQ ID NO: 262; SEQ ID NO: 236 and SEQ ID NO: 263; SEQ ID NO: 236 and SEQ ID NO: 264; SEQ ID NO: 236 and SEQ ID NO: 265; SEQ ID NO: 236 and SEQ ID NO: 266; SEQ ID NO: 236 and SEQ ID NO: 267; SEQ ID NO: 236 and SEQ ID NO: 268; SEQ ID NO: 236 and SEQ ID NO: 269; SEQ ID NO: 236 and SEQ ID NO: 270; SEQ ID NO: 236 and SEQ ID NO: 271; SEQ ID NO: 236 and SEQ ID NO: 272; SEQ ID NO: 236 and SEQ ID NO: 273; SEQ ID NO: 236 and SEQ ID NO: 274; SEQ ID NO: 236 and SEQ ID NO: 275; SEQ ID NO: 236 and SEQ ID NO: 276; SEQ ID NO: 236 and SEQ ID NO: 277; and SEQ ID NO: 236 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 237 and SEQ ID NO: 254; SEQ ID NO: 237 and SEQ ID NO: 255; SEQ ID NO: 237 and SEQ ID NO: 256; SEQ ID NO: 237 and SEQ ID NO: 257; SEQ ID NO: 237 and SEQ ID NO: 258; SEQ ID NO: 237 and SEQ ID NO: 259; SEQ ID NO: 237 and SEQ ID NO: 260; SEQ ID NO: 237 and SEQ ID NO: 261; SEQ ID NO: 237 and SEQ ID NO: 262; SEQ ID NO: 237 and SEQ ID NO: 263; SEQ ID NO: 237 and SEQ ID NO: 264; SEQ ID NO: 237 and SEQ ID NO: 265; SEQ ID NO: 237 and SEQ ID NO: 266; SEQ ID NO: 237 and SEQ ID NO: 267; SEQ ID NO: 237 and SEQ ID NO: 268; SEQ ID NO: 237 and SEQ ID NO: 269; SEQ ID NO: 237 and SEQ ID NO: 270; SEQ ID NO: 237 and SEQ ID NO: 271; SEQ ID NO: 237 and SEQ ID NO: 272; SEQ ID NO: 237 and SEQ ID NO: 273; SEQ ID NO: 237 and SEQ ID NO: 274; SEQ ID NO: 237 and SEQ ID NO: 275; SEQ ID NO: 237 and SEQ ID NO: 276; SEQ ID NO: 237 and SEQ ID NO: 277; and SEQ ID NO: 237 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 238 and SEQ ID NO: 254; SEQ ID NO: 238 and SEQ ID NO: 255; SEQ ID NO: 238 and SEQ ID NO: 256; SEQ ID NO: 238 and SEQ ID NO: 257; SEQ ID NO: 238 and SEQ ID NO: 258; SEQ ID NO: 238 and SEQ ID NO: 259; SEQ ID NO: 238 and SEQ ID NO: 260; SEQ ID NO: 238 and SEQ ID NO: 261; SEQ ID NO: 238 and SEQ ID NO: 262; SEQ ID NO: 238 and SEQ ID NO: 263; SEQ ID NO: 238 and SEQ ID NO: 264; SEQ ID NO: 238 and SEQ ID NO: 265; SEQ ID NO: 238 and SEQ ID NO: 266; SEQ ID NO: 238 and SEQ ID NO: 267; SEQ ID NO: 238 and SEQ ID NO: 268; SEQ ID NO: 238 and SEQ ID NO: 269; SEQ ID NO: 238 and SEQ ID NO: 270; SEQ ID NO: 238 and SEQ ID NO: 271; SEQ ID NO: 238 and SEQ ID NO: 272; SEQ ID NO: 238 and SEQ ID NO: 273; SEQ ID NO: 238 and SEQ ID NO: 274; SEQ ID NO: 238 and SEQ ID NO: 275; SEQ ID NO: 238 and SEQ ID NO: 276; SEQ ID NO: 238 and SEQ ID NO: 277; and SEQ ID NO: 238 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 239 and SEQ ID NO: 254; SEQ ID NO: 239 and SEQ ID NO: 255; SEQ ID NO: 239 and SEQ ID NO: 256; SEQ ID NO: 239 and SEQ ID NO: 257; SEQ ID NO: 239 and SEQ ID NO: 258; SEQ ID NO: 239 and SEQ ID NO: 259; SEQ ID NO: 239 and SEQ ID NO: 260; SEQ ID NO: 239 and SEQ ID NO: 261; SEQ ID NO: 239 and SEQ ID NO: 262; SEQ ID NO: 239 and SEQ ID NO: 263; SEQ ID NO: 239 and SEQ ID NO: 264; SEQ ID NO: 239 and SEQ ID NO: 265; SEQ ID NO: 239 and SEQ ID NO: 266; SEQ ID NO: 239 and SEQ ID NO: 267; SEQ ID NO: 239 and SEQ ID NO: 268; SEQ ID NO: 239 and SEQ ID NO: 269; SEQ ID NO: 239 and SEQ ID NO: 270; SEQ ID NO: 239 and SEQ ID NO: 271; SEQ ID NO: 239 and SEQ ID NO: 272; SEQ ID NO: 239 and SEQ ID NO: 273; SEQ ID NO: 239 and SEQ ID NO: 274; SEQ ID NO: 239 and SEQ ID NO: 275; SEQ ID NO: 239 and SEQ ID NO: 276; SEQ ID NO: 239 and SEQ ID NO: 277; and SEQ ID NO: 239 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 240 and SEQ ID NO: 254; SEQ ID NO: 240 and SEQ ID NO: 255; SEQ ID NO: 240 and SEQ ID NO: 256; SEQ ID NO: 240 and SEQ ID NO: 257; SEQ ID NO: 240 and SEQ ID NO: 258; SEQ ID NO: 240 and SEQ ID NO: 259; SEQ ID NO: 240 and SEQ ID NO: 260; SEQ ID NO: 240 and SEQ ID NO: 261; SEQ ID NO: 240 and SEQ ID NO: 262; SEQ ID NO: 240 and SEQ ID NO: 263; SEQ ID NO: 240 and SEQ ID NO: 264; SEQ ID NO: 240 and SEQ ID NO: 265; SEQ ID NO: 240 and SEQ ID NO: 266; SEQ ID NO: 240 and SEQ ID NO: 267; SEQ ID NO: 240 and SEQ ID NO: 268; SEQ ID NO: 240 and SEQ ID NO: 269; SEQ ID NO: 240 and SEQ ID NO: 270; SEQ ID NO: 240 and SEQ ID NO: 271; SEQ ID NO: 240 and SEQ ID NO: 272; SEQ ID NO: 240 and SEQ ID NO: 273; SEQ ID NO: 240 and SEQ ID NO: 274; SEQ ID NO: 240 and SEQ ID NO: 275; SEQ ID NO: 240 and SEQ ID NO: 276; SEQ ID NO: 240 and SEQ ID NO: 277; and SEQ ID NO: 240 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 241 and SEQ ID NO: 254; SEQ ID NO: 241 and SEQ ID NO: 255; SEQ ID NO: 241 and SEQ ID NO: 256; SEQ ID NO: 241 and SEQ ID NO: 257; SEQ ID NO: 241 and SEQ ID NO: 258; SEQ ID NO: 241 and SEQ ID NO: 259; SEQ ID NO: 241 and SEQ ID NO: 260; SEQ ID NO: 241 and SEQ ID NO: 261; SEQ ID NO: 241 and SEQ ID NO: 262; SEQ ID NO: 241 and SEQ ID NO: 263; SEQ ID NO: 241 and SEQ ID NO: 264; SEQ ID NO: 241 and SEQ ID NO: 265; SEQ ID NO: 241 and SEQ ID NO: 266; SEQ ID NO: 241 and SEQ ID NO: 267; SEQ ID NO: 241 and SEQ ID NO: 268; SEQ ID NO: 241 and SEQ ID NO: 269; SEQ ID NO: 241 and SEQ ID NO: 270; SEQ ID NO: 241 and SEQ ID NO: 271; SEQ ID NO: 241 and SEQ ID NO: 272; SEQ ID NO: 241 and SEQ ID NO: 273; SEQ ID NO: 241 and SEQ ID NO: 274; SEQ ID NO: 241 and SEQ ID NO: 275; SEQ ID NO: 241 and SEQ ID NO: 276; SEQ ID NO: 241 and SEQ ID NO: 277; and SEQ ID NO: 241 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 242 and SEQ ID NO: 254; SEQ ID NO: 242 and SEQ ID NO: 255; SEQ ID NO: 242 and SEQ ID NO: 256; SEQ ID NO: 242 and SEQ ID NO: 257; SEQ ID NO: 242 and SEQ ID NO: 258; SEQ ID NO: 242 and SEQ ID NO: 259; SEQ ID NO: 242 and SEQ ID NO: 260; SEQ ID NO: 242 and SEQ ID NO: 261; SEQ ID NO: 242 and SEQ ID NO: 262; SEQ ID NO: 242 and SEQ ID NO: 263; SEQ ID NO: 242 and SEQ ID NO: 264; SEQ ID NO: 242 and SEQ ID NO: 265; SEQ ID NO: 242 and SEQ ID NO: 266; SEQ ID NO: 242 and SEQ ID NO: 267; SEQ ID NO: 242 and SEQ ID NO: 268; SEQ ID NO: 242 and SEQ ID NO: 269; SEQ ID NO: 242 and SEQ ID NO: 270; SEQ ID NO: 242 and SEQ ID NO: 271; SEQ ID NO: 242 and SEQ ID NO: 272; SEQ ID NO: 242 and SEQ ID NO: 273; SEQ ID NO: 242 and SEQ ID NO: 274; SEQ ID NO: 242 and SEQ ID NO: 275; SEQ ID NO: 242 and SEQ ID NO: 276; SEQ ID NO: 242 and SEQ ID NO: 277; and SEQ ID NO: 242 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 243 and SEQ ID NO: 254; SEQ ID NO: 243 and SEQ ID NO: 255; SEQ ID NO: 243 and SEQ ID NO: 256; SEQ ID NO: 243 and SEQ ID NO: 257; SEQ ID NO: 243 and SEQ ID NO: 258; SEQ ID NO: 243 and SEQ ID NO: 259; SEQ ID NO: 243 and SEQ ID NO: 260; SEQ ID NO: 243 and SEQ ID NO: 261; SEQ ID NO: 243 and SEQ ID NO: 262; SEQ ID NO: 243 and SEQ ID NO: 263; SEQ ID NO: 243 and SEQ ID NO: 264; SEQ ID NO: 243 and SEQ ID NO: 265; SEQ ID NO: 243 and SEQ ID NO: 266; SEQ ID NO: 243 and SEQ ID NO: 267; SEQ ID NO: 243 and SEQ ID NO: 268; SEQ ID NO: 243 and SEQ ID NO: 269; SEQ ID NO: 243 and SEQ ID NO: 270; SEQ ID NO: 243 and SEQ ID NO: 271; SEQ ID NO: 243 and SEQ ID NO: 272; SEQ ID NO: 243 and SEQ ID NO: 273; SEQ ID NO: 243 and SEQ ID NO: 274; SEQ ID NO: 243 and SEQ ID NO: 275; SEQ ID NO: 243 and SEQ ID NO: 276; SEQ ID NO: 243 and SEQ ID NO: 277; and SEQ ID NO: 243 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 244 and SEQ ID NO: 254; SEQ ID NO: 244 and SEQ ID NO: 255; SEQ ID NO: 244 and SEQ ID NO: 256; SEQ ID NO: 244 and SEQ ID NO: 257; SEQ ID NO: 244 and SEQ ID NO: 258; SEQ ID NO: 244 and SEQ ID NO: 259; SEQ ID NO: 244 and SEQ ID NO: 260; SEQ ID NO: 244 and SEQ ID NO: 261; SEQ ID NO: 244 and SEQ ID NO: 262; SEQ ID NO: 244 and SEQ ID NO: 263; SEQ ID NO: 244 and SEQ ID NO: 264; SEQ ID NO: 244 and SEQ ID NO: 265; SEQ ID NO: 244 and SEQ ID NO: 266; SEQ ID NO: 244 and SEQ ID NO: 267; SEQ ID NO: 244 and SEQ ID NO: 268; SEQ ID NO: 244 and SEQ ID NO: 269; SEQ ID NO: 244 and SEQ ID NO: 270; SEQ ID NO: 244 and SEQ ID NO: 271; SEQ ID NO: 244 and SEQ ID NO: 272; SEQ ID NO: 244 and SEQ ID NO: 273; SEQ ID NO: 244 and SEQ ID NO: 274; SEQ ID NO: 244 and SEQ ID NO: 275; SEQ ID NO: 244 and SEQ ID NO: 276; SEQ ID NO: 244 and SEQ ID NO: 277; and SEQ ID NO: 244 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 245 and SEQ ID NO: 254; SEQ ID NO: 245 and SEQ ID NO: 255; SEQ ID NO: 245 and SEQ ID NO: 256; SEQ ID NO: 245 and SEQ ID NO: 257; SEQ ID NO: 245 and SEQ ID NO: 258; SEQ ID NO: 245 and SEQ ID NO: 259; SEQ ID NO: 245 and SEQ ID NO: 260; SEQ ID NO: 245 and SEQ ID NO: 261; SEQ ID NO: 245 and SEQ ID NO: 262; SEQ ID NO: 245 and SEQ ID NO: 263; SEQ ID NO: 245 and SEQ ID NO: 264; SEQ ID NO: 245 and SEQ ID NO: 265; SEQ ID NO: 245 and SEQ ID NO: 266; SEQ ID NO: 245 and SEQ ID NO: 267; SEQ ID NO: 245 and SEQ ID NO: 268; SEQ ID NO: 245 and SEQ ID NO: 269; SEQ ID NO: 245 and SEQ ID NO: 270; SEQ ID NO: 245 and SEQ ID NO: 271; SEQ ID NO: 245 and SEQ ID NO: 272; SEQ ID NO: 245 and SEQ ID NO: 273; SEQ ID NO: 245 and SEQ ID NO: 274; SEQ ID NO: 245 and SEQ ID NO: 275; SEQ ID NO: 245 and SEQ ID NO: 276; SEQ ID NO: 245 and SEQ ID NO: 277; and SEQ ID NO: 245 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 246 and SEQ ID NO: 254; SEQ ID NO: 246 and SEQ ID NO: 255; SEQ ID NO: 246 and SEQ ID NO: 256; SEQ ID NO: 246 and SEQ ID NO: 257; SEQ ID NO: 246 and SEQ ID NO: 258; SEQ ID NO: 246 and SEQ ID NO: 259; SEQ ID NO: 246 and SEQ ID NO: 260; SEQ ID NO: 246 and SEQ ID NO: 261; SEQ ID NO: 246 and SEQ ID NO: 262; SEQ ID NO: 246 and SEQ ID NO: 263; SEQ ID NO: 246 and SEQ ID NO: 264; SEQ ID NO: 246 and SEQ ID NO: 265; SEQ ID NO: 246 and SEQ ID NO: 266; SEQ ID NO: 246 and SEQ ID NO: 267; SEQ ID NO: 246 and SEQ ID NO: 268; SEQ ID NO: 246 and SEQ ID NO: 269; SEQ ID NO: 246 and SEQ ID NO: 270; SEQ ID NO: 246 and SEQ ID NO: 271; SEQ ID NO: 246 and SEQ ID NO: 272; SEQ ID NO: 246 and SEQ ID NO: 273; SEQ ID NO: 246 and SEQ ID NO: 274; SEQ ID NO: 246 and SEQ ID NO: 275; SEQ ID NO: 246 and SEQ ID NO: 276; SEQ ID NO: 246 and SEQ ID NO: 277; and SEQ ID NO: 246 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 247 and SEQ ID NO: 254; SEQ ID NO: 247 and SEQ ID NO: 255; SEQ ID NO: 247 and SEQ ID NO: 256; SEQ ID NO: 247 and SEQ ID NO: 257; SEQ ID NO: 247 and SEQ ID NO: 258; SEQ ID NO: 247 and SEQ ID NO: 259; SEQ ID NO: 247 and SEQ ID NO: 260; SEQ ID NO: 247 and SEQ ID NO: 261; SEQ ID NO: 247 and SEQ ID NO: 262; SEQ ID NO: 247 and SEQ ID NO: 263; SEQ ID NO: 247 and SEQ ID NO: 264; SEQ ID NO: 247 and SEQ ID NO: 265; SEQ ID NO: 247 and SEQ ID NO: 266; SEQ ID NO: 247 and SEQ ID NO: 267; SEQ ID NO: 247 and SEQ ID NO: 268; SEQ ID NO: 247 and SEQ ID NO: 269; SEQ ID NO: 247 and SEQ ID NO: 270; SEQ ID NO: 247 and SEQ ID NO: 271; SEQ ID NO: 247 and SEQ ID NO: 272; SEQ ID NO: 247 and SEQ ID NO: 273; SEQ ID NO: 247 and SEQ ID NO: 274; SEQ ID NO: 247 and SEQ ID NO: 275; SEQ ID NO: 247 and SEQ ID NO: 276; SEQ ID NO: 247 and SEQ ID NO: 277; and SEQ ID NO: 247 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 248 and SEQ ID NO: 254; SEQ ID NO: 248 and SEQ ID NO: 255; SEQ ID NO: 248 and SEQ ID NO: 256; SEQ ID NO: 248 and SEQ ID NO: 257; SEQ ID NO: 248 and SEQ ID NO: 258; SEQ ID NO: 248 and SEQ ID NO: 259; SEQ ID NO: 248 and SEQ ID NO: 260; SEQ ID NO: 248 and SEQ ID NO: 261; SEQ ID NO: 248 and SEQ ID NO: 262; SEQ ID NO: 248 and SEQ ID NO: 263; SEQ ID NO: 248 and SEQ ID NO: 264; SEQ ID NO: 248 and SEQ ID NO: 265; SEQ ID NO: 248 and SEQ ID NO: 266; SEQ ID NO: 248 and SEQ ID NO: 267; SEQ ID NO: 248 and SEQ ID NO: 268; SEQ ID NO: 248 and SEQ ID NO: 269; SEQ ID NO: 248 and SEQ ID NO: 270; SEQ ID NO: 248 and SEQ ID NO: 271; SEQ ID NO: 248 and SEQ ID NO: 272; SEQ ID NO: 248 and SEQ ID NO: 273; SEQ ID NO: 248 and SEQ ID NO: 274; SEQ ID NO: 248 and SEQ ID NO: 275; SEQ ID NO: 248 and SEQ ID NO: 276; SEQ ID NO: 248 and SEQ ID NO: 277; and SEQ ID NO: 248 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 249 and SEQ ID NO: 254; SEQ ID NO: 249 and SEQ ID NO: 255; SEQ ID NO: 249 and SEQ ID NO: 256; SEQ ID NO: 249 and SEQ ID NO: 257; SEQ ID NO: 249 and SEQ ID NO: 258; SEQ ID NO: 249 and SEQ ID NO: 259; SEQ ID NO: 249 and SEQ ID NO: 260; SEQ ID NO: 249 and SEQ ID NO: 261; SEQ ID NO: 249 and SEQ ID NO: 262; SEQ ID NO: 249 and SEQ ID NO: 263; SEQ ID NO: 249 and SEQ ID NO: 264; SEQ ID NO: 249 and SEQ ID NO: 265; SEQ ID NO: 249 and SEQ ID NO: 266; SEQ ID NO: 249 and SEQ ID NO: 267; SEQ ID NO: 249 and SEQ ID NO: 268; SEQ ID NO: 249 and SEQ ID NO: 269; SEQ ID NO: 249 and SEQ ID NO: 270; SEQ ID NO: 249 and SEQ ID NO: 271; SEQ ID NO: 249 and SEQ ID NO: 272; SEQ ID NO: 249 and SEQ ID NO: 273; SEQ ID NO: 249 and SEQ ID NO: 274; SEQ ID NO: 249 and SEQ ID NO: 275; SEQ ID NO: 249 and SEQ ID NO: 276; SEQ ID NO: 249 and SEQ ID NO: 277; and SEQ ID NO: 249 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 250 and SEQ ID NO: 254; SEQ ID NO: 250 and SEQ ID NO: 255; SEQ ID NO: 250 and SEQ ID NO: 256; SEQ ID NO: 250 and SEQ ID NO: 257; SEQ ID NO: 250 and SEQ ID NO: 258; SEQ ID NO: 250 and SEQ ID NO: 259; SEQ ID NO: 250 and SEQ ID NO: 260; SEQ ID NO: 250 and SEQ ID NO: 261; SEQ ID NO: 250 and SEQ ID NO: 262; SEQ ID NO: 250 and SEQ ID NO: 263; SEQ ID NO: 250 and SEQ ID NO: 264; SEQ ID NO: 250 and SEQ ID NO: 265; SEQ ID NO: 250 and SEQ ID NO: 266; SEQ ID NO: 250 and SEQ ID NO: 267; SEQ ID NO: 250 and SEQ ID NO: 268; SEQ ID NO: 250 and SEQ ID NO: 269; SEQ ID NO: 250 and SEQ ID NO: 270; SEQ ID NO: 250 and SEQ ID NO: 271; SEQ ID NO: 250 and SEQ ID NO: 272; SEQ ID NO: 250 and SEQ ID NO: 273; SEQ ID NO: 250 and SEQ ID NO: 274; SEQ ID NO: 250 and SEQ ID NO: 275; SEQ ID NO: 250 and SEQ ID NO: 276; SEQ ID NO: 250 and SEQ ID NO: 277; and SEQ ID NO: 250 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 251 and SEQ ID NO: 254; SEQ ID NO: 251 and SEQ ID NO: 255; SEQ ID NO: 251 and SEQ ID NO: 256; SEQ ID NO: 251 and SEQ ID NO: 257; SEQ ID NO: 251 and SEQ ID NO: 258; SEQ ID NO: 251 and SEQ ID NO: 259; SEQ ID NO: 251 and SEQ ID NO: 260; SEQ ID NO: 251 and SEQ ID NO: 261; SEQ ID NO: 251 and SEQ ID NO: 262; SEQ ID NO: 251 and SEQ ID NO: 263; SEQ ID NO: 251 and SEQ ID NO: 264; SEQ ID NO: 251 and SEQ ID NO: 265; SEQ ID NO: 251 and SEQ ID NO: 266; SEQ ID NO: 251 and SEQ ID NO: 267; SEQ ID NO: 251 and SEQ ID NO: 268; SEQ ID NO: 251 and SEQ ID NO: 269; SEQ ID NO: 251 and SEQ ID NO: 270; SEQ ID NO: 251 and SEQ ID NO: 271; SEQ ID NO: 251 and SEQ ID NO: 272; SEQ ID NO: 251 and SEQ ID NO: 273; SEQ ID NO: 251 and SEQ ID NO: 274; SEQ ID NO: 251 and SEQ ID NO: 275; SEQ ID NO: 251 and SEQ ID NO: 276; SEQ ID NO: 251 and SEQ ID NO: 277; and SEQ ID NO: 251 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 252 and SEQ ID NO: 254; SEQ ID NO: 252 and SEQ ID NO: 255; SEQ ID NO: 252 and SEQ ID NO: 256; SEQ ID NO: 252 and SEQ ID NO: 257; SEQ ID NO: 252 and SEQ ID NO: 258; SEQ ID NO: 252 and SEQ ID NO: 259; SEQ ID NO: 252 and SEQ ID NO: 260; SEQ ID NO: 252 and SEQ ID NO: 261; SEQ ID NO: 252 and SEQ ID NO: 262; SEQ ID NO: 252 and SEQ ID NO: 263; SEQ ID NO: 252 and SEQ ID NO: 264; SEQ ID NO: 252 and SEQ ID NO: 265; SEQ ID NO: 252 and SEQ ID NO: 266; SEQ ID NO: 252 and SEQ ID NO: 267; SEQ ID NO: 252 and SEQ ID NO: 268; SEQ ID NO: 252 and SEQ ID NO: 269; SEQ ID NO: 252 and SEQ ID NO: 270; SEQ ID NO: 252 and SEQ ID NO: 271; SEQ ID NO: 252 and SEQ ID NO: 272; SEQ ID NO: 252 and SEQ ID NO: 273; SEQ ID NO: 252 and SEQ ID NO: 274; SEQ ID NO: 252 and SEQ ID NO: 275; SEQ ID NO: 252 and SEQ ID NO: 276; SEQ ID NO: 252 and SEQ ID NO: 277; and SEQ ID NO: 252 and SEQ ID NO: 278.
In some aspects, the V_H-V_Lpairs are selected from SEQ ID NO: 253 and SEQ ID NO: 254; SEQ ID NO: 253 and SEQ ID NO: 255; SEQ ID NO: 253 and SEQ ID NO: 256; SEQ ID NO: 253 and SEQ ID NO: 257; SEQ ID NO: 253 and SEQ ID NO: 258; SEQ ID NO: 253 and SEQ ID NO: 259; SEQ ID NO: 253 and SEQ ID NO: 260; SEQ ID NO: 253 and SEQ ID NO: 261; SEQ ID NO: 253 and SEQ ID NO: 262; SEQ ID NO: 253 and SEQ ID NO: 263; SEQ ID NO: 253 and SEQ ID NO: 264; SEQ ID NO: 253 and SEQ ID NO: 265; SEQ ID NO: 253 and SEQ ID NO: 266; SEQ ID NO: 253 and SEQ ID NO: 267; SEQ ID NO: 253 and SEQ ID NO: 268; SEQ ID NO: 253 and SEQ ID NO: 269; SEQ ID NO: 253 and SEQ ID NO: 270; SEQ ID NO: 253 and SEQ ID NO: 271; SEQ ID NO: 253 and SEQ ID NO: 272; SEQ ID NO: 253 and SEQ ID NO: 273; SEQ ID NO: 253 and SEQ ID NO: 274; SEQ ID NO: 253 and SEQ ID NO: 275; SEQ ID NO: 253 and SEQ ID NO: 276; SEQ ID NO: 253 and SEQ ID NO: 277; and SEQ ID NO: 253 and SEQ ID NO: 278. 2.7.4.1. Variants of V_HV_LPairs
In some embodiments, the V_H-V_Lpairs provided herein comprise a variant of an illustrative V_Hand/or V_Lsequence provided in this disclosure.
In some aspects, the V_Hsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Hsequence provided in this disclosure. In some aspects, the V_Hsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.1% identity with any of the illustrative V_Hsequences provided in this disclosure.
In some embodiments, the V_Hsequence comprises, consists of, or consists essentially of any of the illustrative V_Hsequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the V_Lsequence comprises, consists of, or consists essentially of a variant of an illustrative V_Lsequence provided in this disclosure. In some aspects, the V_Lsequence comprises, consists of, or consists essentially of a sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 99.5% identity with any of the illustrative V_Lsequences provided in this disclosure.
In some embodiments, the V_Lsequence comprises, consists of, or consists essentially of any of the illustrative V_Lsequences provided in this disclosure having 20 or fewer, 19 or fewer, 18 or fewer, 17 or fewer, 16 or fewer, 15 or fewer, 14 or fewer, 13 or fewer, 12 or fewer, 11 or fewer, 10 or fewer, 9 or fewer, 8 or fewer, 7 or fewer, 6 or fewer, 5 or fewer, 4 or fewer, 3 or fewer, 2 or fewer, or 1 or fewer amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.7.4.2. Excluded V_H-V_LPairs
In some embodiments, the V_H-V_Lpairs provided herein do not comprise certain V_H-V_Lpairs.
In some aspects, the V_Hsequence is not selected from SEQ ID NOs: 326-330, and the V_Lsequence is not selected from SEQ ID NOs: 331-335.
In some aspects, the V_H-V_Lpairs are not selected from SEQ ID NO: 326 and SEQ ID NO: 331; SEQ ID NO: 326 and SEQ ID NO: 332; SEQ ID NO: 326 and SEQ ID NO: 333; SEQ ID NO: 326 and SEQ ID NO: 334; and SEQ ID NO: 326 and SEQ ID NO: 335.
In some aspects, the V_H-V_Lpairs are not selected from SEQ ID NO: 327 and SEQ ID NO: 331; SEQ ID NO: 327 and SEQ ID NO: 332; SEQ ID NO: 327 and SEQ ID NO: 333; SEQ ID NO: 327 and SEQ ID NO: 334; and SEQ ID NO: 327 and SEQ ID NO: 335.
In some aspects, the V_H-V_Lpairs are not selected from SEQ ID NO: 328 and SEQ ID NO: 331; SEQ ID NO: 328 and SEQ ID NO: 332; SEQ ID NO: 328 and SEQ ID NO: 333; SEQ ID NO: 328 and SEQ ID NO: 334; and SEQ ID NO: 328 and SEQ ID NO: 335.
In some aspects, the V_H-V_Lpairs are not selected from SEQ ID NO: 329 and SEQ ID NO: 331; SEQ ID NO: 329 and SEQ ID NO: 332; SEQ ID NO: 329 and SEQ ID NO: 333; SEQ ID NO: 329 and SEQ ID NO: 334; and SEQ ID NO: 329 and SEQ ID NO: 335.
In some aspects, the V_H-V_Lpairs are not selected from SEQ ID NO: 330 and SEQ ID NO: 331; SEQ ID NO: 330 and SEQ ID NO: 332; SEQ ID NO: 330 and SEQ ID NO: 333; SEQ ID NO: 330 and SEQ ID NO: 334; and SEQ ID NO: 330 and SEQ ID NO: 335.
2.8. Antibodies Comprising All Six CDRs
In some embodiments, the antibody comprises a CDR-H1 sequence, a CDR-H2 sequence, a CDR-H3 sequence, a CDR-L1 sequence, and a CDR-L3 sequence. In some aspects, the CDR sequences are part of a V_H(for CDR-H) or V_L(for CDR-L).
In some aspects, the CDR-H1 sequence is a Chothia CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 4-28; the CDR-H2 sequence is a Chothia CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 59-78; the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 104-128; the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153; the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178; and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-203.
In some aspects, the CDR-H1 sequence is a Kabat CDR-H1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 29-53; the CDR-H2 sequence is a Kabat CDR-H2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 79-103; the CDR-H3 sequence is a CDR-H3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 104-128; the CDR-L1 sequence is a CDR-L1 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 129-153; the CDR-L2 sequence is a CDR-L2 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 154-178; and the CDR-L3 sequence is a CDR-L3 sequence comprising, consisting of, or consisting essentially of SEQ ID NOs: 179-203.
2.8.1. Variants of Antibodies Comprising All Six CDRs
In some embodiments, the CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 provided herein comprise a variant of an illustrative CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and/or CDR-L3 sequence provided in this disclosure.
In some aspects, the CDR-H1 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia or Kabat CDR-H1 sequence provided in this disclosure. In some aspects, the CDR-H1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia or Kabat CDR-H1 sequences provided in this disclosure. In some aspects, the CDR-H1 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia or Kabat CDR-H1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a variant of an illustrative Chothia or Kabat CDR-H2 sequence provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative Chothia or Kabat CDR-H2 sequences provided in this disclosure. In some aspects, the CDR-H2 sequence comprises, consists of, or consists essentially of any of the illustrative Chothia or Kabat CDR-H2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-H3 sequence provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-H3 sequences provided in this disclosure. In some aspects, the CDR-H3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-H3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L1 sequence provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L1 sequences provided in this disclosure. In some aspects, the CDR-L1 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L1 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L2 sequence provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L2 sequences provided in this disclosure. In some aspects, the CDR-L2 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L2 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a variant of an illustrative CDR-L3 sequence provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of a sequence having at least 70%, 75%, 80%, 85%, 90%, or 95% identity with any of the illustrative CDR-L3 sequences provided in this disclosure. In some aspects, the CDR-L3 sequence comprises, consists of, or consists essentially of any of the illustrative CDR-L3 sequences provided in this disclosure, with 1, 2, or 3 amino acid substitutions. In some aspects, the amino acid substitutions are conservative amino acid substitutions.
2.8.2. Excluded Six CDR Combinations
In some embodiments, the CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and CDR-L3 provided herein do not comprise certain CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2, and/or CDR-L3.
In some aspects, the Chothia CDR-H1 sequence is not selected from SEQ ID NOs: 286-290; the Kabat CDR-H1 sequence is not selected from SEQ ID NOs: 291-295; the Chothia CDR-H2 sequence is not selected from SEQ ID NOs: 296-300; the Kabat CDR-H2 sequence is not selected from SEQ ID NOs: 301-305; the CDR-H3 sequence is not selected from 306-310; the CDR-L1 sequence is not selected from SEQ ID NOs: 311-315; the CDR-L2 sequence is not selected from SEQ ID NOs: 316-320; and/or the CDR-L3 sequence is not selected from SEQ ID NOs: 321-325.
2.9. Consensus Sequences
In some embodiments, provided herein are anti-EpCAM antibodies comprising one or more sequences defined by consensus sequences. Each consensus sequence is based, at least in part, on one or more alignments of two or more useful anti-EpCAM CDR sequences provided in this disclosure. Based on such alignments, a person of skill in the art would recognize that different amino acid residues may useful in certain positions of the CDRs. Accordingly, each consensus sequence encompasses two or more useful anti-EpCAM CDR sequences.
In some embodiments, the antibodies comprise one to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise two to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise three to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise four to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise five to six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise six of the consensus CDR sequences provided herein. In some embodiments, the antibodies comprise a V_Lcomprising the CDR-L consensus sequence(s). In some embodiments, the antibodies comprise a V_Hcomprising the CDR-H consensus sequence(s). In some embodiments, the antibodies comprise a V_Hcomprising the CDR-H consensus sequence(s) and a V_Lcomprising the CDR-L consensus sequence(s).
2.9.1. CDR-H3 Consensus Sequences
In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence α₁-W-α₃-α₄-Q-α₆-α₇-Y-α₉-α₁₀-D-Y, where α₁is G, A, or D; α₃is H or N; α₄is P, D, or R; α₆is T, S, or D; α₇is L, M, or Y; α₉is D, G, H, or N; and am is L, Q, R, or V.
In some embodiments, the antibody comprises a CDR-H3 sequence defined by the consensus sequence L-R-N-W-ß₅-ß₆-P-M-D-Y, where ß₅is E or D; and ß₆is G or M.
2.9.2. Chothia CDR-H1 Consensus Sequences
In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence G-F-T-F-γ₅-γ₆-γ₇, where γ₅is S, R, G, or C; γ₆is G, V, A, or S; and γ₇is S, T, A, C, E, or F.
In some embodiments, the antibody comprises a Chothia CDR-H1 sequence defined by the consensus sequence δ₁-Y-A-F-δ₅-N-δ₇, where δ₁is G or D; δ₅is A or T; and δ₇is R or S.
2.9.3. Chothia CDR-H2 Consensus Sequences
In some embodiments, the antibody comprises a Chothia CDR-H2 sequence defined by the consensus sequence ε₁-G-ε₃-ε₄-G-ε₆, where ε₁is D, A, or G; ε₃is G, H, or S; ε₄is E, D, V, G, or Q; and ε₆is S, Y, or N.
2.9.4. Kabat CDR-H1 Consensus Sequences
In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence ζ₁-ζ₂-S-M-S, where ζ₁is G, V, A, or S; and ζ₂is S, T, A, C, E, or F.
In some embodiments, the antibody comprises a Kabat CDR-H1 sequence defined by the consensus sequence N-η₂-W-L-G, where η₂is R or S.
2.9.5. Kabat CDR-H2 Consensus Sequences
In some embodiments, the antibody comprises a Kabat CDR-H2 sequence defined by the consensus sequence A-I-θ₃-G-θ₅-θ₆-G-θ₈-T-θ₁₀-Y-A-D-S-V-θ₁₆-θ₁₇, where θ₃is D, A, or G; θ₅is G, H, or S; θ₆is E, D, V, G, or Q; θ₈is S, Y, or N; θ₁₀is G, A, N, or S; θ₁₆is K or R; and θ₁₇is G or D.
2.9.6. CDR-L3 Consensus Sequences
In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-Q-ι₃-ι₄-ι₅-ι₆-P-ι₈-T, where ι₃is L, D, H, N, R, T, V, or Y; ι₄is V, A, L, Q, S, E, F, M, or W; ι₅is T, A, P, S, E, F, N, or Y; ι₆is S, A, I, N, G, K, P, R, or V; and ι₈is P or A.
In some embodiments, the antibody comprises a CDR-L3 sequence defined by the consensus sequence Q-N-D-κ₄-κ₅-Y-P-L-T, where κ₄is L, S, or Y; and κ₅is S or R.
In some aspects, if κ₄is Y, then ι₅is not S.
2.9.7. CDR-L2 Consensus Sequences
In some embodiments, the antibody comprises a CDR-L2 sequence defined by the consensus sequence λ₁-A-S-T-R-E-S, where λ₁is W or R.
In some aspects, λ₁is not W.
2.9.8. CDR-L1 Consensus Sequences
In some embodiments, the antibody comprises a CDR-L1 sequence defined by the consensus sequence μ₁-A-S-Q-μ₅-μ₆-μ₇-μ₈-μ₉-μ₁₀-μ₁₁-A, where pa is R or S; μ₁is S, V, G, T, K, N, P, or R; μ₆is V, L, C, D, G, or I; μ₇is S, P, A, H, K, or T; μ₈is S, T, N, or P; μ₉is S, G, N, R, or T; pa is Y, S, V, D, K, or T; and μ₁₁is L, M, or I.

3. Germline

In some embodiments, the antibody that specifically binds EpCAM is an antibody comprising a variable region that is encoded by a particular germline gene, or a variant thereof. The illustrative antibodies provided herein comprise variable regions that are encoded by the heavy chain variable region germline genes VH3-23 and VH5-51, or variants thereof and the light chain variable region germline genes Vκ3-20 and Vκ4-1, or variants thereof.
One of skill in the art would recognize that the CDR sequences provided herein may also be useful when combined with variable regions encoded by other variable region germline genes, or variants thereof. In particular, the CDR sequences provided herein may be useful when combined with variable regions encoded by variable region germline genes, or variants thereof, that are structurally similar to the variable region germline genes recited above. For example, in some embodiments, a CDR-H sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the V_H3 or V_H5 families, or a variant thereof. In some embodiments, a CDR-L sequence provided herein may be combined with a variable region encoded by a variable region germline gene selected from the Vκ3 or Vκ4 families, or a variant thereof.

4. Affinity

In some embodiments, the affinity of the antibody for EpCAM as indicated by K_D, is less than about 10⁻⁵M, less than about 10⁻⁶M, less than about 10⁻⁷M, less than about 10⁻⁸M, less than about 10⁻⁹M, less than about 10⁻¹⁰M, less than about 10⁻¹¹M, or less than about 10⁻¹²M. In some embodiments, the affinity of the antibody is between about 10⁻⁷M and 10⁻¹¹M. In some embodiments, the affinity of the antibody is between about 10⁻⁷M and 10⁻¹⁰M. In some embodiments, the affinity of the antibody is between about 10⁻⁷M and 10⁻⁹M. In some embodiments, the affinity of the antibody is between about 10⁻⁷M and 10⁻⁸M. In some embodiments, the affinity of the antibody is between about 10⁻⁸M and 10⁻¹¹M. In some embodiments, the affinity of the antibody is between about 10⁻⁸M and 10⁻¹⁰M. In some embodiments, the affinity of the antibody is between about 10⁻⁹M and 10⁻¹¹M. In some embodiments, the affinity of the antibody is between about 10⁻¹⁰M and 10⁻¹¹M.
In some embodiments, the affinity of the antibody for human EpCAM, as determined by surface plasmon resonance at 25° C., and as indicated by K_D, is between about 7.21×10⁻⁹M and about 1.93×10⁻¹⁰M. In some embodiments, the affinity of the antibody for human EpCAM is about 7.21×10⁻⁹M, about 6.91×10⁻⁹M, about 6.70×10⁻⁹M, about 6.17×10⁻⁹M, about 5.46×10⁻⁹M, about 5.24×10⁻⁹M, about 4.17×10⁻⁹M, about 3.99×10⁻⁹M, about 3.93×10⁻⁹M, about 3.56×10⁻⁹M, about 3.50×10⁻⁹M, about 3.44×10⁻⁹M, about 3.43×10⁻⁹M, about 2.75×10⁻⁹M, about 2.54×10⁻⁹M, about 1.78×10⁻⁹M, about 1.49×10⁻⁹M, about 1.45×10⁻⁹M, about 1.41×10⁻⁹M, about 1.19×10⁻⁹M, about 9.83×10⁻¹⁰M, about 9.04×10⁻¹⁰M, or about 1.93×10⁻¹° M.
In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell, as indicated by K_D, is between about 3.68 and about 1.08 nM. In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell is about 3.68 nM, about 3.24 nM, about 3 nM, about 2.6 nM, about 2.59 nM, about 2.49 nM, about 2.47 nM, about 2 nM, about 1.96 nM, about 1.91 nM, about 1.89 nM, about 1.85 nM, about 1.79 nM, about 1.71 nM, about 1.69 nM, about 1.6 nM, about 1.54 nM, about 1.5 nM, about 1.45 nM, about 1.2 nM, about 1.17 nM, about 1.14 nM, or about 1.08 nM. In some embodiments, the cell is a CHO cell.
In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell, as indicated by K_D, is between about 6.9 and about 3.6 nM. In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell is about 6.9 nM, about 6.7 nM, or about 3.6 nM. In some embodiments, the cell is an HCT 116 cell (ATCC No. CCL-247).
In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell, as indicated by K_D, is between about 7.6 and about 2.7 nM. In some embodiments, the affinity of the antibody for human EpCAM expressed on the surface of a cell is about 7.6 nM, about 5.2 nM, or about 2.7 nM. In some embodiments, the cell is a JIMT-1 cell (DSMZ No. ACC 589).
In some embodiments, the affinity of the antibody for cynomolgus EpCAM, as determined by surface plasmon resonance at 25° C., and as indicated by K_D, is between about 1.62×10⁻⁷M and about 1.17×10⁻⁹M. In some embodiments, the affinity of the antibody for cynomolgus EpCAM is about 1.62×10⁻⁷M, about 1.20×10⁻⁷M, about 4.52×10⁻⁸M, about 3.99×10⁻⁸M, about 3.52×10⁻⁸M, about 2.97×10⁻⁸M, about 2.91×10⁻⁸M, about 2.29×10⁻⁸M, about 1.82×10⁻⁸M, about 1.52×10⁻⁸M, about 8.59×10⁻⁹M, about 8.10×10⁻⁹M, about 7.52×10⁻⁹M, about 7.22×10⁻⁹M, about 4.41×10⁻⁹M, or about 1.17×10⁻⁹M.
In some embodiments, the antibody is characterized by a ratio of affinity for human EpCAM to affinity for cynomolgus EpCAM, each as determined by surface plasmon resonance at 25° C., and as indicated by K_D. In some embodiments, the ratio is from about 0.029 to about 6.162. In some embodiments, the ratio is about 0.029, about 0.034, about 0.043, about 0.051, about 0.076, about 0.098, about 0.105, about 0.155, about 0.184, about 0.352, about 0.366, about 0.441, about 0.610, about 0.762, about 0.794, or about 6.162.
In some embodiments, the affinity of the antibody for cynomolgus EpCAM expressed on the surface of a cell, as indicated by K_D, is between about 2.99 and about 0.66 nM. In some embodiments, the affinity of the antibody for cynomolgus EpCAM expressed on the surface of a cell is about 2.99 nM, about 2.5 nM, about 1.83 nM, about 1.79 nM, about 1.62 nM, about 1.59 nM, about 1.38 nM, about 1.35 nM, about 1.21 nM, about 1.2 nM, about 1.07 nM, about 0.99 nM, about 0.9 nM, about 0.87 nM, about 0.7 nM, or about 0.66 nM. In some embodiments, the cell is a CHO cell.
In some embodiments the antibody has a k_aof at least about 10⁴M⁻¹×sec⁻¹. In some embodiments the antibody has a k_aof at least about 10⁵M⁻¹×sec⁻¹. In some embodiments the antibody has a k_aof at least about 10⁶M⁻¹×sec⁻¹. In some embodiments the antibody has a k_aof between about 10⁴M⁻¹×sec⁻¹and about 10⁵M⁻¹×sec⁻¹. In some embodiments the antibody has a k_aof between about 10⁵M⁻¹×sec⁻¹and about 10⁶M⁻¹×sec⁻¹.
In some embodiments the antibody has a k_awhen associating with human EpCAM, as determined by surface plasmon resonance at 25° C., of between about 6.52×10⁴M⁻¹×sec⁻¹and about 3.51×10⁵M⁻¹×sec⁻¹. In some embodiments the antibody has a k_awhen associating with human EpCAM of about 6.52×10⁴M⁻¹×sec⁻¹, about 9.03×10⁴M⁻¹×sec⁻¹, about 1.03×10⁵M⁻¹×sec⁻¹, about 1.40×10⁵M⁻¹×sec⁻¹, about 1.43×10⁵M⁻¹×sec⁻¹, about 1.49×10⁵M⁻¹×sec⁻¹, about 1.66×10⁵M⁻¹×sec⁻¹, about 1.70×10⁵M⁻¹×sec⁻¹, about 1.76×10⁵m⁻¹×sec⁻¹, about 1.82×10⁵M⁻¹×sec⁻¹, about 1.92×10⁵M⁻¹×sec⁻¹, about 2.00×10⁵M⁻¹×sec⁻¹, about 2.05×10⁵M⁻¹×sec⁻¹, about 2.10×10⁵M⁻¹×sec⁻¹, about 2.20×10⁵M⁻¹×sec⁻¹, about 2.35×10⁵M⁻¹×sec⁻¹, about 2.54×10⁵M⁻¹×sec⁻¹, about 2.56×10⁵M⁻¹×sec⁻¹, about 2.57×10⁵m⁻¹×sec⁻¹, about 2.84×10⁵M⁻¹×sec⁻¹, about 2.88×10⁵M⁻¹×sec⁻¹, about 3.10×10⁵M⁻¹×sec⁻¹, or about 3.51×10⁵M⁻¹×sec⁻¹.
In some embodiments the antibody has a k_dof about 10⁻⁵sec⁻¹or less. In some embodiments the antibody has a k_dof about 10⁻⁴sec⁻¹or less. In some embodiments the antibody has a k_dof about 10⁻³sec⁻¹or less. In some embodiments the antibody has a k_dof between about 10⁻²sec⁻¹and about 10⁻⁵sec⁻¹. In some embodiments the antibody has a k_dof between about 10⁻²sec⁻¹and about 10⁻⁴sec⁻¹. In some embodiments the antibody has a k_dof between about 10⁻³sec⁻¹and about 10⁻⁵sec⁻¹.
In some embodiments the antibody has a k_dwhen dissociating from human EpCAM, as determined by surface plasmon resonance at 25° C., of between about 1.75×10⁻³sec⁻¹and about 1.74×10⁻⁵sec⁻¹. In some embodiments the antibody has a k_dwhen dissociating from human EpCAM of about 1.75×10⁻³sec⁻¹, about 1.69×10⁻³sec⁻¹, about 1.58×10⁻³sec⁻¹, about 1.23×10⁻³sec⁻¹, about 1.00×10⁻³sec⁻¹, about 9.39×10⁻⁴sec⁻¹, about 9.08×10⁻⁴sec⁻¹, about 7.90×10⁴sec⁻¹, about 7.87×10⁻⁴sec⁻¹, about 7.84×10⁴sec⁻¹, about 6.04×10⁻⁴sec⁻¹, about 5.98×10⁴sec⁻¹, about 5.10×10⁻⁴sec⁻¹, about 4.12×10⁴sec⁻¹, about 3.75×10⁻⁴sec⁻¹, about 3.06×10⁴sec⁻¹, about 2.97×10⁻⁴sec⁻¹, about 2.57×10⁴sec⁻¹, about 2.57×10⁻⁴sec⁻¹, about 2.56×10⁻⁴sec⁻¹, about 2.54×10⁻⁴sec⁻¹, about 1.97×10⁻⁴sec⁻¹, or about 1.74×10⁻⁵sec⁻¹.
In some aspects, the K_D, k_a, and k_dare determined at 25° C. In some embodiments, the K_D, k_a, and k_dare determined by surface plasmon resonance. In some embodiments, the K_D, k_a, and k_dare determined according to the methods described in the Examples provided herein.

5. Epitope Bins

In some embodiments, the antibody binds the same epitope as the scFv antibody provided in SEQ ID NO: 336. In some embodiments, the antibody binds to a different epitope from the scFv antibody provided in SEQ ID NO: 336. In some embodiments, the antibody binds to part of the epitope bound by the scFv antibody provided in SEQ ID NO: 336.
In some embodiments, the antibody binds to the same epitope as the scFv-Fc antibody provided in SEQ ID NO: 210, which binds to an epitope encoded by exons 4-7 of the EpCAM gene.

6. Glycosylation Variants

In certain embodiments, an antibody may be altered to increase, decrease or eliminate the extent to which it is glycosylated. Glycosylation of polypeptides is typically either “N-linked” or “O-linked.”
“N-linked” glycosylation refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site.
“O-linked” glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
Addition or deletion of N-linked glycosylation sites to the antibody may be accomplished by altering the amino acid sequence such that one or more of the above-described tripeptide sequences is created or removed. Addition or deletion of O-linked glycosylation sites may be accomplished by addition, deletion, or substitution of one or more serine or threonine residues in or to (as the case may be) the sequence of an antibody.

7. Fc Variants

In certain embodiments, amino acid modifications may be introduced into the Fc region of an antibody provided herein to generate an Fc region variant. In certain embodiments, the Fc region variant possesses some, but not all, effector functions. Such antibodies may be useful, for example, in applications in which the half-life of the antibody in vivo is important, yet certain effector functions are unnecessary or deleterious. Examples of effector functions include complement-dependent cytotoxicity (CDC) and antibody-directed complement-mediated cytotoxicity (ADCC). Numerous substitutions or substitutions or deletions with altered effector function are known in the art.
An alteration in in CDC and/or ADCC activity can be confirmed using in vitro and/or in vivo assays. For example, Fc receptor (FcR) binding assays can be conducted to measure FcγR binding. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII. FcR expression on hematopoietic cells is summarized in Ravetch and Kinet, Ann. Rev. Immunol., 1991, 9:457-492, incorporated by reference in its entirety.
Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are provided in U.S. Pat. Nos. 5,500,362 and 5,821,337; Hellstrom et al., Proc. Natl. Acad. Sci. USA., 1986, 83:7059-7063; Hellstrom et al., Proc. Natl. Acad. Sci. USA., 1985, 82:1499-1502; and Bruggemann et al., J. Exp. Med., 1987, 166:1351-1361; each of which is incorporated by reference in its entirety. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, using an animal model such as that disclosed in Clynes et al. Proc. Natl. Acad. Sci. USA., 1998, 95:652-656, incorporated by reference in its entirety.
C1q binding assays may also be carried out to confirm that the antibody is unable to bind C1q and hence lacks CDC activity. Examples of C1q binding assays include those described in WO 2006/029879 and WO 2005/100402, each of which is incorporated by reference in its entirety.
Complement activation assays include those described, for example, in Gazzano-Santoro et al., J. Immunol. Methods, 1996, 202:163-171; Cragg et al., Blood, 2003, 101:1045-1052; and Cragg and Glennie, Blood, 2004, 103:2738-2743; each of which is incorporated by reference in its entirety.
FcRn binding and in vivo clearance (half-life determination) can also be measured, for example, using the methods described in Petkova et al., Intl. Immunol., 2006, 18:1759-1769, incorporated by reference in its entirety.

8. Preparation of Antibodies

8.1. Antigen Preparation
The EpCAM antigen to be used for isolation of the antibodies may be intact EpCAM or a fragment of EpCAM. The intact EpCAM, or fragment of EpCAM, may be in the form of an isolated protein or protein expressed by a cell. Other forms of EpCAM useful for generating antibodies will be apparent to those skilled in the art.
8.2. Monoclonal Antibodies
Monoclonal antibodies may be obtained, for example, using the hybridoma method first described by Kohler et al., Nature, 1975, 256:495-497 (incorporated by reference in its entirety), and/or by recombinant DNA methods (see e.g., U.S. Pat. No. 4,816,567, incorporated by reference in its entirety). Monoclonal antibodies may also be obtained, for example, using phage or yeast-based libraries. See e.g., U.S. Pat. Nos. 8,258,082 and 8,691,730, each of which is incorporated by reference in its entirety.
In the hybridoma method, a mouse or other appropriate host animal is immunized to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes are then fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell. See Goding J. W., Monoclonal Antibodies: Principles and Practice 3^rded. (1986) Academic Press, San Diego, Calif., incorporated by reference in its entirety.
The hybridoma cells are seeded and grown in a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
Useful myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive media conditions, such as the presence or absence of HAT medium. Among these, preferred myeloma cell lines are murine myeloma lines, such as those derived from MOP-21 and MC-11 mouse tumors (available from the Salk Institute Cell Distribution Center, San Diego, Calif.), and SP-2 or X63-Ag8-653 cells (available from the American Type Culture Collection, Rockville, Md.). Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies. See e.g., Kozbor, J. Immunol., 1984, 133:3001, incorporated by reference in its entirety.
After the identification of hybridoma cells that produce antibodies of the desired specificity, affinity, and/or biological activity, selected clones may be subcloned by limiting dilution procedures and grown by standard methods. See Goding, supra. Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
DNA encoding the monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). Thus, the hybridoma cells can serve as a useful source of DNA encoding antibodies with the desired properties. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as bacteria (e.g., E. coli), yeast (e.g., Saccharomyces or Pichia sp.), COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody, to produce the monoclonal antibodies.
8.3. Humanized Antibodies
Humanized antibodies may be generated by replacing most, or all, of the structural portions of a non-human monoclonal antibody with corresponding human antibody sequences. Consequently, a hybrid molecule is generated in which only the antigen-specific variable, or CDR, is composed of non-human sequence. Methods to obtain humanized antibodies include those described in, for example, Winter and Milstein, Nature, 1991, 349:293-299; Rader et al., Proc. Nat. Acad. Sci. USA., 1998, 95:8910-8915; Steinberger et al., J. Biol. Chem., 2000, 275:36073-36078; Queen et al., Proc. Natl. Acad. Sci. USA., 1989, 86:10029-10033; and U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and 6,180,370; each of which is incorporated by reference in its entirety.
8.4. Human Antibodies
Human antibodies can be generated by a variety of techniques known in the art, for example by using transgenic animals (e.g., humanized mice). See, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA., 1993, 90:2551; Jakobovits et al., Nature, 1993, 362:255-258; Bruggermann et al., Year in Immuno., 1993, 7:33; and U.S. Pat. Nos. 5,591,669, 5,589,369 and 5,545,807; each of which is incorporated by reference in its entirety. Human antibodies can also be derived from phage-display libraries (see e.g., Hoogenboom et al., J. Mol. Biol., 1991, 227:381-388; Marks et al., J. Mol. Biol., 1991, 222:581-597; and U.S. Pat. Nos. 5,565,332 and 5,573,905; each of which is incorporated by reference in its entirety). Human antibodies may also be generated by in vitro activated B cells (see e.g., U.S. Pat. Nos. 5,567,610 and 5,229,275, each of which is incorporated by reference in its entirety). Human antibodies may also be derived from yeast-based libraries (see e.g., U.S. Pat. No. 8,691,730, incorporated by reference in its entirety).

9. Vectors, Host Cells, and Recombinant Methods

The invention also provides isolated nucleic acids encoding anti-EpCAM antibodies, vectors and host cells comprising the nucleic acids, and recombinant techniques for the production of the antibodies.
For recombinant production of the antibody, the nucleic acid(s) encoding it may be isolated and inserted into a replicable vector for further cloning (i.e., amplification of the DNA) or expression. In some aspects, the nucleic acid may be produced by homologous recombination, for example as described in U.S. Pat. No. 5,204,244, incorporated by reference in its entirety.
Many different vectors are known in the art. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U.S. Pat. No. 5,534,615, incorporated by reference in its entirety.
Illustrative examples of suitable host cells are provided below. these host cells are not meant to be limiting.
Suitable host cells include any prokaryotic (e.g., bacterial), lower eukaryotic (e.g., yeast), or higher eukaryotic (e.g., mammalian) cells. Suitable prokaryotes include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia (E. coli), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella (S. typhimurium), Serratia (S. marcescans), Shigella, Bacilli (B. subtilis and B. licheniformis), Pseudomonas (P. aeruginosa), and Streptomyces. One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli X1776, and E. coli W3110 are suitable.
In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for anti-EpCAM antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is a commonly used lower eukaryotic host microorganism. However, a number of other genera, species, and strains are available and useful, such as Schizosaccharomyces pombe, Kluyveromyces (K. lactis, K. fragilis, K. bulgaricus K. wickeramii, K. waltii, K. drosophilarum, K. thermotolerans, and K. marxianus), Yarrowia, Pichia pastoris, Candida (C. albicans), Trichoderma reesia, Neurospora crassa, Schwanniomyces (S. occidentalis), and filamentous fungi such as, for example Penicillium, Tolypocladium, and Aspergillus (A. nidulans and A. niger).
Useful mammalian host cells include COS-7 cells, HEK293 cells; baby hamster kidney (BHK) cells; Chinese hamster ovary (CHO); mouse sertoli cells; African green monkey kidney cells (VERO-76), and the like.
The host cells used to produce the anti-EpCAM antibody of this invention may be cultured in a variety of media. Commercially available media such as, for example, Ham's F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco's Modified Eagle's Medium (DMEM) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz., 1979, 58:44; Barnes et al., Anal. Biochem., 1980, 102:255; and U.S. Pat. Nos. 4,767,704, 4,657,866, 4,927,762, 4,560,655, and 5,122,469, or WO 90/03430 and WO 87/00195 may be used. Each of the foregoing references is incorporated by reference in its entirety.
Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. For example, Carter et al. (Bio/Technology, 1992, 10:163-167) describes a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli. Briefly, cell paste is thawed in the presence of sodium acetate (pH 3.5), EDTA, and phenylmethylsulfonylfluoride (PMSF) over about 30 min. Cell debris can be removed by centrifugation.
In some embodiments, the antibody is produced in a cell-free system. In some aspects, the cell-free system is an in vitro transcription and translation system as described in Yin et al., mAbs, 2012, 4:217-225, incorporated by reference in its entirety. In some aspects, the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell. In some aspects, the prokaryotic cell is E. coli. Cell-free expression of the antibody may be useful, for example, where the antibody accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.
Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon® or Millipore® Pellcon® ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
The antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique. The suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody. Protein A can be used to purify antibodies that are based on human γ1, γ2, or γ4 heavy chains (Lindmark et al., J. Immunol. Meth., 1983, 62:1-13, incorporated by reference in its entirety). Protein G is useful for all mouse isotypes and for human γ3 (Guss et al., EMBO J., 1986, 5:1567-1575, incorporated by reference in its entirety).
The matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a C_H3domain, the BakerBond ABX® resin is useful for purification.
Other techniques for protein purification, such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin Sepharose®, chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available, and can be applied by one of skill in the art.
Following any preliminary purification step(s), the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 to about 4.5, generally performed at low salt concentrations (e.g., from about 0 to about 0.25 M salt).

10. Pharmaceutical Compositions and Methods of Administration

Any of the antibodies provided herein can be provided in any appropriate pharmaceutical composition and be administered by any suitable route of administration. Suitable routes of administration include, but are not limited to, the inhalation, intraarterial, intradermal, intramuscular, intraperitoneal, intravenous, nasal, parenteral, pulmonary, and subcutaneous routes.
The pharmaceutical composition may comprise one or more pharmaceutical excipients. Any suitable pharmaceutical excipient may be used, and one of ordinary skill in the art is capable of selecting suitable pharmaceutical excipients. Accordingly, the pharmaceutical excipients provided below are intended to be illustrative, and not limiting. Additional pharmaceutical excipients include, for example, those described in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), incorporated by reference in its entirety.
In some embodiments, the pharmaceutical composition comprises an anti-foaming agent. Any suitable anti-foaming agent may be used. In some aspects, the anti-foaming agent is selected from an alcohol, an ether, an oil, a wax, a silicone, a surfactant, and combinations thereof. In some aspects, the anti-foaming agent is selected from a mineral oil, a vegetable oil, ethylene bis stearamide, a paraffin wax, an ester wax, a fatty alcohol wax, a long chain fatty alcohol, a fatty acid soap, a fatty acid ester, a silicon glycol, a fluorosilicone, a polyethylene glycol-polypropylene glycol copolymer, polydimethylsiloxane-silicon dioxide, ether, octyl alcohol, capryl alcohol, sorbitan trioleate, ethyl alcohol, 2-ethyl-hexanol, dimethicone, oleyl alcohol, simethicone, and combinations thereof.
In some embodiments, the pharmaceutical composition comprises a cosolvent. Illustrative examples of cosolvents include ethanol, poly(ethylene) glycol, butylene glycol, dimethylacetamide, glycerin, and propylene glycol.
In some embodiments, the pharmaceutical composition comprises a buffer. Illustrative examples of buffers include acetate, borate, carbonate, lactate, malate, phosphate, citrate, hydroxide, diethanolamine, monoethanolamine, glycine, methionine, guar gum, and monosodium glutamate.
In some embodiments, the pharmaceutical composition comprises a carrier or filler. Illustrative examples of carriers or fillers include lactose, maltodextrin, mannitol, sorbitol, chitosan, stearic acid, xanthan gum, and guar gum.
In some embodiments, the pharmaceutical composition comprises a surfactant. Illustrative examples of surfactants include d-alpha tocopherol, benzalkonium chloride, benzethonium chloride, cetrimide, cetylpyridinium chloride, docusate sodium, glyceryl behenate, glyceryl monooleate, lauric acid, macrogol 15 hydroxystearate, myristyl alcohol, phospholipids, polyoxyethylene alkyl ethers, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, polyoxylglycerides, sodium lauryl sulfate, sorbitan esters, and vitamin E polyethylene(glycol) succinate.
In some embodiments, the pharmaceutical composition comprises an anti-caking agent. Illustrative examples of anti-caking agents include calcium phosphate (tribasic), hydroxymethyl cellulose, hydroxypropyl cellulose, and magnesium oxide.
Other excipients that may be used with the pharmaceutical compositions include, for example, albumin, antioxidants, antibacterial agents, antifungal agents, bioabsorbable polymers, chelating agents, controlled release agents, diluents, dispersing agents, dissolution enhancers, emulsifying agents, gelling agents, ointment bases, penetration enhancers, preservatives, solubilizing agents, solvents, stabilizing agents, and sugars. Specific examples of each of these agents are described, for example, in the Handbook of Pharmaceutical Excipients, Rowe et al. (Eds.) 6th Ed. (2009), The Pharmaceutical Press, incorporated by reference in its entirety.
In some embodiments, the pharmaceutical composition comprises a solvent. In some aspects, the solvent is saline solution, such as a sterile isotonic saline solution or dextrose solution. In some aspects, the solvent is water for injection.
In some embodiments, the pharmaceutical compositions are in a particulate form, such as a microparticle or a nanoparticle. Microparticles and nanoparticles may be formed from any suitable material, such as a polymer or a lipid. In some aspects, the microparticles or nanoparticles are micelles, liposomes, or polymersomes.
Further provided herein are anhydrous pharmaceutical compositions and dosage forms comprising an antibody, since water can facilitate the degradation of some antibodies.
Anhydrous pharmaceutical compositions and dosage forms provided herein can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions. Pharmaceutical compositions and dosage forms that comprise lactose and at least one active ingredient that comprises a primary or secondary amine can be anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.
An anhydrous pharmaceutical composition should be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions can be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastics, unit dose containers (e.g., vials), blister packs, and strip packs.
10.1. Parenteral Dosage Forms
In certain embodiments, provided are parenteral dosage forms. Parenteral dosage forms can be administered to subjects by various routes including, but not limited to, subcutaneous, intravenous (including bolus injection), intramuscular, and intraarterial. Because their administration typically bypasses subjects' natural defenses against contaminants, parenteral dosage forms are typically, sterile or capable of being sterilized prior to administration to a subject. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.
Suitable vehicles that can be used to provide parenteral dosage forms are well known to those skilled in the art. Examples include, but are not limited to: Water for Injection USP; aqueous vehicles such as, but not limited to, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium Chloride Injection, and Lactated Ringer's Injection; water miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
Excipients that increase the solubility of one or more of the antibodies disclosed herein can also be incorporated into the parenteral dosage forms.
10.2. Dosage and Unit Dosage Forms
In human therapeutics, the doctor will determine the posology which he considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition and other factors specific to the subject to be treated.
In certain embodiments, a composition provided herein is a pharmaceutical composition or a single unit dosage form. Pharmaceutical compositions and single unit dosage forms provided herein comprise a prophylactically or therapeutically effective amount of one or more prophylactic or therapeutic antibodies.
The amount of the antibody or composition which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof will vary with the nature and severity of the disease or condition, and the route by which the antibody is administered. The frequency and dosage will also vary according to factors specific for each subject depending on the specific therapy (e.g., therapeutic or prophylactic agents) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
In certain embodiments, exemplary doses of a composition include milligram or microgram amounts of the antibody per kilogram of subject or sample weight (e.g., about 10 micrograms per kilogram to about 50 milligrams per kilogram, about 100 micrograms per kilogram to about 25 milligrams per kilogram, or about 100 microgram per kilogram to about 10 milligrams per kilogram). In certain embodiment, the dosage of the antibody provided herein, based on weight of the antibody, administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 10 mg/kg, or 15 mg/kg or more of a subject's body weight. In another embodiment, the dosage of the composition or a composition provided herein administered to prevent, treat, manage, or ameliorate a disorder, or one or more symptoms thereof in a subject is 0.1 mg to 200 mg, 0.1 mg to 100 mg, 0.1 mg to 50 mg, 0.1 mg to 25 mg, 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 10 mg, 0.1 mg to 7.5 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 mg to 7.5 mg, 0.25 mg to 5 mg, 0.25 mg to 2.5 mg, 0.5 mg to 20 mg, 0.5 to 15 mg, 0.5 to 12 mg, 0.5 to 10 mg, 0.5 mg to 7.5 mg, 0.5 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 7.5 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.
The dose can be administered according to a suitable schedule, for example, once, two times, three times, or for times weekly. It may be necessary to use dosages of the antibody outside the ranges disclosed herein in some cases, as will be apparent to those of ordinary skill in the art. Furthermore, it is noted that the clinician or treating physician will know how and when to interrupt, adjust, or terminate therapy in conjunction with subject response.
Different therapeutically effective amounts may be applicable for different diseases and conditions, as will be readily known by those of ordinary skill in the art. Similarly, amounts sufficient to prevent, manage, treat or ameliorate such disorders, but insufficient to cause, or sufficient to reduce, adverse effects associated with the antibodies provided herein are also encompassed by the herein described dosage amounts and dose frequency schedules. Further, when a subject is administered multiple dosages of a composition provided herein, not all of the dosages need be the same. For example, the dosage administered to the subject may be increased to improve the prophylactic or therapeutic effect of the composition or it may be decreased to reduce one or more side effects that a particular subject is experiencing.
In certain embodiments, treatment or prevention can be initiated with one or more loading doses of an antibody or composition provided herein followed by one or more maintenance doses.
In certain embodiments, a dose of an antibody or composition provided herein can be administered to achieve a steady-state concentration of the antibody in blood or serum of the subject. The steady-state concentration can be determined by measurement according to techniques available to those of skill or can be based on the physical characteristics of the subject such as height, weight and age.
In certain embodiments, administration of the same composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months. In other embodiments, administration of the same prophylactic or therapeutic agent may be repeated and the administration may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or 6 months.

11. Therapeutic Applications

For therapeutic applications, the antibodies of the invention are administered to a mammal, generally a human, in a pharmaceutically acceptable dosage form such as those known in the art and those discussed above. For example, the antibodies of the invention may be administered to a human intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intra-cerebrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, or intratumoral routes. The antibodies also are suitably administered by peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. The intraperitoneal route may be particularly useful, for example, in the treatment of ovarian tumors.
The antibodies provided herein may be useful for the treatment of any disease or condition involving EpCAM. In some embodiments, the disease or condition is a disease or condition that can be diagnosed by overexpression of EpCAM. In some embodiments, the disease or condition is a disease or condition that can benefit from treatment with an anti-EpCAM antibody. In some embodiments, the disease or condition is a cancer.
Any suitable cancer may be treated with the antibodies provided herein. Illustrative suitable cancers include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), adrenocortical carcinoma, anal cancer, appendix cancer, astrocytoma, basal cell carcinoma, brain tumor, bile duct cancer, bladder cancer, bone cancer, breast cancer, bronchial tumor, carcinoma of unknown primary origin, cardiac tumor, cervical cancer, chordoma, colon cancer, colorectal cancer, craniopharyngioma, ductal carcinoma, embryonal tumor, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, fibrous histiocytoma, Ewing sarcoma, eye cancer, germ cell tumor, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gestational trophoblastic disease, glioma, head and neck cancer, hepatocellular cancer, histiocytosis, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumor, Kaposi sarcoma, kidney cancer, Langerhans cell histiocytosis, laryngeal cancer, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ, lung cancer, macroglobulinemia, malignant fibrous histiocytoma, melanoma, Merkel cell carcinoma, mesothelioma, metastatic squamous neck cancer with occult primary, midline tract carcinoma involving NUT gene, mouth cancer, multiple endocrine neoplasia syndrome, multiple myeloma, mycosis fungoides, myelodysplastic syndrome, myelodysplastic/myeloproliferative neoplasm, nasal cavity and par nasal sinus cancer, nasopharyngeal cancer, neuroblastoma, non-small cell lung cancer, oropharyngeal cancer, osteosarcoma, ovarian cancer, pancreatic cancer, papillomatosis, paraganglioma, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytomas, pituitary tumor, pleuropulmonary blastoma, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell cancer, renal pelvis and ureter cancer, retinoblastoma, rhabdoid tumor, salivary gland cancer, Sezary syndrome, skin cancer, small cell lung cancer, small intestine cancer, soft tissue sarcoma, spinal cord tumor, stomach cancer, T-cell lymphoma, teratoid tumor, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, urethral cancer, uterine cancer, vaginal cancer, vulvar cancer, and Wilms tumor.
In particular embodiments, the cancer is a cancer of epithelial origin. In some aspects, the cancer is a carcinoma. In some aspects, the cancer is selected from an adenocarcinoma, a squamous cell carcinoma, an adenosquamos carcinoma, an anaplastic carcinoma, a large cell carcinoma, small cell carcinoma, and carcinoma of unknown primary origin.

12. Diagnostic Applications

In some embodiments, the antibodies provided herein are used in diagnostic applications. For example, an ant-EpCAM antibody may be useful in assays for EpCAM protein. In some aspects the antibody can be used to detect the expression of EpCAM in various cells and tissues. These assays may be useful, for example, in making a diagnosis and/or prognosis for a disease, such as a cancer.
In some diagnostic and prognostic applications, the antibody may be labeled with a detectable moiety. Suitable detectable moieties include, but are not limited to radioisotopes, fluorescent labels, and enzyme-substrate labels. In another embodiment, the anti-EpCAM antibody need not be labeled, and the presence of the antibody can be detected using a labeled antibody which specifically binds to the anti-EpCAM antibody.

13. Affinity Purification Reagents

The antibodies of the invention may be used as affinity purification agents. In this process, the antibodies may be immobilized on a solid phase such a resin or filter paper, using methods well known in the art. The immobilized antibody is contacted with a sample containing the EpCAM protein (or fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the EpCAM protein, which is bound to the immobilized antibody. Finally, the support is washed with another suitable solvent, such as glycine buffer, pH 5.0, that will release the EpCAM protein from the antibody.

14. Kits

In some embodiments, an anti-EpCAM antibody provided herein is provided in the form of a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing a procedure. In some embodiments, the procedure is a diagnostic assay. In other embodiments, the procedure is a therapeutic procedure.
In some embodiments, the kit further comprises a solvent for the reconstitution of the anti-EpCAM antibody. In some embodiments, the anti-EpCAM antibody is provided in the form of a pharmaceutical composition.

EXAMPLES

Example 1: Generation and Primary Screening of Anti-EpCAM Antibodies

Antibody scFv libraries were constructed using a standard overlap extension PCR protocol with mutagenic primers targeting complementary determining regions (CDRs). See Heckman and Pease, Nat. Protoc., 2007, 2:924-932, incorporated by reference in its entirety. Selections for novel antibodies were performed using standard ribosome display protocols. See Dreier and Plückthun, Methods Mol. Biol., 2003, 687:283-306, Clifton, N.J., incorporated by reference in its entirety. scFv-based selection was performed according to published protocols. See Hanes and Plückthun, Proc. Natl. Acad. Sci. USA., 1997, 94:4937-4942, incorporated by reference in its entirety. After multiple rounds of selection, the DNA from RT-PCR output was cloned into an optimized vector for cell-free expression using standard molecular biology techniques. See Yin et al., mAbs, 2012, 4:217-225, incorporated by reference in its entirety. All constructs were HIS- and FLAG-tagged to streamline purification and testing during screening.
Libraries of antibody variants generated by selection workflow were transformed into E. coli and grown on agar plates with antibiotic (kanamycin). Individual colonies were grown in liquid broth (TB+kanamycin), and used as a template for DNA amplification via rolling circle amplification (RCA). The variants were then expressed in cell-free protein synthesis reactions as described in Zawada et al., Biotechnol. Bioeng., 2011, 108:1570-1578, incorporated by reference in its entirety.
Briefly, cell-free extracts were treated with 50 μM iodoacetamide for 30 min at room temperature (20° C.) and added to a premix containing cell-free components (see Groff et al., mAbs, 2014, 6:671-678, incorporated by reference in its entirety) and 10% (v/v) RCA DNA template (approximately 10 μg/mL DNA) for variants of interest. Sixty microliters of cell-free reactions were incubated at 30° C. for 12 hr on a shaker at 650 rpm in 96-well plates. Four hundred to one-thousand-five-hundred colonies were screened, depending on the predicted diversity of different selection campaigns.
Following synthesis, each reaction was diluted 1:50 into PBST (PBS at pH 7.4 with 0.2% Tween-20+0.2% BSA) and expressed variants were tested for functional activity via ELISA-based binding to recombinant human EpCAM extracellular domain (ECD) (Gln 24-Lys 265; Acro Biosystems; Cat. No. EPM-H5223). Standard ELISA-based methods were employed. Specifically, 384-well plates were coated with 2 μg/mL recombinant EpCAM diluted in bicarbonate buffer, and then blocked with BSA. Antibody variants of interest were allowed to bind to the EpCAM-coated plates, and detected with secondary antibodies (e.g., HRP-conjugated anti-human Fc or anti-FLAG) and then detected with chemiluminescent substrate (Pierce ELISA SuperSignal™ Substrate). Chemiluminescence was quantified on a Molecular Devices SpectraMax® M5 plate reader. Top hits were selected based on ELISA signal or signal/noise ratio and their nucleotides were sequenced. Based on functional activity and sequence analysis, a subset of variants was selected for further scale-up and characterization.

Example 2: Secondary Screening of Antibodies

The top leads from the initial round of screening were cultured and plasmid minipreps were performed using a QlAprep® 96 Turbo miniprep kit (Qiagen) according to the manufacturer's instructions. 10 μg/mL miniprepped DNA was added to 4 mL cell-free reactions and incubated overnight for 12 hr at 30° C., at 650 rpm.
Expressed variants from clarified cell-free reactions were purified via immobilized metal ion affinity chromatography (IMAC) purification using a semi-automated high throughput batch purification method. Briefly, purifications were performed in a 96-well plate format where 50 μL/well of IMAC resin (Ni Sepharose High Performance, GE Healthcare) was equilibrated in IMAC binding buffer (50 mM Tris pH 8.0, 300 mM NaCl, 10 mM imidazole), incubated with 1 mL cell-free reaction for 15 minutes followed by two washes in IMAC binding buffer. His-tagged antibody variants were then eluted using 200 μL IMAC elution buffer (50 mM Tris pH 8.0, 300 mM NaCl, 500 mM imidazole) and buffer exchanged into PBS using a 96-well Zeba plate (7 kD MWCO, Thermo Fisher). Purified antibodies were quantified via high throughput capillary electrophoresis using the LabChip GXII (Perkin Elmer) against a Herceptin standard curve, according to the manufacturer's instructions.

Example 3: Affinity and Kinetic Binding Analyses

Monoclonal Anti-FLAG M2 IgG (Sigma-Aldrich # F9291) was immobilized onto a CMS chip (GE Life Sciences) using amine coupling chemistry (from Amine Coupling Kit, GE Life Sciences). The immobilization steps were carried out at a flow rate of 25 μL/min in 1×HBS-EP+ buffer (GE Life Sciences; 10× Stock diluted before use). The sensor surfaces were activated for 7 min with a mixture of NHS (0.05 M) and EDC (0.2 M). The Anti-Flag M2 IgG was injected over all 4 flow cells at a concentration of 25 μg/mL in 10 mM sodium acetate, pH 4.5, for 7 min. Ethanolamine (1 M, pH 8.5) was injected for 7 min to block any remaining activated groups. An average of 12,000 response units (RU) of capture antibody was immobilized on each flow cell.
Off-rate and Kinetic binding experiments were performed at 25° C. using 1×HBS-EP+ buffer. Test and control antibodies were injected over the Anti-FLAG surface at concentrations of 5-10 μg/mL for 12 seconds at a flow rate of 10 μL/min on flow cells 2, 3 and 4, followed by a buffer wash for 30 seconds at the same flow rate. Kinetic characterization of antibody samples was carried out with a single concentration of antigen (for off-rate ranking) or a 1:2 dilution series of antigen (for kinetic characterization) and 1 injection of 0 nM antigen. After capturing ligand (antibody) on the anti-FLAG surface, the analyte (human EpCAM-His) was bound at 50, 25, 12.5, 6.25 and 0 nM for 180 seconds, followed by a 600 second dissociation phase at a flow rate of 50 μl/min. Between each ligand capture and analyte binding cycle, regeneration was carried out using 2 injections of 10 mM glycine pH 2.0 for 30 seconds at 30 μL/min, followed by a 30 second buffer wash step.
The data were fit with the Biacore T200 Evaluation software, using a 1:1 Langmuir binding model. K_D(affinity, nM) was determined as a ratio of the kinetic rate constants calculated from the fits of the association and dissociation phases.

Example 4: EpCAM Epitope Binning ELISA

An anti-EpCAM antibody, 5-10 scFv-Fc (SEQ ID NO: 362), was adsorbed on Nunc 384-well white Maxisorp plates at 2 μg/mL in in sodium bicarbonate buffer (pH 8.9) and incubated at 30° C. for 1 hour or overnight at 4° C. The plate was washed 3 times with PBS pH 7.4 with 0.05% Tween and blocked with 2% bovine serum albumin (BSA) in PBS pH 7.4+0.1% Tween for 1 hour at 30° C. The block was removed by aspiration.
A dilution series of antibody was mixed with 1 nM biotinylated EpCAM-Fc (R&D Systems) in 0.2% BSA in PBS pH 7.4+0.1% Tween (diluent buffer) and incubated at 30° C. for 1 hour. The plate was washed, and streptavidin-HRP (horseradish peroxidase; Thermo Pierce) was diluted 1:10,000 in diluent buffer, added to each well, and incubated at 30° C. for 1 hour. The plate was washed and detected by SuperSignal West Pico Chemiluminescent Substrate (Thermo Pierce). Luminescence was detected on a SpectraMax plate reader (Molecular Devices).

Example 5: Fluorescence-Assisted Cell Sorting (FACS)-Based Cell Sorting

CHO-k cells were transfected to stably express EpCAM on the cell surface. CHO parental and stably transfected CHO-EpCAM (human, cynomolgus and mouse EpCAM-expressing cells) cells were washed with DPBS, detached with Accutase™ (BD Biosciences; San Jose, Calif.), and resuspended in ice-cold FACS buffer (DPBS buffer supplemented with 0.5% bovine serum albumin).
A total of 200,000 cells per 96-well were incubated on ice for 60 mins with 100 nM of test antibodies diluted in FACS buffer. Cells were washed twice with FACS buffer and incubated on ice for 30 mins with R-phycoerythrin AffiniPure F(ab′)₂fragment, goat anti-Human IgG, Fcγ fragment specific secondary detection antibody (Jackson ImmunoResearch Laboratories, West Grove, Pa.) diluted at 1:200 with FACS buffer. Cells were washed twice with FACS buffer, fixed in 4% paraformaldehyde in PBS (Santa Cruz Biotechnology; Dallas, Tex.) for 20 mins on ice in the dark, washed twice with FACS buffer and analyzed using the BD LSR II Flow Cytometer (BD Biosciences; San Jose, Calif.). Data were analyzed using FlowJo (FlowJo, LLC; Ashland, Oreg.) to determine mean fluorescence intensities. Binding constants were calculated using the statistical software, GraphPad Prism (GraphPad Software; La Jolla, Calif.) using the nonlinear regression equation, one site—specific binding with Hill slope. Secondary antibody alone was used as a control, in addition to measuring non-specific EpCAM antibody binding to CHO parental cells. For some variants, binding to human tumor cells, HCT 116 and JIMT1 cells were also evaluated.

Example 6: Epitope Binding and Domain Mapping

The EpCAM domain bound by the anti-human EpCAM Abs was mapped by cell binding analysis on stably transfected CHO cells expressing human/mouse chimeric EpCAM constructs. Since anti-human EpCAM Abs do not have cross-reactive binding to mouse EpCAM, chimeric human/mouse EpCAM constructs were generated to map the binding region on human EpCAM. To make the expression constructs, human and mouse EpCAM amino acid sequences corresponding to exon 2, exon 3 and exons 4-9 were switched with the alternative mouse and human amino acid sequences, respectively. The following constructs were generated and expressed in CHO cells: 1) MHH, 2) HMH, 3) HHM, 4) HMM, 5) MHM and 6) MMH, where the three letters denote human (H) or mouse (M) amino acid sequences in exon 2, exon 3 and exons 4-9, respectively. EpCAM Abs were tested for binding to the different chimeric cell lines at a concentration of 10 μg/mL by FACS binding analysis.
The results show that the SRP1464-A08 and SRP1464-B04 antibodies provided herein bind an epitope on EpCAM that is encoded by exons 4-7 of the EpCAM gene. On the other hand, 1332-A05 binds to an epitope encoded by exon 2.
Based on sequence similarity, it is expected that other SRP1464-antibodies, as well as the (parent) SRP1304-antibodies and (child) SRP1557-antibodies also bind an epitope on EpCAM that is encoded by exons 4-7. Similarly, it is expected that other SRP1332-antibodies also bind an epitope encoded by exon 2.
Despite the fact that they bind epitopes encoded by different exons both the SRP1332-A05 antibody (exon 2) and the 1464-A08 and 1464-B04 antibodies (exons 4-7) competed with a known exon 2 binder (SEQ ID NO: 336) in an experiment where each antibody was tested for its ability to block binding of the known exon 2 binder. This suggests that the epitope encoded by exon 2 (bound by SRP1332- and SEQ ID NO: 336) and exons 4-7 (bound by SRP1464-) are proximal to each other in the folded EpCAM structure, as expressed on the cell surface.

Example 7: Refined Epitope Binding and Competition Assay

The EpCAM domain bound by the anti-human EpCAM Abs within exons 4-7 was mapped by additional cell binding analysis on stably transfected CHO cells expressing human/mouse chimeric EpCAM constructs for exons 4 and 5 only. To make the expression constructs, human EpCAM amino acid sequences within parts of exon 4 and/or exons were replaced with mouse EpCAM amino acid sequences. The following constructs were generated and expressed in CHO cells: 1) MH, 2) HM, and 3) MM, where the two letters denote human (H) or mouse (M) amino acid sequences within exons 4 and exon 5, respectively. EpCAM Abs were tested for binding to the different chimeric cell lines at a concentration of 10 μg/mL by FACS binding analysis.
The results show that the SRP1464-B04 and SRP1557-G01 antibodies provided herein bind an epitope on EpCAM that is encoded by exon 5 of the EpCAM gene. Positive control Adecatumumab (known to bind exon 5) also bound to exon 5 in the same assay. This is further confirmed by competition binding experiment using CHO cells expressing human EpCAM, which showed that both SRP1464-B04 and SRP1557-G01 compete with Adecatumumab for binding to EpCAM.
Based on sequence similarity, it is expected that other SRP1464-antibodies, as well as the (parent) SRP1304-antibodies and other (child) SRP1557-antibodies also bind an epitope on EpCAM that is encoded by exon 5.
It should be noted that though the SRP1464-B04 and SRP1557-G01 antibodies bind to the same exon as, and compete for binding with, Adecatumumab, both SRP1464-B04 and SRP1557-G01 have significant binding affinity for cynomolgous EpCAM protein (see Tables 5 and 6, below), while Adecatumumab does not have significant binding affinity for cynomolgous EpCAM. See Münz et al., Cancer Cell Int, 2010, 10:44. Cynomolgous cross-reactivity is advantageous because it evaluation of the toxicity of antibodies in a primate model, allowing such evaluation without exposing human subjects to molecules of unknown toxicity. Thus, the SRP1464-B04 and SRP1557-G01 antibodies demonstrate a significant and unexpected biological property not found in known antibodies binding exon 5 of human EpCAM.

Example 8: Characteristics of Illustrative Anti-EpCAM Antibodies

FIGS. 1A-1C provide an alignment of the “1304,” “1464,” and “1557” V_Hsequences provided herein. FIGS. 2A-2B provide an alignment of the “1332” V_Hsequences provided herein. FIGS. 3A-3B provide an alignment of the “1304,” “1464,” and “1557” V_Lsequences provided herein. FIGS. 4A-4B provide an alignment of the “1332” V_Lsequences provided herein.
Tables 5-7 show results obtained using the illustrative antibodies described herein.
Table 5 shows results obtained from certain antibodies provided herein. Antibody SRP-1304-G11 was isolated from a naive library constructing using trinucleotides to introduce variability into CDRs. SRP-1464-A02, SRP-1464-A08, and SRP-1464-B04 were isolated from a first affinity maturation library that was based on SRP-1304-G11, and constructed using a soft randomization approach.
Briefly, during soft randomization, polynucleotides encoding the antibodies were synthesized by incorporating low levels (˜30%) of non-parent nucleotides at each position within a CDR. For example, for a parent polynucleotide with A at a position to be soft randomized, a series of oligonucleotides were synthesized where about 70% have A at the position, 10% have C at the position, 10% have G at the position, and 10% have T at the position. As a result, when each position in a codon is soft randomized, approximately 34.3% of codons will remain unchanged, but any of the other 19 amino acids may also occur at the soft randomized position.

TABLE 5

	Human	Cyno	Human	Human	Human

	Human EpCAM	EpCAM	EpCAM	EpCAM	EpCAM	EpCAM
	(Biacore)	(ELISA)	(ELISA)	(CHO)	(HCT-116)	(JIMT1)	Epitope

scFv-Fc	k_a	k_d	K_D	EC₅₀	EC₅₀	K_D	K_D	K_D	BinExon
Antibody	(1/Ms)	(1/s)	(M)	(nM)	(nM)	(nM)	(nM)	(nM)	5

SRP1304-G11	1.03E+05	4.12E−04	3.99E−09	not deter-	not deter-	3	not deter-	not deter-	not deter-
(SEQ ID NO:				mined	mined		mined	mined	mined
204)
SRP 1464-A02	2.00E+05	1.97E−04	9.83E−10	0.009	not	2.6	6.7	5.2	not deter-
(SEQ ID NO:					detected				mined
208)
SRP 1464-A08	9.03E+04	1.74E−05	1.93E−10	0.39	not	1.2	3.6	2.7	yes
(SEQ ID NO:					detected
209)
SRP1464-B04	6.52E+04	2.56E−04	3.93E−09	0.39	16.18	2	6.9	7.6	yes
(SEQ ID NO:
210)

Table 6 shows results obtained from antibodies isolated from a second affinity matured library, constructed using soft randomization, based on the SRP1464-B04 antibody.
The “EC₅₀” value is the concentration of the antibody at which half-maximum signal is achieved in an ELISA assay where EpCAM protein is adsorbed onto a plate and then bound by the respective antibody provided herein. The anti-EpCAM antibody is detected with horseradish peroxidase (HRP)-conjugated anti-human Fc antibody.

TABLE 6

Results obtained from antibodies isolated from a first affinity matured library, based
on the SRP1464-B04 antibody provided in Table 5.

	Human EpCAM	Cyno EpCAM	Human EpCAM	Cyno EpCAM
	(Biacore)	(Biacore)	(CHO)	(CHO)

scFv-Fc	k_a	k_d	K_D	K_D	K_D	K_D	Epitope bin
Antibody	(1/Ms)	(1/s)	(M)	(M)	(nM)	(nM)	Exon 5

SRP1557-A04	2.10E+05	3.75E−04	1.78E−09	1.82E−08	1.85	2.5	Not tested
(SEQ ID NO:
211)
SRP1557-A05	2.20E+05	7.84E−04	3.56E−09	2.29E−08	2.49	1.83	Not tested
(SEQ ID NO:
212)
SRP1557-B03	1.49E+05	5.10E−04	3.43E−09	1.20E−07	1.45	1.59	Not tested
(SEQ ID NO:
213)
SRP1557-B10	1.43E+05	5.98E−04	4.17E−09	3.99E−08	1.71	1.35	Not tested
(SEQ ID NO:
214)
SRP1557-006	1.66E+05	9.08E−04	5.46E−09	2.97E−08	1.08	0.7	Not tested
(SEQ ID NO:
215)
SRP1557-E07	2.56E+05	1.58E−03	6.17E−09	8.10E−09	1.54	0.9	Not tested
(SEQ ID NO:
216)
SRP1557-E08	2.88E+05	7.90E−04	2.75E−09	7.52E−09	1.17	1.2	Not tested
(SEQ ID NO:
217)
SRP1557-E11	1.76E+05	6.04E−04	3.44E−09	4.52E−08	1.69	1.07	Not tested
(SEQ ID NO:
218)
SRP1557-F01	2.35E+05	1.69E−03	7.21E−09	1.17E−09	1.96	1.21	Not tested
(SEQ ID NO:
219)
SRP1557-F02	1.70E+05	2.54E−04	1.49E−09	2.91E−08	1.91	0.9	Not tested
(SEQ ID NO:
220)
SRP1557-F03	1.92E+05	1.00E−03	5.24E−09	8.59E−09	1.5	0.66	Not tested
(SEQ ID NO:
221)
SRP1557-F05	ND	ND	ND	ND	3.24	2.99	Not tested
(SEQ ID NO:
222)
SRP1557-G01	3.51E+05	1.23E−03	3.50E−09	4.41E−09	1.79	1.79	yes
(SEQ ID NO:
223)
SRP1557-G03	2.54E+05	1.75E−03	6.91E−09	1.62E−07	1.91	1.38	Not tested
(SEQ ID NO:
224)
SRP1557-G04	ND	ND	ND	ND	3.68	1.83	Not tested
(SEQ ID NO:
225)
SRP1557-G06	1.40E+05	9.39E−04	6.70E−09	1.52E−08	2.47	1.62	Not tested
(SEQ ID NO:
226)
SRP1557-H04	3.10E+05	7.87E−04	2.54E−09	7.22E−09	1.89	0.87	Not tested
(SEQ ID NO:
227)
SRP1557-H10	2.57E+05	3.06E−04	1.19E−09	3.52E−08	2.59	0.99	Not tested
(SEQ ID NO:
228)

Table 7 shows results obtained from antibodies isolated from a third affinity matured library constructed by performing soft randomization on a different antibody.

TABLE 7

Results obtained from antibodies isolated from a third affinity matured library.

Human

	Human EpCAM	EpCAM	EpCAM	Cyno EpCAM
	(Biacore)	(CHO)	(ELISA)	(ELISA)	Epitope

scFv-Fc	k_a	k_d	K_D	K_D	EC₅₀	EC₅₀	bin
Antibody	(1/Ms)	(1/s)	(M)	(nM)	(nM)	(nM)	Exon 5

SRP1332-C01	2.84E+05	2.57E−04	9.04E−10	1.6	0.33	not detected	Yes
(SEQ ID NO:
206)
SRP1332-A05	2.05E+05	2.97E−04	1.45E−09	2	0.47	not detected	Yes
(SEQ ID NO:
205)
SRP1332-F11	1.82E+05	2.57E−04	1.41E−09	1.14	0.47	not detected	Yes
(SEQ ID NO:
207)

Example 9: Sequences

Table 8 provides sequences referred to herein. In Table 8, the numbering scheme is indicated as Chothia or Kabat for the sequences where the scheme is significant, e.g., for CDR-H1 and CDR-H2 regions. Otherwise, the scheme is not indicated, and those of skill will recognize that either numbering scheme, or another, can apply.

TABLE 8

Sequences.

SEQ
ID NO:	Molecule	Region	Scheme	Sequence	Length

1	hEpCAM			MAPPQVLAFGLLLAAATATFAAAQEECVCE	314
				NYKLAVNCFVNNNRQCQCTSVGAQNTVICS
				KLAAKCLVMKAEMNGSKLGRRAKPEGALQN
				NDGLYDPDCDESGLFKAKQONGTSTCWCVN
				TAGVRRTDKDTEITCSERVRTYWIIIELKH
				KAREKPYDSKSLRTALQKEITTRYQLDPKF
				ITSILYENNVITIDLVQNSSQKTQNDVDIA
				DVAYYFEKDVKGESLFHSKKMDLTVNGEQL
				DLDPGQTLIYYVDEKAPEFSMQGLKAGVIA
				VIVVVVIAVVAGIVVLVISRKKRMAKYEKA
				EIKEMGEMHRELNA

2	cEpCAM			MAQSGQQCLQEEQETSLQQHYSFFVFLNFL	319
				ECVCENYKLAVNCFLNDNGQCQCTSIGAQN
				TVLCSKLAAKCLVMKAEMNGSKLGRRAKPE
				GALQNNDGLYDPDCDESGLFKAKQONGTST
				CWCVNTAGVRRTDKDTEITCSERVRTYWII
				IELKHKAREKPYDVQSLRTALEEAIKTRYQ
				LDPKFITNILYEDNVITIDLVQNSSQKTQN
				DVDIADVAYYFEKDVKGESLFHSKKMDLRV
				NGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
				AGVIAVIVVVVIAIVAGIVVLVISRKKRMA
				KYEKAEIKEMGEIHRELNA

3	mEpCAM			MAGPQALAFGLLLAVVTATLAAAQRDCVCD	315
				NYKLATSCSLNEYGECQCTSYGTQNTVICS
				KLASKCLAMKAEMTHSKSGRRIKPEGAIQN
				NDGLYDPDCDEQGLFKAKQCNGTATCWCVN
				TAGVRRTDKDTEITCSERVRTYWIIIELKH
				KERESPYDHQSLQTALQEAFTSRYKLNQKF
				IKNIMYENNVITIDLMQNSSQKTQDDVDIA
				DVAYYFEKDVKGESLFHSSKSMDLRVNGEP
				LDLDPGQTLIYYVDEKAPEFSMQGLTAGII
				AVIVVVSLAVIAGIVVLVISTRKKSAKYEK
				AEIKEMGEIHRELNA

4	1304-G11	CDR-H1	Chothia	GFTFSGS	7

5	1332-A05	CDR-H1	Chothia	DYAFANR	7

6	1332-C01	CDR-H1	Chothia	GYAFTNS	7

7	1332-F11	CDR-H1	Chothia	GYAFANR	7

8	1464-A02	CDR-H1	Chothia	GFTFGVE	7

9	1464-A08	CDR-H1	Chothia	GFTFSGS	7

10	1464-B04	CDR-H1	Chothia	GFTFSGS	7

11	1557-A04	CDR-H1	Chothia	GFTFSGS	7

12	1557-A05	CDR-H1	Chothia	GFTFGGS	7

13	1557-B03	CDR-H1	Chothia	GFTFRSS	7

14	1557-B10	CDR-H1	Chothia	GFTFSGC	7

15	1557-C06	CDR-H1	Chothia	GFTFRGA	7

16	1557-E07	CDR-H1	Chothia	GFTFSGS	7

17	1557-E08	CDR-H1	Chothia	GFTFRAS	7

18	1557-E11	CDR-H1	Chothia	GFTFRGS	7

19	1557-F01	CDR-H1	Chothia	GFTFSGS	7

20	1557-F02	CDR-H1	Chothia	GFTFRGS	7

21	1557-F03	CDR-H1	Chothia	GFTFSGS	7

22	1557-F05	CDR-H1	Chothia	GFTFRGS	7

23	1557-G01	CDR-H1	Chothia	GFTFSVT	7

24	1557-G03	CDR-H1	Chothia	GFTFGGS	7

25	1557-G04	CDR-H1	Chothia	GFTFCGS	7

26	1557-G06	CDR-H1	Chothia	GFTFSGF	7

27	1557-H04	CDR-H1	Chothia	GFTFSVT	7

28	1557-H10	CDR-H1	Chothia	GFTFSGS	7

29	1304-G11	CDR-H1	Kabat	GSSMS	5

30	1332-A05	CDR-H1	Kabat	NRWLG	5

31	1332-C01	CDR-H1	Kabat	NSWLG	5

32	1332-F11	CDR-H1	Kabat	NRWLG	5

33	1464-A02	CDR-H1	Kabat	VESMS	5

34	1464-A08	CDR-H1	Kabat	GSSMS	5

35	1464-B04	CDR-H1	Kabat	GSSMS	5

36	1557-A04	CDR-H1	Kabat	GSSMS	5

37	1557-A05	CDR-H1	Kabat	GSSMS	5

38	1557-B03	CDR-H1	Kabat	SSSMS	5

39	1557-B10	CDR-H1	Kabat	GCSMS	5

40	1557-C06	CDR-H1	Kabat	GASMS	5

41	1557-E07	CDR-H1	Kabat	GSSMS	5

42	1557-E08	CDR-H1	Kabat	ASSMS	5

43	1557-E11	CDR-H1	Kabat	GSSMS	5

44	1557-F01	CDR-H1	Kabat	GSSMS	5

45	1557-F02	CDR-H1	Kabat	GSSMS	5

46	1557-F03	CDR-H1	Kabat	GSSMS	5

47	1557-F05	CDR-H1	Kabat	GSSMS	5

48	1557-G01	CDR-H1	Kabat	VTSMS	5

49	1557-G03	CDR-H1	Kabat	GSSMS	5

50	1557-G04	CDR-H1	Kabat	GSSMS	5

51	1557-G06	CDR-H1	Kabat	GFSMS	5

52	1557-H04	CDR-H1	Kabat	VTSMS	5

53	1557-H10	CDR-H1	Kabat	GSSMS	5

54	1304-G11	CDR-H2	Chothia	DGGDGY	6

55	1332-A05	CDR-H2	Chothia	FPGSGN	6

56	1332-C01	CDR-H2	Chothia	FPGSGN	6

57	1332-F11	CDR-H2	Chothia	FPGSGN	6

58	1464-A02	CDR-H2	Chothia	DGGDGY	6

59	1464-A08	CDR-H2	Chothia	AGGDGY	6

60	1464-B04	CDR-H2	Chothia	DGGEGY	6

61	1557-A04	CDR-H2	Chothia	DGGEGS	6

62	1557-A05	CDR-H2	Chothia	GGGEGS	6

63	1557-B03	CDR-H2	Chothia	GGHEGY	6

64	1557-B10	CDR-H2	Chothia	AGGEGN	6

65	1557-006	CDR-H2	Chothia	DGSQGS	6

66	1557-E07	CDR-H2	Chothia	DGGEGS	6

67	1557-E08	CDR-H2	Chothia	DGGVGS	6

68	1557-E11	CDR-H2	Chothia	DGGEGS	6

69	1557-F01	CDR-H2	Chothia	DGGEGS	6

70	1557-F02	CDR-H2	Chothia	DGGEGS	6

71	1557-F03	CDR-H2	Chothia	AGGGGS	6

72	1557-F05	CDR-H2	Chothia	DGGEGS	6

73	1557-G01	CDR-H2	Chothia	AGGEGS	6

74	1557-G03	CDR-H2	Chothia	GGGEGY	6

75	1557-G04	CDR-H2	Chothia	DGGVGS	6

76	1557-G06	CDR-H2	Chothia	DGGEGS	6

77	1557-H04	CDR-H2	Chothia	AGGEGS	6

78	1557-H10	CDR-H2	Chothia	DGGEGS	6

79	1304-G11	CDR-H2	Kabat	AIDGGDGYTNYADSVRG	17

80	1332-A05	CDR-H2	Kabat	DIFPGSGNIHYNEKFKG	17

81	1332-C01	CDR-H2	Kabat	DIFPGSGNIHYNEKFKG	17

82	1332-F11	CDR-H2	Kabat	DIFPGSGNIHYNEKFKG	17

83	1464-A02	CDR-H2	Kabat	AIDGGDGYTGYADSVKD	17

84	1464-A08	CDR-H2	Kabat	AIAGGDGYTGYADSVKG	17

85	1464-B04	CDR-H2	Kabat	AIDGGEGYTSYADSVKG	17

86	1557-A04	CDR-H2	Kabat	AIDGGEGSTAYADSVKG	17

87	1557-A05	CDR-H2	Kabat	AIGGGEGSTGYADSVKG	17

88	1557-B03	CDR-H2	Kabat	AIGGHEGYTGYADSVKG	17

89	1557-B10	CDR-H2	Kabat	AIAGGEGNTGYADSVKG	17

90	1557-C06	CDR-H2	Kabat	AIDGSQGSTGYADSVKG	17

91	1557-E07	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

92	1557-E08	CDR-H2	Kabat	AIDGGVGSTGYADSVKG	17

93	1557-E11	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

94	1557-F01	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

95	1557-F02	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

96	1557-F03	CDR-H2	Kabat	AIAGGGGSTGYADSVKG	17

97	1557-F05	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

98	1557-G01	CDR-H2	Kabat	AIAGGEGSTGYADSVKG	17

99	1557-G03	CDR-H2	Kabat	AIGGGEGYTGYADSVKG	17

100	1557-G04	CDR-H2	Kabat	AIDGGVGSTGYADSVKG	17

101	1557-G06	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

102	1557-H04	CDR-H2	Kabat	AIAGGEGSTGYADSVKG	17

103	1557-H10	CDR-H2	Kabat	AIDGGEGSTGYADSVKG	17

104	1304-G11	CDR-H3		GWHPQTYYGLDY	12

105	1332-A05	CDR-H3		LRNWEGPMDY	10

106	1332-C01	CDR-H3		LRNWDMPMDY	10

107	1332-F11	CDR-H3		LRNWEGPMDY	10

108	1464-A02	CDR-H3		AWHPQTYYGVDY	12

109	1464-A08	CDR-H3		GWHRQDYYGQDY	12

110	1464-B04	CDR-H3		GWHPQTLYDLDY	12

111	1557-A04	CDR-H3		GWHPQTMYDLDY	12

112	1557-A05	CDR-H3		GWHDQSLYDRDY	12

113	1557-B03	CDR-H3		GWNPQTLYHLDY	12

114	1557-B10	CDR-H3		GWHPQTLYDLDY	12

115	1557-C06	CDR-H3		GWHPQTMYDLDY	12

116	1557-E07	CDR-H3		GWHPQTLYDLDY	12

117	1557-E08	CDR-H3		GWHPQTLYDLDY	12

118	1557-E11	CDR-H3		GWHPQSLYDLDY	12

119	1557-F01	CDR-H3		GWHPQTLYDLDY	12

120	1557-F02	CDR-H3		GWHPQTMYNLDY	12

121	1557-F03	CDR-H3		GWHPQTLYDLDY	12

122	1557-F05	CDR-H3		DWHPQTLYDLDY	12

123	1557-G01	CDR-H3		GWHPQTLYDLDY	12

124	1557-G03	CDR-H3		GWHPQTLYDLDY	12

125	1557-G04	CDR-H3		GWHPQTLYDLDY	12

126	1557-G06	CDR-H3		GWHPQTLYHLDY	12

127	1557-H04	CDR-H3		GWHPQTLYDLDY	12

128	1557-H10	CDR-H3		GWHPQSMYDLDY	12

129	1304-G11	CDR-L1		RASQSVSSSYLA	12

130	1332-A05	CDR-L1		KSSQSLLNSGNQKNYLT	17

131	1332-C01	CDR-L1		KSSQSLLNSGNQKNYLT	17

132	1332-F11	CDR-L1		KSSQSLLNSGNQKNYLT	17

133	1464-A02	CDR-L1		RASQSVSSSYLA	12

134	1464-A08	CDR-L1		RASQSVSSSYLA	12

135	1464-B04	CDR-L1		RASQSVSSSYLA	12

136	1557-A04	CDR-L1		RASQNVSTNYLA	12

137	1557-A05	CDR-L1		SASQTVSSSYIA	12

138	1557-B03	CDR-L1		RASQKCSSSSMA	12

139	1557-B10	CDR-L1		RASQGLASRYMA	12

140	1557-C06	CDR-L1		RASQRGTSSYLA	12

141	1557-E07	CDR-L1		RASQVLSSSSLA	12

142	1557-E08	CDR-L1		RASQGDSSSVLA	12

143	1557-E11	CDR-L1		RASQPVPNTTLA	12

144	1557-F01	CDR-L1		RASQSVSSSKLA	12

145	1557-F02	CDR-L1		RASQSVSSSYLA	12

146	1557-F03	CDR-L1		RASQSVKTSDLA	12

147	1557-F05	CDR-L1		RASQTVSPSVLA	12

148	1557-G01	CDR-L1		RASQVLSSSSLA	12

149	1557-G03	CDR-L1		RASQSVHSSYLA	12

150	1557-G04	CDR-L1		RASQSVSSSYLA	12

151	1557-G06	CDR-L1		RASQSIPSSYLA	12

152	1557-H04	CDR-L1		RASQSVSTGYLA	12

153	1557-H10	CDR-L1		RASQVLSSSSLA	12

154	1304-G11	CDR-L2		GASSRAT	7

155	1332-A05	CDR-L2		WASTRES	7

156	1332-C01	CDR-L2		WASTRES	7

157	1332-F11	CDR-L2		RASTRES	7

158	1464-A02	CDR-L2		GASSRAT	7

159	1464-A08	CDR-L2		GASSRAT	7

160	1464-B04	CDR-L2		GASSRAT	7

161	1557-A04	CDR-L2		GASSRAT	7

162	1557-A05	CDR-L2		GASSRAT	7

163	1557-B03	CDR-L2		GASSRAT	7

164	1557-B10	CDR-L2		GASSRAT	7

165	1557-C06	CDR-L2		GASSRAT	7

166	1557-E07	CDR-L2		GASSRAT	7

167	1557-E08	CDR-L2		GASSRAT	7

168	1557-E11	CDR-L2		GASSRAT	7

169	1557-F01	CDR-L2		GASSRAT	7

170	1557-F02	CDR-L2		GASSRAT	7

171	1557-F03	CDR-L2		GASSRAT	7

172	1557-F05	CDR-L2		GASSRAT	7

173	1557-G01	CDR-L2		GASSRAT	7

174	1557-G03	CDR-L2		GASSRAT	7

175	1557-G04	CDR-L2		GASSRAT	7

176	1557-G06	CDR-L2		GASSRAT	7

177	1557-H04	CDR-L2		GASSRAT	7

178	1557-H10	CDR-L2		GASSRAT	7

179	1304-G11	CDR-L3		QQYWYGPPT	9

180	1332-A05	CDR-L3		QNDLSYPLT	9

181	1332-C01	CDR-L3		QNDYRYPLT	9

182	1332-F11	CDR-L3		QNDSSYPLT	9

183	1464-A02	CDR-L3		QQTSEAPPT	9

184	1464-A08	CDR-L3		QQNQAAPAT	9

185	1464-B04	CDR-L3		QQLVTSPPT	9

186	1557-A04	CDR-L3		QQLVTNPPT	9

187	1557-A05	CDR-L3		QQLLTSPPT	9

188	1557-B03	CDR-L3		QQLQTSPPT	9

189	1557-B10	CDR-L3		QQVMTIPPT	9

190	1557-C06	CDR-L3		QQHVTSPPT	9

191	1557-E07	CDR-L3		QQRAAPPPT	9

192	1557-E08	CDR-L3		QQLVPSPPT	9

193	1557-E11	CDR-L3		QQLVPSPPT	9

194	1557-F01	CDR-L3		QQLETIPPT	9

195	1557-F02	CDR-L3		QQLFNSPPT	9

196	1557-F03	CDR-L3		QQLVSKPPT	9

197	1557-F05	CDR-L3		QQLVTNPPT	9

198	1557-G01	CDR-L3		QQLVTSPPT	9

199	1557-G03	CDR-L3		QQLLSSPPT	9

200	1557-G04	CDR-L3		QQDSFVPPT	9

201	1557-G06	CDR-L3		QQLATSPPT	9

202	1557-H04	CDR-L3		QQLVTRPPT	9

203	1557-H10	CDR-L3		QQLVTAPPT	9

204	1304-G11	scFv-Fc		MEVQLLESGGGLVRPGGSLRLSCAASGFTF	492
				SGSSMSWVRQAPGKGLEWVGAIDGGDGYTN
				YADSVRGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTYYGLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSSSGTDFT
				LTISRLEPEDFAVYYCQQYWYGPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGGSHHHHHH

205	1332-A05	scFv-Fc		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL	507
				LNSGNQKNYLTWYQQKPGQPPKLLIYWAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDLSYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASDYAFANRWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWEGPMDYWG
				QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS
				APELLGGSSVFLFPPKPKDTLMISRTPEVT
				CVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
				PREEQYNSTYRVVSVLTVLHQDWLNGKEYK
				CKVSNKALPAPIEKTISKAKGQPREPQVYT
				LPPSRDELTKNQVSLTCLVKGFYPSDIAVE
				WESNGQPENNYKTTPPVLDSDGSFFLYSKL
				TVDKSRWQQGNVFSCSVMHEALHNHYTQKS
				LSLSPGKGSGDYKDDDDKGSGHHHHHH

206	1332-C01	scFv-Fc		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL	507
				LNSGNQKNYLTWYQQKPGQPPKLLIYWAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDYRYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASGYAFTNSWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWDMPMDYWG
				QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS
				APELLGGSSVFLFPPKPKDTLMISRTPEVT
				CVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
				PREEQYNSTYRVVSVLTVLHQDWLNGKEYK
				CKVSNKALPAPIEKTISKAKGQPREPQVYT
				LPPSRDELTKNQVSLTCLVKGFYPSDIAVE
				WESNGQPENNYKTTPPVLDSDGSFFLYSKL
				TVDKSRWQQGNVFSCSVMHEALHNHYTQKS
				LSLSPGKGSGDYKDDDDKGSGHHHHHH

207	1332-F11	scFv-Fc		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL	507
				LNSGNQKNYLTWYQQKPGQPPKLLIYRAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDSSYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASGYAFANRWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWEGPMDYWG
				QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS
				APELLGGSSVFLFPPKPKDTLMISRTPEVT
				CVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
				PREEQYNSTYRVVSVLTVLHQDWLNGKEYK
				CKVSNKALPAPIEKTISKAKGQPREPQVYT
				LPPSRDELTKNQVSLTCLVKGFYPSDIAVE
				WESNGQPENNYKTTPPVLDSDGSFFLYSKL
				TVDKSRWQQGNVFSCSVMHEALHNHYTQKS
				LSLSPGKGSGDYKDDDDKGSGHHHHHH

208	1464-A02	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				GVESMSWVRQAPGKGLEWVGAIDGGDGYTG
				YADSVKDRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKAWHPQTYYGVDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQTSEAPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

209	1464-A08	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIAGGDGYTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHRQDYYGQDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLGCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQNQAAPATFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

210	1464-B04	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIDGGEGYTS
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

211	1557-A04	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTA
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGNEIVLTQSPGTLSL
				SPGERATLSCRASQNVSTNYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTNPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

212	1557-A05	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				GGSSMSWVRQAPGKGLEWVGAIGGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHDQSLYDRDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCSASQTVSSSYIAWYQQKPGQ
				APRLLIYGASSRATGIPDRFGGSGSGTDFT
				LTISRLEPEDFAVYYCQQLLTSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

213	1557-B03	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				RSSSMSWVRQAPGKGLEWVGAIGGHEGYTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWNPQTLYHLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQKCSSSSMAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLQTSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

214	1557-B10	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGCSMSWVRQAPGKGLEWVGAIAGGEGNTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQGLASRYMAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQVMTIPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

215	1557-C06	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				RGASMSWVRQAPGKGLEWVGAIDGSQGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV
				SSGGCGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQRGTSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQHVTSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

216	1557-E07	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATMSCRASQVLSSSSLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFA
				LTISRLEPEDFAVYYCQQRAAPPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

217	1557-E08	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				RASSMSWMRQAPGKGLEWVGAIDGGVGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQGDSSSVLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVPSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

218	1557-E11	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTINRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQSLYDLDYWGQGTLVTV
				SSGGGGSGGGDSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQPVPNTTLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAAYYCQQLVPSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

219	1557-F01	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSKLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGYGSGTDFT
				LTISRLEPEDFAVYYCQQLETIPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

220	1557-F02	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTMYNLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLFNSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

221	1557-F03	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIAGGGGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVKTSDLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVSKPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

222	1557-F05	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKDWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQTVSPSVLAWYQQKPGQ
				APRLLIYGASSRATGIPGRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTNPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

223	1557-G01	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATMSCRASQVLSSSSLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

224	1557-G03	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				GGSSMSWVRQAPGKGLEWVGAIGGGEGYTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVHSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLLSSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

225	1557-G04	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				CGSSMSWVRQAPGKGLEWVGAIDGGVGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGDSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQDSFVPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

226	1557-G06	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGFSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYHLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSIPSSYLAWYQQEPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLATSPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

227	1557-H04	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSDGGGSGGGGSEIVLTQGPSTLSL
				SPGERATLSCRASQSVSTGYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTRPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

228	1557-H10	scFv-Fc		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	503
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQSMYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATMSCRASQVLSSSSLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTAPPTFGQGT
				KVEIKAAGSDQEPKSSDKTHTCPPCSAPEL
				LGGSSVFLFPPKPKDTLMISRTPEVTCVVV
				DVSHEDPEVKFNWYVDGVEVHNAKTKPREE
				QYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
				NKALPAPIEKTISKAKGQPREPQVYTLPPS
				RDELTKNQVSLTCLVKGFYPSDIAVEWESN
				GQPENNYKTTPPVLDSDGSFFLYSKLTVDK
				SRWQQGNVFSCSVMHEALHNHYTQKSLSLS
				PGKGSGDYKDDDDKGSGHHHHHH

229	1304-G11	VH		EVQLLESGGGLVRPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIDGGDGYTNY
				ADSVRGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTYYGLDYWGQGTLVTVS
				S

230	1332-A05	VH		EVQLLEQSGAELVRPGTSVKISCKASDYAF	120
				ANRWLGWVKQRPGHGLEWIGDIFPGSGNIH
				YNEKFKGKATLTADKSSSTAYMQLSSLTFE
				DSAVYFCARLRNWEGPMDYWGQGTTVTVSS

231	1332-C01	VH		EVQLLEQSGAELVRPGTSVKISCKASGYAF	120
				TNSWLGWVKQRPGHGLEWIGDIFPGSGNIH
				YNEKFKGKATLTADKSSSTAYMQLSSLTFE
				DSAVYFCARLRNWDMPMDYWGQGTTVTVSS

232	1332-F11	VH		EVQLLEQSGAELVRPGTSVKISCKASGYAF	120
				ANRWLGWVKQRPGHGLEWIGDIFPGSGNIH
				YNEKFKGKATLTADKSSSTAYMQLSSLTFE
				DSAVYFCARLRNWEGPMDYWGQGTTVTVSS

233	1464-A02	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFG	121
				VESMSWVRQAPGKGLEWVGAIDGGDGYTGY
				ADSVKDRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKAWHPQTYYGVDYWGQGTLVTVS
				S

234	1464-A08	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIAGGDGYTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHRQDYYGQDYWGQGTLVTVS
				S

235	1464-B04	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGYTSY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

236	1557-A04	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTAY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTMYDLDYWGQGTLVTVS
				S

237	1557-A05	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFG	121
				GSSMSWVRQAPGKGLEWVGAIGGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHDQSLYDRDYWGQGTLVTVS
				S

238	1557-B03	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFR	121
				SSSMSWVRQAPGKGLEWVGAIGGHEGYTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWNPQTLYHLDYWGQGTLVTVS
				S

239	1557-B10	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GCSMSWVRQAPGKGLEWVGAIAGGEGNTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

240	1557-C06	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFR	121
				GASMSWVRQAPGKGLEWVGAIDGSQGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTMYDLDYWGQGTLVTVS
				S

241	1557-E07	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

242	1557-E08	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFR	121
				ASSMSWMRQAPGKGLEWVGAIDGGVGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

243	1557-E11	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFR	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTINRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQSLYDLDYWGQGTLVTVS
				S

244	1557-F01	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

245	1557-F02	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFR	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTMYNLDYWGQGTLVTVS
				S

246	1557-F03	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIAGGGGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

247	1557-F05	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFR	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKDWHPQTLYDLDYWGQGTLVTVS
				S

248	1557-G01	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				VTSMSWMRQAPGKGLEWVGAIAGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

249	1557-G03	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFG	121
				GSSMSWVRQAPGKGLEWVGAIGGGEGYTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

250	1557-G04	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFC	121
				GSSMSWVRQAPGKGLEWVGAIDGGVGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

251	1557-G06	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GFSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYHLDYWGQGTLVTVS
				S

252	1557-H04	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				VTSMSWMRQAPGKGLEWVGAIAGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQTLYDLDYWGQGTLVTVS
				S

253	1557-H10	VH		EVQLLESGGGLVQPGGSLRLSCAASGFTFS	121
				GSSMSWVRQAPGKGLEWVGAIDGGEGSTGY
				ADSVKGRFTISRDNSKNTLYLQMNSLRAED
				TAVYYCAKGWHPQSMYDLDYWGQGTLVTVS
				S

254	1304-G11	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVS	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSSSGTDFTLTISRLEPEDFAVYYCQ
				QYWYGPPTFGQGTKVEIK

255	1332-A05	VL		ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL	113
				NSGNQKNYLTWYQQKPGQPPKLLIYWASTR
				ESGVPDRFTGSGSGTDFTLTISSVQAEDLA
				VYYCQNDLSYPLTFGAGTKLEIK


256	1332-C01	VL		ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL	113
				NSGNQKNYLTWYQQKPGQPPKLLIYWASTR
				ESGVPDRFTGSGSGTDFTLTISSVQAEDLA
				VYYCQNDYRYPLTFGAGTKLEIK

257	1332-F11	VL		ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL	113
				NSGNQKNYLTWYQQKPGQPPKLLIYRASTR
				ESGVPDRFTGSGSGTDFTLTISSVQAEDLA
				VYYCQNDSSYPLTFGAGTKLEIK


258	1464-A02	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVS	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QTSEAPPTFGQGTKVEIK


259	1464-A08	VL		EIVLTQSPGTLSLSPGERATLGCRASQSVS	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QNQAAPATFGQGTKVEIK


260	1464-B04	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVS	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVTSPPTFGQGTKVEIK


261	1557-A04	VL		EIVLTQSPGTLSLSPGERATLSCRASQNVS	108
				TNYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVTNPPTFGQGTKVEIK


262	1557-A05	VL		EIVLTQSPGTLSLSPGERATLSCSASQTVS	108
				SSYIAWYQQKPGQAPRLLIYGASSRATGIP
				DRFGGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLLTSPPTFGQGTKVEIK

263	1557-B03	VL		EIVLTQSPGTLSLSPGERATLSCRASQKCS	108
				SSSMAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLQTSPPTFGQGTKVEIK


264	1557-B10	VL		EIVLTQSPGTLSLSPGERATLSCRASQGLA	108
				SRYMAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QVMTIPPTFGQGTKVEIK


265	1557-C06	VL		EIVLTQSPGTLSLSPGERATLSCRASQRGT	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QHVTSPPTFGQGTKVEIK


266	1557-E07	VL		EIVLTQSPGTLSLSPGERATMSCRASQVLS	108
				SSSLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFALTISRLEPEDFAVYYCQ
				QRAAPPPTFGQGTKVEIK

267	1557-E08	VL		EIVLTQSPGTLSLSPGERATLSCRASQGDS	108
				SSVLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVPSPPTFGQGTKVEIK


268	1557-E11	VL		EIVLTQSPGTLSLSPGERATLSCRASQPVP	108
				NTTLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAAYYCQ
				QLVPSPPTFGQGTKVEIK


269	1557-F01	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVS	108
				SSKLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGYGSGTDFTLTISRLEPEDFAVYYCQ
				QLETIPPTFGQGTKVEIK


270	1557-F02	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVS	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLFNSPPTFGQGTKVEIK

271	1557-F03	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVK	108
				TSDLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVSKPPTFGQGTKVEIK

272	1557-F05	VL		EIVLTQSPGTLSLSPGERATLSCRASQTVS	108
				PSVLAWYQQKPGQAPRLLIYGASSRATGIP
				GRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVTNPPTFGQGTKVEIK


273	1557-G01	VL		EIVLTQSPGTLSLSPGERATMSCRASQVLS	108
				SSSLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVTSPPTFGQGTKVEIK

274	1557-G03	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVH	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLLSSPPTFGQGTKVEIK


275	1557-G04	VL		EIVLTQSPGTLSLSPGERATLSCRASQSVS	108
				SSYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QDSFVPPTFGQGTKVEIK


276	1557-G06	VL		EIVLTQSPGTLSLSPGERATLSCRASQSIP	108
				SSYLAWYQQEPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLATSPPTFGQGTKVEIK


277	1557-H04	VL		EIVLTQGPSTLSLSPGERATLSCRASQSVS	108
				TGYLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVTRPPTFGQGTKVEIK


278	1557-H10	VL		EIVLTQSPGTLSLSPGERATMSCRASQVLS	108
				SSSLAWYQQKPGQAPRLLIYGASSRATGIP
				DRFSGSGSGTDFTLTISRLEPEDFAVYYCQ
				QLVTAPPTFGQGTKVEIK

279	IgG1			ASTKGPSVFPLAPSSKSTSGGTAALGCLVK	330
	Constant			DYFPEPVTVSWNSGALTSGVHTFPAVLQSS
	Region			GLYSLSSVVTVPSSSLGTQTYICNVNHKPS
				NTKVDKKVEPKSCDKTHTCPPCPAPELLGG
				PSVFLFPPKPKDTLMISRTPEVTCVVVDVS
				HEDPEVKFNWYVDGVEVHNAKTKPREEQYN
				STYRVVSVLTVLHQDWLNGKEYKCKVSNKA
				LPAPIEKTISKAKGQPREPQVYTLPPSREE
				MTKNQVSLTCLVKGFYPSDIAVEWESNGQP
				ENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
				QQGNVFSCSVMHEALHNHYTQKSLSLSPGK

280	IgG1 Fc			AAGSDQEPKSSDKTHTCPPCSAPELLGGSS	252
	from			VFLFPPKPKDTLMISRTPEVTCVVVDVSHE
	scFv-Fc			DPEVKFNWYVDGVEVHNAKTKPREEQYNST
				YRVVSVLTVLHQDWLNGKEYKCKVSNKALP
				APIEKTISKAKGQPREPQVYTLPPSRDELT
				KNQVSLTCLVKGFYPSDIAVEWESNGQPEN
				NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
				GNVFSCSVMHEALHNHYTQKSLSLSPGKGS
				GDYKDDDDKGSG

281	Lambda			GQPKAAPSVTLFPPSSEELQANKATLVCLI	106
	Constant			SDFYPGAVTVAWKADSSPVKAGVETTTPSK
	Region			QSNNKYAASSYLSLTPEQWKSHRSYSCQVT
				HEGSTVEKTVAPTECS

282	Kappa			RTVAAPSVFIFPPSDEQLKSGTASVVCLLN	107
	Constant			NFYPREAKVQWKVDNALQSGNSQESVTEQD
	Region			SKDSTYSLSSTLTLSKADYEKHKVYACEVT
				HQGLSSPVTKSFNRGEC

283	Linker			GGGGSGGGGSGGGGS	15

284	Linker			AAGSDQ	6

285	His Tag			GSGDYKDDDDKGSGHHHHHH	20
	with
	Linker

286	mAb_3-1	CDR-H1	Chothia	GYAFTNY	7

287	mAb_3-5	CDR-H1	Chothia	GYTFTSY	7

288	mAb_4-1	CDR-H1	Chothia	GYAFTNY	7

289	mAb_4-7	CDR-H1	Chothia	GYTFTNY	7

290	mAb_5-10	CDR-H1	Chothia	GYAFTNY	7

291	mAb_3-1	CDR-H1	Kabat	NYWLG	5

292	mAb_3-5	CDR-H1	Kabat	SYGLS	5

293	mAb_4-1	CDR-H1	Kabat	NYWLG	5

294	mAb_4-7	CDR-H1	Kabat	NYGLS	5

295	mAb_5-10	CDR-H1	Kabat	NYWLG	5

296	mAb_3-1	CDR-H2	Chothia	FPGSGN	6

297	mAb_3-5	CDR-H2	Chothia	YPRIGN	6

298	mAb_4-1	CDR-H2	Chothia	FPGSGN	6

299	mAb_4-7	CDR-H2	Chothia	YPRIGN	6

300	mAb_5-10	CDR-H2	Chothia	FPGSGN	6

301	mAb_3-1	CDR-H2	Kabat	DLFPGSGNTHYNERFRG	17

302	mAb_3-5	CDR-H2	Kabat	EVYPRIGNAYYNEKFKG	17

303	mAb_4-1	CDR-H2	Kabat	DIFPGSGNAHYNEKFKG	17

304	mAb_4-7	CDR-H2	Kabat	EVYPRIGNAYYNEKFKG	17

305	mAb_5-10	CDR-H2	Kabat	DIFPGSGNIHYNEKFKG	17

306	mAb_3-1	CDR-H3		LRNWDEAMDY	10

307	mAb_3-5	CDR-H3		RGSYGSNYDWYFDV	14

308	mAb_4-1	CDR-H3		LRNWDEAMDY	10

309	mAb_4-7	CDR-H3		RGSYDTNYDWYFDV	14

310	mAb_5-10	CDR-H3		LRNWDEPMDY	10

311	mAb_3-1	CDR-L1		RASKSISKYLA	11

312	mAb_3-5	CDR-L1		RSSQSLVHSNGNTYLH	16

313	mAb_4-1	CDR-L1		KSSQSLLNSGNQKNYLA	17

314	mAb_4-7	CDR-L1		RSSQSLVHSNGNTYLH	16

315	mAb_5-10	CDR-L1		KSSQSLLNSGNQKNYLT	17

316	mAb_3-1	CDR-L2		SGSTLQS	7

317	mAb_3-5	CDR-L2		KVSNRFS	7

318	mAb_4-1	CDR-L2		GASTRES	7

319	mAb_4-7	CDR-L2		KVSNRFS	7

320	mAb_5-10	CDR-L2		WASTRES	7

321	mAb_3-1	CDR-L3		QQHNEYPYT	9

322	mAb_3-5	CDR-L3		SQSTHVPYT	9

323	mAb_4-1	CDR-L3		QNDYSYPYT	9

324	mAb_4-7	CDR-L3		SQSTHVPYT	9

325	mAb_5-10	CDR-L3		QNDYSYPLT	9

326	mAb_3-1	VH		EVQLLEQSGAELVKPGASVKISCKASGYAF
				TNYWLGWVKQRPGHGLEWIGDLFPGSGNTH
				YNERFRGKATLTADKSSSTAFMQLSSLTSE
				DSAVYFCARLRNWDEAMDYWGQGTTVTVSS

327	mAb_3-5	VH		EVQLLEQSGAELVRPGTSVKLSCKASGYTF
				TSYGLSWVKQRTGQGLEWIGEVYPRIGNAY
				YNEKFKGKATLTADKSSSTASMELRSLTSE
				DSAVYFCARRGSYGSNYDWYFDVWGQGTTV
				TVSS

328	mAb_4-1	VH		EVQLLEQSGAELVRPGTSVKISCKASGYAF
				TNYWLGWVKQRPGHGLEWVGDIFPGSGNAH
				YNEKFKGKATLTADKSSYTAYMQLSSLTSE
				DSAVYFCARLRNWDEAMDYWGQGTTVTVSS

329	mAb_4-7	VH		EVQLLEQSGAELARPGASVKLSCKASGYTF
				TNYGLSWVKQRPGQVLEWIGEVYPRIGNAY
				YNEKFKGKATLTADKSSSTASMELRSLTSE
				DSAVYFCARRGSYDTNYDWYFDVWGQGTTV
				TVSS

330	mAb_5-10	VH		EVQLLEQSGAELVRPGTSVKISCKASGYAF
				TNYWLGWVKQRPGHGLEWIGDIFPGSGNIH
				YNEKFKGKATLTADKSSSTAYMQLSSLTFE
				DSAVYFCARLRNWDEPMDYWGQGTTVTVSS

331	mAb_3-1	VL		ELVMTQSPSYLAASPGETITINCRASKSIS
				KYLAWYQEKPGKTNKLLIYSGSTLQSGIPS
				RFSGSGSGTDFTLTISSLEPEDFAMYYCQQ
				HNEYPYTFGGGTKLEIK

332	mAb_3-5	VL		ELVMTQTPLSLPVSLGDQASISCRSSQSLV
				HSNGNTYLHWYLQKPGQSPKLLIYKVSNRF
				SGVPDRFSGSGSGTDFTLKISRVEAEDLGV
				YFCSQSTHVPYTFGGGTKLEIK

333	mAb_4-1	VL		ELVMTQSPSSLSVSAGEKVTMSCKSSQSLL
				NSGNQKNYLAWYQQKPGQPPKLLIYGASTR
				ESGVPDRFTGSGSGTDFTLTISSVQAEDLA
				VYYCQNDYSYPYTFGGGTKLEIK

334	mAb_4-7	VL		ELVMTQTPLSLPVSLGDQASISCRSSQSLV
				HSNGNTYLHWYLQKPGQSPKLLIYKVSNRF
				SGVPDRFSGSGSGTDFTLKISRVEAEDLGV
				YFCSQSTHVPYTFGGGTKLEIK

335	mAb_5-10	VL		ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL
				NSGNQKNYLTWYQQKPGQPPKLLIYWASTR
				ESGVPDRFTGSGSGTDFTLTISSVQAEDLA
				VYYCQNDYSYPLTFGAGTKLEIK

336	mAB_5-10	scFv		ELVMTQSPSSLTVTAGEKVTMSCKSSQSLL
				NSGNQKNYLTWYQQKPGQPPKLLIYWAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDYSYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASGYAFTNYWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWDEPMDYWG
				QGTTVTVSS

337	1304-G11	scFv		MEVQLLESGGGLVRPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIDGGDGYTN
				YADSVRGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTYYGLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSSSGTDFT
				LTISRLEPEDFAVYYCQQYWYGPPTFGQGT
				KVEIK

338	1332-A05	scFv		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL	249
				LNSGNQKNYLTWYQQKPGQPPKLLIYWAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDLSYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASDYAFANRWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWEGPMDYWG
				QGTTVTVSS

339	1332-C01	scFv		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL	249
				LNSGNQKNYLTWYQQKPGQPPKLLIYWAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDYRYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASGYAFTNSWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWDMPMDYWG
				QGTTVTVSS

340	1332-F11	scFv		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL	249
				LNSGNQKNYLTWYQQKPGQPPKLLIYRAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDSSYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASGYAFANRWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWEGPMDYWG
				QGTTVTVSS

341	1464-A02	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				GVESMSWVRQAPGKGLEWVGAIDGGDGYTG
				YADSVKDRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKAWHPQTYYGVDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQTSEAPPTFGQGT
				KVEIK

342	1464-A08	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF		245
				SGSSMSWVRQAPGKGLEWVGAIAGGDGYTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHRQDYYGQDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLGCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQNQAAPATFGQGT
				KVEIK

343	1464-B04	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIDGGEGYTS
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTSPPTFGQGT
				KVEIK

344	1557-A04	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTA
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGNEIVLTQSPGTLSL
				SPGERATLSCRASQNVSTNYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTNPPTFGQGT
				KVEIK

345	1557-A05	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				GGSSMSWVRQAPGKGLEWVGAIGGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHDQSLYDRDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCSASQTVSSSYIAWYQQKPGQ
				APRLLIYGASSRATGIPDRFGGSGSGTDFT
				LTISRLEPEDFAVYYCQQLLTSPPTFGQGT
				KVEIK

346	1557-B03	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF		245
				RSSSMSWVRQAPGKGLEWVGAIGGHEGYTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWNPQTLYHLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQKCSSSSMAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLQTSPPTFGQGT
				KVEIK

347	1557-B10	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGCSMSWVRQAPGKGLEWVGAIAGGEGNTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQGLASRYMAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQVMTIPPTFGQGT
				KVEIK

348	1557-C06	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				RGASMSWVRQAPGKGLEWVGAIDGSQGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTMYDLDYWGQGTLVTV
				SSGGCGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQRGTSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQHVTSPPTFGQGT
				KVEIK

349	1557-E07	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATMSCRASQVLSSSSLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFA
				LTISRLEPEDFAVYYCQQRAAPPPTFGQGT
				KVEIK

350	1557-E08	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				RASSMSWMRQAPGKGLEWVGAIDGGVGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQGDSSSVLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVPSPPTFGQGT
				KVEIK

351	1557-E11	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTINRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQSLYDLDYWGQGTLVTV
				SSGGGGSGGGDSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQPVPNTTLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAAYYCQQLVPSPPTFGQGT
				KVEIK

352	1557-F01	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSKLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGYGSGTDFT
				LTISRLEPEDFAVYYCQQLETIPPTFGQGT
				KVEIK

353	1557-F02	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTMYNLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLFNSPPTFGQGT
				KVEIK

354	1557-F03	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIAGGGGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVKTSDLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVSKPPTFGQGT
				KVEIK

355	1557-F05	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				RGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKDWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQTVSPSVLAWYQQKPGQ
				APRLLIYGASSRATGIPGRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTNPPTFGQGT
				KVEIK

356	1557-G01	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATMSCRASQVLSSSSLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTSPPTFGQGT
				KVEIK

357	1557-G03	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				GGSSMSWVRQAPGKGLEWVGAIGGGEGYTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVHSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLLSSPPTFGQGT
				KVEIK

358	1557-G04	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				CGSSMSWVRQAPGKGLEWVGAIDGGVGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGDSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSVSSSYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQDSFVPPTFGQGT
				KVEIK

359	1557-G06	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGFSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYHLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATLSCRASQSIPSSYLAWYQQEPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLATSPPTFGQGT
				KVEIK

360	1557-H04	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SVTSMSWMRQAPGKGLEWVGAIAGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQTLYDLDYWGQGTLVTV
				SSGGGGSDGGGSGGGGSEIVLTQGPSTLSL
				SPGERATLSCRASQSVSTGYLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTRPPTFGQGT
				KVEIK

361	1557-H10	scFv		MEVQLLESGGGLVQPGGSLRLSCAASGFTF	245
				SGSSMSWVRQAPGKGLEWVGAIDGGEGSTG
				YADSVKGRFTISRDNSKNTLYLQMNSLRAE
				DTAVYYCAKGWHPQSMYDLDYWGQGTLVTV
				SSGGGGSGGGGSGGGGSEIVLTQSPGTLSL
				SPGERATMSCRASQVLSSSSLAWYQQKPGQ
				APRLLIYGASSRATGIPDRFSGSGSGTDFT
				LTISRLEPEDFAVYYCQQLVTAPPTFGQGT
				KVEIK

362	mAB_5-10	scFv-Fc		MELVMTQSPSSLTVTAGEKVTMSCKSSQSL
				LNSGNQKNYLTWYQQKPGQPPKLLIYWAST
				RESGVPDRFTGSGSGTDFTLTISSVQAEDL
				AVYYCQNDYSYPLTFGAGTKLEIKGGGGSG
				GGGSGGGGSEVQLLEQSGAELVRPGTSVKI
				SCKASGYAFTNYWLGWVKQRPGHGLEWIGD
				IFPGSGNIHYNEKFKGKATLTADKSSSTAY
				MQLSSLTFEDSAVYFCARLRNWDEPMDYWG
				QGTTVTVSSAAGSDQEPKSSDKTHTCPPCS
				APELLGGSSVFLFPPKPKDTLMISRTPEVT
				CVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
				PREEQYNSTYRVVSVLTVLHQDWLNGKEYK
				CKVSNKALPAPIEKTISKAKGQPREPQVYT
				LPPSRDELTKNQVSLTCLVKGFYPSDIAVE
				WESNGQPENNYKTTPPVLDSDGSFFLYSKL
				TVDKSRWQQGNVFSCSVMHEALHNHYTQKS
				LSLSPGKGGSHHHHHH

EQUIVALENTS

The disclosure set forth above may encompass multiple distinct inventions with independent utility. Although each of these inventions has been disclosed in its preferred form(s), the specific embodiments thereof as disclosed and illustrated herein are not to be considered in a limiting sense, because numerous variations are possible. The subject matter of the inventions includes all novel and nonobvious combinations and subcombinations of the various elements, features, functions, and/or properties disclosed herein. The following claims particularly point out certain combinations and subcombinations regarded as novel and nonobvious. Inventions embodied in other combinations and subcombinations of features, functions, elements, and/or properties may be claimed in this application, in applications claiming priority from this application, or in related applications. Such claims, whether directed to a different invention or to the same invention, and whether broader, narrower, equal, or different in scope in comparison to the original claims, also are regarded as included within the subject matter of the inventions of the present disclosure.

Claims

1. A method of treating cancer that expresses EpCAM in a subject in need thereof, comprising administering to the subject an effective amount of an antibody comprising:

three heavy chain CDRs of a V_Hregion selected from the group consisting of SEQ ID NOS: 248, 252, and 253, and three light chain CDRs of a V_Lregion selected from the group consisting of SEQ ID NOS: 273, 277, and 278.

2. The method of claim 1, wherein the antibody comprises:

(a) three heavy chain CDRs and three light chain CDRs of an antibody comprising the V_Hregion SEQ ID NO: 248, and the V_Lregion SEQ ID NO: 273;

(b) three heavy chain CDRs and three light chain CDRs of an antibody comprising the V_Hregion SEQ ID NO: 252, and the V_Lregion SEQ ID NO: 277; or

(c) three heavy chain CDRs and three light chain CDRs of an antibody comprising the V_Hregion SEQ ID NO: 253, and the V_Lregion SEQ ID NO: 278.

3. The method of claim 1, wherein the antibody comprises:

(a) a V_Hcomprising: a CDR-H1 comprising SEQ ID NO: 23; a CDR-H2 comprising SEQ ID NO: 73; and a CDR-H3 comprising SEQ ID NO: 123, and a V_Lregion comprising a CDR L1 comprising SEQ ID NO: 148; a CDR L2 comprising SEQ ID NO: 173, and a CDR L3 comprising SEQ ID NO: 198, according to the Chothia numbering scheme;

(b) a V_Hcomprising: a CDR-H1 comprising SEQ ID NO: 48; a CDR-H2 comprising SEQ ID NO: 98; and a CDR-H3 comprising SEQ ID NO: 123, and a V_Lregion comprising a CDR L1 comprising SEQ ID NO: 148; a CDR L2 comprising SEQ ID NO: 173, and a CDR L3 comprising SEQ ID NO: 198, according to the Kabat numbering scheme;

(c) a V_Hcomprising: a CDR-H1 comprising SEQ ID NO: 27; a CDR-H2 comprising SEQ ID NO: 77; and a CDR-H3 comprising SEQ ID NO: 127, and a V_Lregion comprising a CDR L1 comprising SEQ ID NO: 152; a CDR L2 comprising SEQ ID NO: 177, and a CDR L3 comprising SEQ ID NO: 202, according to the Kabat numbering scheme;

(d) a V_Hcomprising: a CDR-H1 comprising SEQ ID NO: 52; a CDR-H2 comprising SEQ ID NO: 102; and a CDR-H3 comprising SEQ ID NO: 127, and a V_Lregion comprising a CDR L1 comprising SEQ ID NO: 152; a CDR L2 comprising SEQ ID NO: 177, and a CDR L3 comprising SEQ ID NO: 202, according to the Kabat numbering scheme; or

(e) a V_Hcomprising: a CDR-H1 comprising SEQ ID NO: 28; a CDR-H2 comprising SEQ ID NO: 78; and a CDR-H3 comprising SEQ ID NO: 128, and a V_Lregion comprising a CDR L1 comprising SEQ ID NO: 153; a CDR L2 comprising SEQ ID NO: 178, and a CDR L3 comprising SEQ ID NO: 203, according to the Chothia numbering scheme; or

(f) a V_Hcomprising: a CDR-H1 comprising SEQ ID NO: 53; a CDR-H2 comprising SEQ ID NO: 103; and a CDR-H3 comprising SEQ ID NO: 128, and a V_Lregion comprising a CDR L1 comprising SEQ ID NO: 153; a CDR L2 comprising SEQ ID NO: 178, and a CDR L3 comprising SEQ ID NO: 203, according to the Kabat numbering scheme.

4. The method of claim 1, wherein the antibody comprises:

(a) the V_Hregion SEQ ID NO: 248, and the V_Lregion SEQ ID NO: 273;

(b) the V_Hregion SEQ ID NO: 252, and the V_Lregion SEQ ID NO: 277; or

(c) the V_Hregion SEQ ID NO: 253, and the V_Lregion SEQ ID NO: 278.

5.-33. (canceled)

34. The method of claim 1, wherein the antibody further comprises at least one constant region domain.

35. The method of claim 34, wherein the constant region comprises a sequence selected from the group consisting of SEQ ID NOs: 279, 281, and 282.

36. The method of claim 1, wherein the antibody is a monoclonal antibody.

37. The method of claim 1, wherein the antibody is an IgA, an IgD, an IgE, an IgG, or an IgM.

38. The method of claim 1, wherein the antibody is humanized or human.

39. The method of claim 1, wherein the antibody is aglycosylated.

40. The method of claim 1, wherein the antibody is an antibody fragment.

41. The method of claim 40, wherein the antibody fragment is selected from an Fv fragment, a Fab fragment, a F(ab′)₂fragment, a Fab′ fragment, an scFv (sFv) fragment, and an scFv-Fc fragment.

42. The method of claim 41, wherein the antibody is an scFv fragment.

43. The method of claim 42, wherein the scFv fragment comprises a sequence selected from SEQ ID NOs: 337-361, with or without the N-terminal M residue.

44. The method of claim 41, wherein the antibody is an scFv-Fc fragment.

45. The method of claim 44, wherein the scFv-Fc fragment comprises a sequence selected from SEQ ID NOs: 204-228, with or without the N-terminal M residue.

46. The method of claim 1, wherein the antibody has a k_aof about 6.52×10⁴M⁻¹×sec⁻¹to about 3.51×10⁵M⁻¹×sec⁻¹when associating with human EpCAM at a temperature of 25° C.

47. The method of claim 1, wherein the antibody has a k_dof about 1.75×10⁻³sec⁻¹to about 1.74×10⁻⁵sec⁻¹when dissociating from human EpCAM at a temperature of 25° C.

48. The method of claim 1, wherein the antibody has a K_Dof about 7.21×10⁻⁹M to about 1.93×10⁻¹° M when bound to human EpCAM at a temperature of 25° C.

49. The method of claim 1, wherein the antibody specifically binds cynomolgus EpCAM.

50. The method of claim 49, wherein the antibody has a K_Dof about 1.62×10⁻⁷M to about 1.17×10⁻⁹M when bound to cynomolgus EpCAM at a temperature of 25° C.

51. The method of claim 50, wherein the ratio of K_Dfor human EpCAM to K_Dfor cynomolgus EpCAM is about 0.029 to about 6.162.

52.-64. (canceled)

65. The method of claim 1, wherein the cancer is a carcinoma.

66. The method of claim 1, wherein the antibody is administered more than once and wherein the antibody is administered at least 15 days apart from each administration.

67. The method of claim 1, wherein the antibody is administered subcutaneously, intravenously, intramuscularly, and intraarterially.

68. The method of claim 1, wherein the antibody is administered intravenously.