US20220089696A1 - Arenavirus monoclonal antibodies and uses - Google Patents
Arenavirus monoclonal antibodies and uses Download PDFInfo
- Publication number
- US20220089696A1 US20220089696A1 US17/520,338 US202117520338A US2022089696A1 US 20220089696 A1 US20220089696 A1 US 20220089696A1 US 202117520338 A US202117520338 A US 202117520338A US 2022089696 A1 US2022089696 A1 US 2022089696A1
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- cdr3
- cdr1
- cdr2
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 241000712891 Arenavirus Species 0.000 title abstract description 47
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 claims abstract description 101
- 230000003472 neutralizing effect Effects 0.000 claims abstract description 66
- 238000000034 method Methods 0.000 claims abstract description 64
- 208000015181 infectious disease Diseases 0.000 claims abstract description 56
- 239000000203 mixture Substances 0.000 claims abstract description 52
- 229960005486 vaccine Drugs 0.000 claims abstract description 24
- 241000712902 Lassa mammarenavirus Species 0.000 claims description 166
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 58
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 58
- 241000282414 Homo sapiens Species 0.000 claims description 40
- 239000000427 antigen Substances 0.000 claims description 33
- 102000036639 antigens Human genes 0.000 claims description 33
- 108091007433 antigens Proteins 0.000 claims description 33
- 101000904196 Homo sapiens Pancreatic secretory granule membrane major glycoprotein GP2 Proteins 0.000 claims description 29
- 102100024019 Pancreatic secretory granule membrane major glycoprotein GP2 Human genes 0.000 claims description 29
- 206010023927 Lassa fever Diseases 0.000 claims description 23
- 150000007523 nucleic acids Chemical class 0.000 claims description 23
- 101000900206 Hantaan virus (strain 76-118) Envelopment polyprotein Proteins 0.000 claims description 22
- 108090000288 Glycoproteins Proteins 0.000 claims description 18
- 102000003886 Glycoproteins Human genes 0.000 claims description 18
- 102000039446 nucleic acids Human genes 0.000 claims description 16
- 108020004707 nucleic acids Proteins 0.000 claims description 16
- LJPIRKICOISLKN-WHFBIAKZSA-N Gly-Ala-Ser Chemical compound NCC(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O LJPIRKICOISLKN-WHFBIAKZSA-N 0.000 claims description 15
- 241000712892 Arenaviridae Species 0.000 claims description 14
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 14
- 239000013604 expression vector Substances 0.000 claims description 14
- 239000012634 fragment Substances 0.000 claims description 14
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 10
- 238000002372 labelling Methods 0.000 claims description 10
- 239000008194 pharmaceutical composition Substances 0.000 claims description 6
- 206010008761 Choriomeningitis lymphocytic Diseases 0.000 claims description 5
- 239000012472 biological sample Substances 0.000 claims description 5
- QXUPRMQJDWJDFR-NRPADANISA-N Glu-Val-Ser Chemical compound CC(C)[C@H](NC(=O)[C@@H](N)CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O QXUPRMQJDWJDFR-NRPADANISA-N 0.000 claims description 4
- 239000003937 drug carrier Substances 0.000 claims description 3
- NJIKKGUVGUBICV-ZLUOBGJFSA-N Asp-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O NJIKKGUVGUBICV-ZLUOBGJFSA-N 0.000 claims description 2
- 238000009007 Diagnostic Kit Methods 0.000 claims description 2
- SHERTACNJPYHAR-ACZMJKKPSA-N Gln-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O SHERTACNJPYHAR-ACZMJKKPSA-N 0.000 claims description 2
- MLILEEIVMRUYBX-NHCYSSNCSA-N Glu-Val-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O MLILEEIVMRUYBX-NHCYSSNCSA-N 0.000 claims description 2
- ZYRXTRTUCAVNBQ-GVXVVHGQSA-N Glu-Val-Lys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N ZYRXTRTUCAVNBQ-GVXVVHGQSA-N 0.000 claims description 2
- QIZJOTQTCAGKPU-KWQFWETISA-N Gly-Ala-Tyr Chemical compound [NH3+]CC(=O)N[C@@H](C)C(=O)N[C@H](C([O-])=O)CC1=CC=C(O)C=C1 QIZJOTQTCAGKPU-KWQFWETISA-N 0.000 claims description 2
- AVYVKJMBNLPWRX-WFBYXXMGSA-N Trp-Ala-Ser Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O)=CNC2=C1 AVYVKJMBNLPWRX-WFBYXXMGSA-N 0.000 claims description 2
- 239000000523 sample Substances 0.000 claims description 2
- 208000019981 lassa virus infectious disease Diseases 0.000 claims 1
- 108090000765 processed proteins & peptides Proteins 0.000 abstract description 21
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 17
- 238000011282 treatment Methods 0.000 abstract description 17
- 230000001225 therapeutic effect Effects 0.000 abstract description 11
- 230000002265 prevention Effects 0.000 abstract description 6
- 241001244462 Old world arenaviruses Species 0.000 abstract description 4
- 238000013461 design Methods 0.000 abstract description 4
- 238000004519 manufacturing process Methods 0.000 abstract description 4
- 238000002360 preparation method Methods 0.000 abstract description 4
- 150000003384 small molecules Chemical class 0.000 abstract description 2
- 241000700199 Cavia porcellus Species 0.000 description 87
- 210000004027 cell Anatomy 0.000 description 32
- 241000700605 Viruses Species 0.000 description 27
- 102000040430 polynucleotide Human genes 0.000 description 26
- 108091033319 polynucleotide Proteins 0.000 description 26
- 239000002157 polynucleotide Substances 0.000 description 26
- 230000004927 fusion Effects 0.000 description 21
- 150000001413 amino acids Chemical group 0.000 description 19
- 108090000623 proteins and genes Proteins 0.000 description 17
- 230000003612 virological effect Effects 0.000 description 16
- 239000000463 material Substances 0.000 description 15
- 239000013598 vector Substances 0.000 description 15
- 238000001727 in vivo Methods 0.000 description 14
- 229920001184 polypeptide Polymers 0.000 description 13
- 206010058874 Viraemia Diseases 0.000 description 12
- 229940024606 amino acid Drugs 0.000 description 12
- 235000001014 amino acid Nutrition 0.000 description 12
- 239000003814 drug Substances 0.000 description 12
- 241001465754 Metazoa Species 0.000 description 11
- 238000013459 approach Methods 0.000 description 11
- 201000010099 disease Diseases 0.000 description 11
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 11
- 239000002671 adjuvant Substances 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 238000011161 development Methods 0.000 description 10
- 230000018109 developmental process Effects 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 9
- 241000282412 Homo Species 0.000 description 8
- 108010009254 Lysosomal-Associated Membrane Protein 1 Proteins 0.000 description 8
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 8
- 238000006386 neutralization reaction Methods 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 8
- 206010061192 Haemorrhagic fever Diseases 0.000 description 7
- 108010029973 Lymphocytic choriomeningitis virus glycoprotein peptide Proteins 0.000 description 7
- 101800000461 Stable signal peptide Proteins 0.000 description 7
- 239000007789 gas Substances 0.000 description 7
- 229940027941 immunoglobulin g Drugs 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 102000004169 proteins and genes Human genes 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 230000009260 cross reactivity Effects 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 125000003729 nucleotide group Chemical group 0.000 description 6
- 235000018102 proteins Nutrition 0.000 description 6
- 238000006467 substitution reaction Methods 0.000 description 6
- 230000009385 viral infection Effects 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 5
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- 239000004472 Lysine Substances 0.000 description 5
- 241000282567 Macaca fascicularis Species 0.000 description 5
- 241001416505 Mastomys Species 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 241000283984 Rodentia Species 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 238000012512 characterization method Methods 0.000 description 5
- 239000002299 complementary DNA Substances 0.000 description 5
- 230000001747 exhibiting effect Effects 0.000 description 5
- -1 form amine hydrochlorides Chemical class 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 230000002688 persistence Effects 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 238000002864 sequence alignment Methods 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 4
- 208000036142 Viral infection Diseases 0.000 description 4
- 238000011230 antibody-based therapy Methods 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 102000037865 fusion proteins Human genes 0.000 description 4
- 108020001507 fusion proteins Proteins 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000001506 immunosuppresive effect Effects 0.000 description 4
- 230000002458 infectious effect Effects 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 238000002887 multiple sequence alignment Methods 0.000 description 4
- 230000005180 public health Effects 0.000 description 4
- 229960000329 ribavirin Drugs 0.000 description 4
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 239000013638 trimer Substances 0.000 description 4
- 201000009695 Argentine hemorrhagic fever Diseases 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 101710121417 Envelope glycoprotein Proteins 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- 241000712890 Junin mammarenavirus Species 0.000 description 3
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 3
- 241001244466 New world arenaviruses Species 0.000 description 3
- 208000037581 Persistent Infection Diseases 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 241000121210 Sigmodontinae Species 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 239000003443 antiviral agent Substances 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 238000010166 immunofluorescence Methods 0.000 description 3
- 230000028802 immunoglobulin-mediated neutralization Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 231100000518 lethal Toxicity 0.000 description 3
- 230000001665 lethal effect Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 230000035935 pregnancy Effects 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 239000002096 quantum dot Substances 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 241000712461 unidentified influenza virus Species 0.000 description 3
- 210000002845 virion Anatomy 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 208000034628 Celiac artery compression syndrome Diseases 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 241001183012 Modified Vaccinia Ankara virus Species 0.000 description 2
- 241000699729 Muridae Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 108091061960 Naked DNA Proteins 0.000 description 2
- 102000011931 Nucleoproteins Human genes 0.000 description 2
- 108010061100 Nucleoproteins Proteins 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000000840 anti-viral effect Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 238000011948 assay development Methods 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 102000028861 calmodulin binding Human genes 0.000 description 2
- 108091000084 calmodulin binding Proteins 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 210000004748 cultured cell Anatomy 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 210000001163 endosome Anatomy 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 229940088598 enzyme Drugs 0.000 description 2
- 210000003608 fece Anatomy 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 238000003167 genetic complementation Methods 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 235000013336 milk Nutrition 0.000 description 2
- 239000008267 milk Substances 0.000 description 2
- 210000004080 milk Anatomy 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 238000000569 multi-angle light scattering Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 238000012809 post-inoculation Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 230000009257 reactivity Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 244000052613 viral pathogen Species 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- BRMWTNUJHUMWMS-UHFFFAOYSA-N 3-Methylhistidine Natural products CN1C=NC(CC(N)C(O)=O)=C1 BRMWTNUJHUMWMS-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229940117976 5-hydroxylysine Drugs 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- 208000030090 Acute Disease Diseases 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 208000003829 American Hemorrhagic Fever Diseases 0.000 description 1
- 206010003085 Arenaviral haemorrhagic fever Diseases 0.000 description 1
- 208000005989 Arenaviridae Infections Diseases 0.000 description 1
- 208000006740 Aseptic Meningitis Diseases 0.000 description 1
- 101150011571 BSL2 gene Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 208000000477 Bilateral Hearing Loss Diseases 0.000 description 1
- 102100028282 Bile salt export pump Human genes 0.000 description 1
- 229920002799 BoPET Polymers 0.000 description 1
- 208000034200 Bolivian hemorrhagic fever Diseases 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- 201000010424 Brazilian hemorrhagic fever Diseases 0.000 description 1
- 101100380241 Caenorhabditis elegans arx-2 gene Proteins 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 206010008479 Chest Pain Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 206010051625 Conjunctival hyperaemia Diseases 0.000 description 1
- 208000034657 Convalescence Diseases 0.000 description 1
- 206010011409 Cross infection Diseases 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 206010066919 Epidemic polyarthritis Diseases 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 206010053172 Fatal outcomes Diseases 0.000 description 1
- 208000001951 Fetal Death Diseases 0.000 description 1
- 241000711950 Filoviridae Species 0.000 description 1
- 206010055690 Foetal death Diseases 0.000 description 1
- 208000000666 Fowlpox Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 108060003393 Granulin Proteins 0.000 description 1
- 241000190708 Guanarito mammarenavirus Species 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000724352 Homo sapiens Bile salt export pump Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000725303 Human immunodeficiency virus Species 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical class C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108091029795 Intergenic region Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 238000012313 Kruskal-Wallis test Methods 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 208000032912 Local swelling Diseases 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 1
- 241000712898 Machupo mammarenavirus Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 206010027201 Meningitis aseptic Diseases 0.000 description 1
- 239000005041 Mylar™ Substances 0.000 description 1
- JDHILDINMRGULE-LURJTMIESA-N N(pros)-methyl-L-histidine Chemical compound CN1C=NC=C1C[C@H](N)C(O)=O JDHILDINMRGULE-LURJTMIESA-N 0.000 description 1
- 241001644525 Nastus productus Species 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 206010029803 Nosocomial infection Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 206010068319 Oropharyngeal pain Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241001112090 Pseudovirus Species 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 101710119090 RING finger protein Z Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 241000220010 Rhode Species 0.000 description 1
- 241000710942 Ross River virus Species 0.000 description 1
- 241000710961 Semliki Forest virus Species 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 206010042682 Swelling face Diseases 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 241000712908 Tacaribe mammarenavirus Species 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 241000838698 Togo Species 0.000 description 1
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 206010044565 Tremor Diseases 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- 208000001065 Unilateral Hearing Loss Diseases 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 201000009693 Venezuelan hemorrhagic fever Diseases 0.000 description 1
- 241000711975 Vesicular stomatitis virus Species 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 230000010530 Virus Neutralization Effects 0.000 description 1
- 208000035472 Zoonoses Diseases 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- GELXFVQAWNTGPQ-UHFFFAOYSA-N [N].C1=CNC=N1 Chemical compound [N].C1=CNC=N1 GELXFVQAWNTGPQ-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 101150092805 actc1 gene Proteins 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000003302 anti-idiotype Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 208000024597 arenavirus hemorrhagic fever Diseases 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 230000004856 capillary permeability Effects 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 238000000423 cell based assay Methods 0.000 description 1
- 230000005591 charge neutralization Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 125000002668 chloroacetyl group Chemical group ClCC(=O)* 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000002447 crystallographic data Methods 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 125000004494 ethyl ester group Chemical group 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000001815 facial effect Effects 0.000 description 1
- 231100000479 fetal death Toxicity 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 238000009459 flexible packaging Methods 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 230000000799 fusogenic effect Effects 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 101150110946 gatC gene Proteins 0.000 description 1
- 238000005227 gel permeation chromatography Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000012252 genetic analysis Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 244000052637 human pathogen Species 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 229940042795 hydrazides for tuberculosis treatment Drugs 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 229940124452 immunizing agent Drugs 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 229940055742 indium-111 Drugs 0.000 description 1
- APFVFJFRJDLVQX-AHCXROLUSA-N indium-111 Chemical compound [111In] APFVFJFRJDLVQX-AHCXROLUSA-N 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940117681 interleukin-12 Drugs 0.000 description 1
- 229940044173 iodine-125 Drugs 0.000 description 1
- ZCYVEMRRCGMTRW-YPZZEJLDSA-N iodine-125 Chemical compound [125I] ZCYVEMRRCGMTRW-YPZZEJLDSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Chemical class 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 235000019419 proteases Nutrition 0.000 description 1
- 238000000164 protein isolation Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000003908 quality control method Methods 0.000 description 1
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 238000003325 tomography Methods 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000004627 transmission electron microscopy Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 108010087967 type I signal peptidase Proteins 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 208000036000 unilateral deafness Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 206010048282 zoonosis Diseases 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
- C07K16/4208—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/10011—Arenaviridae
Definitions
- the present invention relates to novel arenavirus monoclonal antibodies, to compositions comprising the arenavirus monoclonal antibodies, and methods comprising the same.
- Biological sequence information for this application is included in an ASCII text file having the file name “TU-439-SEQ-R1.txt”, created on Aug. 28, 2019, and having a file size of 121,021 bytes, which is incorporated herein by reference.
- Lassa virus and several other members of the Arenaviridae are classified as Biosafety Level 4 and NIAID Biodefense Category A agents.
- the present invention will fill a vital biodefense need for rapid multiagent immunodiagnostic assays for arenaviruses and for effective therapeutics against arenaviral disease, and will provide a major advance for public health management of an important family of viral pathogens.
- LASV chiefly Lassa virus
- HF hemorrhagic fever
- LCMV prototypic arenavirus lymphocytic choriomeningitis virus
- Lassa fever The most prevalent arenaviral disease is Lassa fever (LF), an often-fatal hemorrhagic fever named for the Nigerian town in which the first described cases occurred in 1969 (Buckley and Casals, 1970). Parts of Guinea, Sierra Leone, Nigeria, and Liberia are endemic for the etiologic agent, LASV (Birmingham and Kenyon, 2001). Although detailed surveillance of LASV is hampered by many factors, including the lack of a widely available diagnostic test, it is clear that the public health impact is immense.
- LASV has been associated with severe nosocomial outbreaks involving health care workers and laboratory personnel (Fisher-Hoch et al., 1995).
- the mortality rate for women in the last month of pregnancy is always high, about 90%, and LASV infection causes high rates of fetal death at all stages of gestation (Walls, 1985).
- Mortality rates for Lassa appear to be higher in non-Africans, which is of concern because Lassa is the most commonly exported hemorrhagic fever (Haas et al., 2003; Holmes et al., 1990).
- Arenaviruses are enveloped viruses with a bi-segmented negative strand (NS) RNA genome.
- the S RNA encodes the viral glycoprotein precursor (GPC) and the nucleoprotein (NP).
- GPC is co- and post-translationally processed to yield the two mature virion surface glycoproteins GP1 and GP2 that together with the stable signal peptide (SSP) form the GP complex that decorates the virus surface and directs virus cell entry via receptor-mediated endocytosis.
- GPC viral glycoprotein precursor
- NP nucleoprotein
- GPC is co- and post-translationally processed to yield the two mature virion surface glycoproteins GP1 and GP2 that together with the stable signal peptide (SSP) form the GP complex
- the L RNA encodes the viral RNA dependent RNA polymerase (L polymerase), and the small RING finger protein Z that has functions of a bona fide matrix protein.
- L polymerase viral RNA dependent RNA polymerase
- the structure of arenavirus GP2 appears to be a class I fusion protein, which is common to envelope glycoproteins of myxoviruses, retroviruses and filoviruses (Gallaher, DiSimone, and Buchmeier, 2001).
- the enveloped spherical virions When viewed by transmission electron microscopy, the enveloped spherical virions (diameter: 110-130 nm) show grainy particles that are ribosomes acquired from the host cells (Murphy and Whitfield, 1975), hence the basis for the family name of the Latin word “arena,” which means “sandy.”
- the arenaviruses are divided into the Old World or lymphocytic choriomeningitis virus (LCMV)/LASV complex and the New World or Tacaribe complex (Bowen, Peters, and Nichol, 1997).
- LCMV lymphocytic choriomeningitis virus
- Tacaribe complex Bowen, Peters, and Nichol, 1997
- Arenaviruses In addition to LASV, other arenaviruses that cause severe illness in humans and are classified as BSL-4 and NIAID category A agents include the New World arenaviruses Machupo virus (MACV, Venezuelan hemorrhagic fever), Junin virus (JUNV, Argentine hemorrhagic fever), Guanarito virus (GUAV, Venezuelan hemorrhagic fever) and Sabiá virus (SABV, Brazilian hemorrhagic fever). Arenaviruses are zoonotic; each virus is associated with a specific species of rodent (Bowen, Peters, and Nichol, 1997). The LCMV/LASV complex viruses are associated with Old World rats and mice (family Muridae, subfamily Murinae).
- Tacaribe complex viruses are generally associated with New World rats and mice (family Muridae, subfamily Sigmodontinae); however, the reservoir of Tacaribe virus itself appears to be a bat (Bowen, Peters, and Nichol, 1996).
- the reservoir of LASV is the “multimammate rat” of the genus Mastomys (Monath et al., 1974). Mastomys rats are ubiquitous in sub-Saharan Africa (Demby et al., 2001) and are known to be peridomestic, often living in human homes; however, many questions regarding the taxonomy, geographic distribution and ecobiology of Mastomys species are unanswered.
- Arenaviruses cause chronic infections of rodents across the world with human infections mostly occurring through mucosal exposure or by direct contact of abraded skin with infectious materials. Arenaviruses are easily transmitted to humans from rodents via direct contact with rodent excreta or by contact with or ingestion of excreta-contaminated materials (Bausch et al., 2001; Demby et al., 2001). In the case of Mastomys species, infection may also occur when the animals are caught, prepared as a food source and eaten. Most arenaviruses, including LASV, are readily transmitted between humans, thus making nosocomial infection another matter of great concern. Human-to-human transmission can occur via exposure to blood or body fluids. LASV can also be transmitted to sexual partners of convalescent men via semen up to six weeks post-infection.
- Lassa fever Natural history of Lassa fever. Signs and symptoms of Lassa fever, which occur 1-3 weeks after virus exposure, are highly variable, but typically begin with the insidious onset of fever and other nonspecific symptoms such as headache, generalized weakness, and malaise, followed within days by sore throat, retrosternal pain, conjunctival injection, abdominal pain, and diarrhea.
- LASV infects endothelial cells, resulting in increased capillary permeability, which can produce diminished effective circulating volume (Peters et al., 1989). Severe cases progress to facial and neck swelling, shock and multiorgan system failure. Frank bleeding, usually mucosal (gums, etc.), occurs in less than a third of cases, but confers a poor prognosis.
- Neurological problems have also been described, including hearing loss, tremors, and encephalitis. Patients who survive begin to defervesce 2-3 weeks after onset of the disease. Temporary or permanent unilateral or bilateral deafness that occurs in a third of Lassa patients during convalescence is not associated with the severity of the acute disease (Cummins et al., 1990; Rybak, 1990; Hartnet et al., 2015; Anderson et al., 2015; Branco et al., October 2011; Grove et al., 2011; Branco et al., 2010; Branco et al., August 2011).
- Arenaviruses have relatively stable virions, do not require passage via insect vectors, are spread easily by human-to-human contact, and may be capable of aerosol spread or other simple means of dispersal.
- the high prevalence of Lassa fever in western Africa coupled with the ease of travel to and from this area and endemic areas for MACV, JUNV, GUAV, SABV and other highly pathogenic arenaviruses permits easy access to these viruses for use as a bioweapon.
- a cluster of hemorrhagic fever cases in the United States caused by any arenavirus would be a major public health incident.
- LASV and other arenaviruses as a biological weapon directed against civilian or military targets potentiated the commercial development of effective diagnostics, which the VHFC has accomplished, through the marketing of immunodiagnostic tests for the rapid detection of LASV infections (ReLASV Rapid Diagnotic Test [RDT]TM, RePanLASV RDTTM) and companion ELISA diagnostics for the detection of antigenemia and the immunoglobulin (Ig) M (IgM) and G (IgG) response to infection (www(dot)zalgenlabs(dot)com/products).
- RDT ReLASV Rapid Diagnotic Test
- IgM immunoglobulin M
- G IgG
- Ribavirin may be effective in the treatment of Lassa fever only if administered early in the course of illness (Johnson et al., 1987; McCormick et al., 1986). Ribavirin administered to patients with a high virus load (and therefore a high risk for mortality) within the first six days of illness reduced the case-fatality rate from 55% to 5% (McCormick et al., 1986).
- Antibody-based therapy to combat human viral infections Viral antigenic variability can pose significant obstacles to the development of effective vaccines to combat human viral infections as illustrated in the cases of HIV and influenza virus.
- recent findings have shown that some infected individuals generate broadly neutralizing monoclonal antibodies (BNhMAbs) that target a conserved domain within the stem region of the viral surface envelope (Env) glycoprotein of HIV-1 or and are able to block infection by many phylogenetically distinct isolates.
- BNhMAbs have been shown to target a conserved domain within the proximal membrane stalk domain of influenza virus hemagglutinin (HA) and several BNhMAbs such as MAb F16 and MAb 5A7 proved to be protective when passively administered in mouse models of influenza virus infection.
- Antibodies typically exhibit desirable pharmacological characteristics including long serum half-lives, high potency, and limited off-target toxicity.
- the recent developments in the area of BNhMAbs have raised great interest in exploring their development as viable antiviral therapy.
- BNhMAbs often recognize conserved epitopes within the region of the viral glycoproteins that mediate fusion between viral and cellular membranes, they can also facilitate the identification and structural characterization of highly conserved viral epitopes, knowledge that can be harnessed for the generation of universal vaccines and broad-spectrum antiviral drugs against these viral pathogens.
- arenavirus cell entry requires a pH-dependent fusion event that is mediated by the fusogenic domain of GP2.
- the identification and characterization of LCMV GP-specific BNhMAbs will facilitate the development of a novel antibody-based therapy to treat LASV and LCMV induced disease in humans.
- this work may generate valuable information for the design of immunogens to facilitate the development of universal arenavirus vaccines, as well as broad-spectrum anti-arenaviral drugs targeting the conserved structural and functional motifs identified by BNhMAbs.
- the work described herein combines the use of state-of-the-art arenavirus reverse genetics with the access to a unique collection of LASV GP-specific human monoclonal antibodies (hMAbs) that have been shown to cross-react and neutralize different strains of LCMV, including isolates from human cases of LASV and LCMV induced disease, as well as WE strain that causes a LF-like disease in non-human primates.
- hMAbs human monoclonal antibodies
- the present disclosure provides an antibody-based therapy to treat human cases of LCMV-induced disease. Unlike vaccines that depend on the host's ability to mount an effective immune response, this novel approach can provide protection in immunosuppressed individuals, including cases of LASV and LCMV infection associated with severe clinical symptoms in individuals undergoing transplantation procedures.
- a detailed characterization of the conserved epitopes within LCMV GPC recognized by these BNhMAbs may help to design immunogens aimed at developing a vaccine able to confer protection against all LASV and LCMV strains that have been linked to disease in humans.
- information obtained from the identification and characterization of LASV BNhMAbs will help to identify broad-spectrum anti-LASV and LCMV drugs via targeting conserved epitopes identified by these BNhMAbs.
- the experimental approach described herein involves the use of unique reagents and assays to identify and characterize LASV and LCMV BNhMAbs and their targets.
- a single-cycle infectious, GFP-expressing, rLCMV has been generated in which the GP is replaced by GFP (rLCMVAGP/GFP). Genetic complementation with plasmids or stable cell lines expressing arenavirus GPs of interest results in production of the corresponding GP-pseudotyped rLCMVAGP/GFP that are used to evaluate neutralizing antibody responses to different LCMV strains using a novel GFP-based microneutralization assay.
- a tri-segmented LCMV platform has been developed within the backbone of ARM or C1-13 LCMV strains that allows expression of an arenavirus GP of choice and an appropriate reporter gene (e.g.
- a panel of anti-idiotype antibodies (anti-ids) to 37.2D specifically detected this BNhMAb when spiked into human serum and did not capture or detect any other arenaviral BNhMAb tested to date, or any other IgG specificity present in human serum on both ELISA and SPR based studies.
- compositions comprising arenavirus monoclonal antibodies (e.g., fully human monoclonal antibodies), as well as therapeutic, diagnostic, and preventative methods using the antibodies.
- Preventative methods include preparation of vaccines, as well as factors (e.g. small molecules, peptides) that inhibit Old World arenavirus infectivity, including LASV and LCMV.
- Diagnostic and therapeutic antibodies including neutralizing antibodies for the prevention and treatment of infection by LASV and other arenaviruses are also disclosed, as well as new tools and methods for the design, production, and use of arenavirus monoclonal antibodies, including expression in engineered bacterial- and mammalian-based systems.
- One embodiment of the materials and methods described herein relates to monoclonal antibodies and fragments thereof effective against LASV.
- Another embodiment of the materials and methods described herein relates to monoclonal antibodies or fragments thereof effective against LCMV.
- Another embodiment of the materials and methods described herein relates to methods of producing forms of monoclonal antibodies effective against LASV and/or LCMV.
- Another embodiment of the materials and methods described herein relates to expression vectors comprising polynucleotides encoding forms of the LASV or LCMV GP-specific hMAbs.
- An embodiment of the materials and methods described herein relates to diagnostic uses of antibodies or fragments thereof, such as neutralizing antibodies, specific for LASV or LCMV.
- Another embodiment of the materials and methods described herein relates to diagnostics comprising the antibodies or fragments thereof specific for LASV or LCMV, including labeled antibodies or fragments thereof of the invention.
- kits comprising the antibodies of the invention.
- Embodiment 1 is an antigen-binding composition
- a neutralizing antibody or neutralizing antigen-binding antibody fragment thereof specific to glycoprotein 1 (GP1), glycoprotein 2 (GP2), glycoprotein precursor (GPC), or full-length glycoprotein (GP) of Lassa virus (LASV) wherein the antibody or antibody fragment comprises a heavy chain variable region (V H ) and a light chain variable region (V L ), the V H and V L each comprising complementarity determining regions CDR1, CDR2 and CDR3 selected from the group consisting of:
- Embodiment 2 is the composition of Embodiment 1, wherein the composition comprises two or more of said antibodies or antigen-binding antibody fragments.
- Embodiment 3 is the composition of any one of Embodiments 1 and 2, wherein the composition comprises:
- an antibody or antigen-binding antibody fragment comprising a V H CDR1 of SEQ ID NO: 83, a V H CDR2 of SEQ ID NO: 84, a V H CDR3 of SEQ ID NO: 85, a V L CDR1 of SEQ ID NO: 125, a V L CDR2 of sequence Gly Ala Ser, and a V L CDR3 of SEQ ID NO: 126 (from MAb 37.2D);
- an antibody or antigen-binding antibody fragment comprising a V H CDR1 of SEQ ID NO: 92, a V H CDR2 of SEQ ID NO: 93, a V H CDR3 of SEQ ID NO: 94, a V L CDR1 of SEQ ID NO: 131, a V L CDR2 of sequence Glu Val Ser, and a V L CDR3 of SEQ ID NO: 132 (from MAb 8.9F); and
- an antibody or antigen-binding antibody fragment comprising a V H CDR1 of SEQ ID NO: 98, a V H CDR2 of SEQ ID NO: 99, a V H CDR3 of SEQ ID NO: 100, a V L CDR1 of SEQ ID NO: 135, a V L CDR2 of sequence Gly Ala Ser, and a V L CDR3 of SEQ ID NO: 136 (from MAb 12.1F).
- Embodiment 4 is the composition of any one of Embodiments 1 to 3, wherein the antibody is selected from the group consisting of a monoclonal antibody, and a recombinantly produced antibody.
- Embodiment 5 is the composition of any one of Embodiments 1 to 4, wherein the antibody comprises a human monoclonal antibody.
- Embodiment 6 is the composition of any one of Embodiments 1 to 3, wherein the antigen-binding antibody fragment is selected from the group consisting of a Fab, a Fab′, and a F(ab′) 2 fragment.
- Embodiment 7 is a nucleic acid (e.g., a cDNA) having a sequence that encodes for a V H of the antibody or the antibody fragment of a composition of Embodiment 1.
- a nucleic acid e.g., a cDNA
- Embodiment 8 is the nucleic acid of Embodiment 7, wherein the nucleic acid includes a nucleic acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 16.
- Embodiment 9 is a nucleic acid 9 e.g., a cDNA) having a sequence that encodes for a V L of the antibody or the antibody fragment of Embodiment 1.
- Embodiment 10 is the nucleic acid of Embodiment 9, wherein the nucleic acid includes a nucleic acid sequence selected from the group consisting of SEQ ID NO: 17 through SEQ ID NO: 32.
- Embodiment 11 is an expression vector that contains the nucleic acid sequence of any one of Embodiments 7 to 10.
- Embodiment 12 is an antigen-binding composition
- a neutralizing antibody or neutralizing antigen-binding antibody fragment thereof specific to glycoprotein 1 (GP1), glycoprotein 2 (GP2), glycoprotein precursor (GPC), or full-length glycoprotein (GP) of Lassa virus (LASV) wherein the antibody or antibody fragment comprises a heavy chain variable region (V H ) and a light chain variable region (V L ) selected from the group consisting of:
- Embodiment 13 is the composition of Embodiment 12, wherein the composition comprises two or more of said antibodies or antigen-binding antibody fragments.
- Embodiment 14 is the composition of any one of Embodiments 12 and 13, wherein the composition comprises:
- an antibody or antigen-binding antibody fragment comprising a V H of SEQ ID NO: 39 and a V L of SEQ ID NO: 55 (from MAb 37.2D);
- an antibody or antigen-binding antibody fragment comprising a V H of SEQ ID NO: 44 and a V L of SEQ ID NO: 60 (from MAb 12.1F).
- Embodiment 15 is the composition of any one of Embodiments 12 to 14, wherein the the antibody is selected from the group consisting of a monoclonal antibody, and a recombinantly produced antibody.
- Embodiment 16 is the composition of any one of Embodiments 12 to 15, wherein the antibody comprises a human monoclonal antibody.
- Embodiment 17 is the composition of any one of Embodiments 12 to 14, wherein the antigen-binding antibody fragment is selected from the group consisting of a Fab, a Fab′, and a F(ab′) 2 fragment.
- Embodiment 18 is a nucleic acid (e.g., a cDNA) having a sequence that encodes for a V H of the antibody or the antibody fragment of Embodiment 12.
- a nucleic acid e.g., a cDNA
- Embodiment 19 is a nucleic acid (e.g., a cDNA) having a sequence that encodes for a V L of the antibody or the antibody fragment of Embodiment 12.
- a nucleic acid e.g., a cDNA
- Embodiment 20 is an expression vector that contains the nucleic acid sequence of any one of Embodiments 18 to 19.
- Embodiment 21 is a vaccine for preventing or treating infection of a patient by Lassa virus or other arenaviridae comprising the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17.
- Embodiment 22 is the vaccine of Embodiment 21, which is cross-protective against infection by other arenaviridae.
- Embodiment 23 is the vaccine of any one of Embodiments 21 to 22, which is cross-protective against infection by a lymphocytic choriomeningitis virus.
- Embodiment 24 is a pharmaceutical composition for treating or preventing infection by a Lassa virus or other arenaviridae comprising the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 and a pharmaceutically acceptable carrier.
- Embodiment 25 is the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 for use in treating or preventing infection by a Lassa virus or other arenaviridae.
- Embodiment 26 is the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 for use in treating or preventing a lymphocytic choriomeningitis virus infection.
- Embodiment 27 is use of the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 for treating or preventing infection by a Lassa virus or other arenaviridae.
- Embodiment 28 is use of the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 for treating or preventing a lymphocytic choriomeningitis virus infection.
- Embodiment 29 is use of the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 for the preparation of a medicament for treating or preventing infection by a Lassa virus or other arenaviridae.
- Embodiment 30 is use of the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 for the preparation of a medicament for treating or preventing a lymphocytic choriomeningitis virus infection.
- Embodiment 31 is diagnostic kit for detecting infection of a subject by Lassa virus or other arenaviridae comprising at least one antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 bound to a detectable labelling group.
- Embodiment 32 is an antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 bound to a detectable labelling group.
- Embodiment 33 is a method of detecting infection by a Lassa virus or other arenaviridae comprising contacting a biological sample from a subject with at least one antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 bound to a detectable labelling group; and detecting a complex between the antibody or antibody fragment and a Lassa virus or other arenaviridae present in the sample.
- Embodiment 34 is a method of treating or preventing infection by a Lassa virus or other arenaviridae in a subject comprising administering the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 to the subject.
- Embodiment 35 is a method of treating or preventing a lymphocytic choriomeningitis virus infection in a subject comprising administering the antibody or antibody fragment of any one of Embodiments 1 to 6 and 12 to 17 to the subject.
- FIG. 1 depicts (A) Schematic representation of LASV GP; (B) Arenavirus GP complex; and (C) Recognition of different LASV GP species by LASV hMAbs.
- LASV GP is synthesized as the precursor protein GPC.
- Signal peptidase (Spase) cleaves the small stable signal peptide (SSP) that remains associated with GP1 and GP2 to form the GP complex ( FIG. 1 , Panel B).
- SSP small stable signal peptide
- FIG. 1 Panel B
- the cellular protease SK1/S1P cleaves GPC into GP1 and GP2.
- Construct rGPe corresponds to a recombinant LASV GPC ectodomain lacking GP2 and with a non-cleavable linker replacing the SK1/S1P cleavage recognition site. Constructs expressing recombinant SSP-GP1 (rGP1) and SSP fused to GP2 (rGP2) were also generated. (B) GP-1 forms the globular head subunit that interact with the cellular receptor whereas GP2 mediates the fusion of the viral envelop with the cell membrane. SSP remains associated with both GP1 and GP2 and plays critical roles in the biology of the GP complex.
- (C) 293T cells were transfected with pCAGGS expressing plasmids encoding LASV rGP1, rGP2 and GPC and the reactivity of LASV hMAbs evaluated at 48 h post-transfection by immunofluorescence. The distribution of LASV GP-specific hMAbs by subunit specificity, neutralizing activity and reactivity to linear epitopes is indicated.
- FIG. 2 depicts in vitro neutralization of LCMV ARM with the 15 LASV GP-specific neutralizing hMAbs: LASV Josiah (squares) and LCMV ARM (triangles) GP-pseudotyped rLCMV ⁇ GP/GFP viruses were incubated for 90 min at 37° C. with a 2-fold dilution of the indicated LASV GP-specific BNhMAb before infecting LCMV GP-expressing Vero cells (96 plate format, triplicates). Virus neutralization was determined under a fluorescent microscope and quantified using a GFP microplate reader at 72 hours post-infection. Results are presented as percent inhibition after normalizing to respective viral infections in the absence of hMAbs. Virus infection in the absence of hMAbs was used as internal control. Mean values and standard deviation are shown. Standard error was calculated based on 2-6 replicates.
- FIG. 3 depicts in vivo neutralization of the 6 LCMV neutralizing antibodies (12.1F, 9.8A, 37.2D, 36.9F, 37.2G, and 18.5C) using the non-crossreactive antibodies 19.7E and 8.9F as internal controls.
- Mice were infected with rCl-13 (2 ⁇ 106 pfu; i.v.) and treated with the indicated hMAb (20 mg/kg; i.p.), as well as an isotype hMAb control (20 mg/kg, i.p.) or vehicle.
- post inoculation (p.i.) viremia i.e., the presence of viruses in the blood was determined.
- FIG. 4 illustrates Viremia data from treated and control GP plasma on days 7 and 14 PI.
- Viremia levels for day 7 treatment groups 37.7H, 12.1F, and 25.6A as well as day 14 12.1F, 37.2D, 19.7E, and 10.4B were below the limit of detection (LOD).
- Error bars represent standard deviation from mean values. *denotes P_0.05. **denotes P_0.001. ***denotes P ⁇ 0.0001.
- FIG. 5 depicts clinical scores of HuMAb treated and untreated guinea pigs.
- HuMAbs 8.9F and 12.1 treated GP showed no variation in clinical score from baseline (data not shown). Error bars (thin lines) represent standard deviation from mean values.
- FIG. 6 illustrates the effect of antibodies on rVSV-LASV GP infection and fusion.
- the antibody 9.7A is non-neutralizing and in the same competition group as 37.7H (GPC-B); 13.4E binds to a linear epitope in the T-loop of GP2; 12.1F binds to the GP1 subunit of LASV. Error bars indicate the standard deviation of at least six (two biological replicates, each having three or more technical replicates).
- C Antibody-mediated inhibition of rVSVLASV GP fusion at the cell surface.
- FIG. 7 provides a sequence alignment prepared using CLUSTAL OMEGATM (1.2.4) multiple sequence alignment (from EMBL-EBI, a part of the European Molecular Biology Laboratory) for the heavy chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with ⁇ circumflex over ( ) ⁇ ), and CDR3 (marked with #).
- sequences shown include 10.4B (SEQ ID NO: 33), 19.7E (SEQ ID NO: 34), 2.9D (SEQ ID NO: 35), 25.6A (SEQ ID NO: 36), 36.1F (SEQ ID NO: 37), 36.9F (SEQ ID NO: 38), 37.2D (SEQ ID NO: 39), 37.2G (SEQ ID NO: 40), 37.7H (SEQ ID NO: 41), 8.9F (SEQ ID NO: 42), NE13 (SEQ ID NO: 43), 12.1F (SEQ ID NO: 44), 9.8A (SEQ ID NO: 45), 18.5C (SEQ ID NO: 46), 8.11G (SEQ ID NO: 47), and 25.10C (SEQ ID NO: 48).
- FIG. 8 provides a sequence alignment prepared using CLUSTAL OMEGATM (1.2.4) multiple sequence alignment for the light chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with ⁇ circumflex over ( ) ⁇ ), and CDR3 (marked with #).
- sequences shown include 10.4B (SEQ ID NO: 49), 19.7E (SEQ ID NO: 50), 2.9D (SEQ ID NO: 51), 25.6A (SEQ ID NO: 52), 36.1F (SEQ ID NO: 53), 36.9F (SEQ ID NO: 54), 37.2D (SEQ ID NO: 55), 37.2G (SEQ ID NO: 56), 37.7H (SEQ ID NO: 57), 8.9F (SEQ ID NO: 58), NE13 (SEQ ID NO: 59), 12.1F (SEQ ID NO: 60), 9.8A (SEQ ID NO: 61), 18.5C (SEQ ID NO: 62), 8.11G (SEQ ID NO: 63), and 25.10C (SEQ ID NO: 64).
- a monoclonal antibody includes one or more monoclonal antibodies.
- monoclonal antibodies specific for LASV monoclonal antibodies specific for LCMV
- polynucleotides encoding the antibodies and methods for using these antibodies in prevention, diagnosis, detection, and treatment are described herein.
- human monoclonal antibodies specific for LASV human monoclonal antibodies specific for LCMV, and combinations thereof for development and production of diagnostics, vaccines, therapeutics, and screening tools are provided.
- B cell clones producing specific IgG to GP of any Lassa virus isolate or strain may be utilized to derive the antibodies described herein.
- polynucleotide is used broadly and refers to polymeric nucleotides of any length (e.g., oligonucleotides, genes, small inhibiting RNA, fragments of polynucleotides encoding a protein, etc.).
- the polynucleotides of the invention may comprise a sequence encoding all or part of the ectodomain and part of the transmembrane domain.
- the polynucleotide of the invention may be, for example, linear, circular, supercoiled, single-stranded, double-stranded, branched, partially double-stranded or partially single-stranded.
- the nucleotides comprised within the polynucleotide may be naturally occurring nucleotides or modified nucleotides.
- functionally equivalent polynucleotides are those that possess one or more of the following characteristics: the ability to generate antibodies (including, but not limited to, viral neutralizing antibodies) capable of recognizing LASV GP or the ability to generate antibodies specific to LASV GP that show neutralizing activity against LASV lineages I-IV, and proposed new lineages (e.g. lineage V from Mali , lineage VI from Togo and Benin.
- Polynucleotide sequences that are functionally equivalent may also be identified by methods known in the art.
- sequence alignment software programs are available to facilitate determination of homology or equivalence.
- Non-limiting examples of these programs are BLAST family programs including BLASTN, BLASTP, BLASTX, TBLASTN, and TBLASTX (BLAST is available from the National Institutes of Health website), FASTATM, COMPARE, DOTPLOTTM, BESTFITTM, GAPTM, FRAMEALIGNTM, CLUSTALWTM, and PILEUP.
- Other similar analysis and alignment programs can be purchased from various providers such as DNA Star's MEGALIGN′, or the alignment programs in GENEJOCKEYTM.
- sequence analysis and alignment programs can be accessed through the world wide web at sites such as the CMS Molecular Biology Resource at San Diego Supercomuter Center (SDSC) website; and the Swiss Institute of Bioinformatics SIB Bioinformatics Resource Portal website ExPASy Proteomics Server.
- SDSC CMS Molecular Biology Resource at San Diego Supercomuter Center
- ExPASy Proteomics Server Any sequence database that contains DNA or protein sequences corresponding to a gene or a segment thereof can be used for sequence analysis. Commonly employed databases include but are not limited to GenBank, EMBL, DDBJ, PDB, SWISS-PROT, EST, STS, GSS, and HTGS.
- Parameters for determining the extent of homology set forth by one or more of the aforementioned alignment programs are well established in the art. They include but are not limited to p value, percent sequence identity and the percent sequence similarity. P value is the probability that the alignment is produced by chance. For a single alignment, the p value can be calculated according to Karlin et al. (1990) Proc. Natl. Acad. Sci . (USA) 87: 2246. For multiple alignments, the p value can be calculated using a heuristic approach such as the one programmed in BLAST. Percent sequence identify is defined by the ratio of the number of nucleotide or amino acid matches between the query sequence and the known sequence when the two are optimally aligned.
- the percent sequence similarity is calculated in the same way as percent identity except one scores amino acids that are different but similar as positive when calculating the percent similarity.
- conservative changes that occur frequently without altering function such as a change from one basic amino acid to another or a change from one hydrophobic amino acid to another are scored as if they were identical.
- analog includes any polypeptide having an amino acid residue sequence substantially identical to a polypeptide of the invention in which one or more residues have been conservatively substituted with a functionally similar residue and which displays the functional aspects of the polypeptides as described herein.
- conservative substitutions include the substitution of one non-polar (hydrophobic) residue such as isoleucine, valine, leucine or methionine for another; the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, between glycine and serine; the substitution of one basic residue such as lysine, arginine or histidine for another; and the substitution of one acidic residue, such as aspartic acid or glutamic acid or another.
- “conservative substitution” also includes the use of a chemically derivatized residue in place of a non-derivatized residue.
- “Chemical derivative” refers to a subject polypeptide having one or more amino acid residues chemically derivatized by reaction of a functional side group. Examples of such derivatized amino acids include for example, those amino acids in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups.
- the free carboxyl groups of amino acids may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides.
- the free hydroxyl groups of certain amino acids may be derivatized to form 0-acyl or 0-alkyl derivatives.
- the imidazole nitrogen of histidine may be derivatized to form N-imbenzylhistidine.
- chemical derivatives are those proteins or peptides which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids.
- Polypeptides of the present invention also include any polypeptide having one or more additions and/or deletions of residues relative to the sequence of any one of the polypeptides whose sequence is described herein.
- Two polynucleotide or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence as described below. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity.
- a “comparison window” as used herein refers to a segment of at least about 20 contiguous positions, usually 30 to about 75 contiguous positions, or 40 to about 50 contiguous positions, in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Optimal alignment of sequences for comparison may be conducted using the MEGALIGNTM program in the LASERGENETM suite of bioinformatics software (DNASTAR, Inc., Madison, Wis.), using default parameters.
- This program embodies several alignment schemes described in the following references: Dayhoff, M. O. (1978) “A model of evolutionary change in proteins—Matrices for detecting distant relationships” in Dayhoff, M. O. (ed.) Atlas of Protein Sequence and Structure , National Biomedical Research Foundation, Washington D.C. Vol. 5, Suppl. 3, pp. 345-358 (1978); Hem J., “Unified Approach to Alignment and Phylogenes” pp. 626-645 Methods in Enzymology vol.
- the “percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- the percentage is calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e., the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
- Expression vectors comprising at least one polynucleotide encoding an antibody or antibody fragment protein also are described herein.
- Expression vectors are well known in the art and include, but are not limited to viral vectors or plasmids.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
- Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat.
- alphavirus-based vectors e.g., Sindbis virus vectors, Semliki forest virus), Ross River virus, adeno-associated virus (AAV) vectors
- AAV adeno-associated virus
- PCT Publication Nos. WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655 vaccinia virus (e.g., Modified Vaccinia virus Ankara (MVA) or fowlpox), Baculovirus recombinant system and herpes virus.
- Nonviral vectors such as plasmids, are also well known in the art and include, but are not limited to, yeast- and bacteria-based plasmids.
- vectors into a host cell and isolating and purifying the expressed protein are also well known in the art (e.g., Molecular Cloning: A Laboratory Manual , second edition, Sambrook, et al., 1989, Cold Spring Harbor Press).
- host cells include, but are not limited to, mammalian cells such as NS0 and CHO cells.
- vectors comprising the polynucleotides described herein may further comprise a tag polynucleotide sequence to facilitate protein isolation and/or purification.
- tags include but are not limited to the myc-epitope, S-tag, his-tag, HSV epitope, V5-epitope, FLAG and CBP (calmodulin binding protein). Such tags are commercially available or readily made by methods known to the art.
- the vector may further comprise a polynucleotide sequence encoding a linker sequence.
- the linking sequence is positioned in the vector between the antibody polynucleotide sequence and the polynucleotide tag sequence.
- Linking sequences can encode random amino acids or can contain functional sites. Examples of linking sequences containing functional sites include but are not limited to, sequences containing the Factor Xa cleavage site, the thrombin cleavage site, or the enterokinase cleavage site.
- an antibody specific for LASV may be generated as described herein using mammalian expression vectors in mammalian cell culture systems or bacterial expression vectors in bacterial culture systems.
- an antibody specific for LCMV may be generated as described herein using mammalian expression vectors in mammalian cell culture systems or bacterial expression vectors in bacterial culture systems.
- antibodies disclosed herein include, but are not limited to, antibodies specific for LASV or LCMV, antibodies that cross react with native Lassa virus antigens and/or native lymphocytic choriomeningitis virus antigens, and neutralizing antibodies.
- a characteristic of a neutralizing antibody includes the ability to block or prevent infection of a host cell.
- the antibodies may be characterized using methods well known in the art.
- the antibodies useful in the compositions and methods described herein can encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab′, F(ab′)2, Fv, Fc, etc.), chimeric antibodies, bi-specific antibodies, heteroconjugate antibodies, single-chain fragments (e.g. ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- the antibodies may be murine, rat, human, or of any other origin (including chimeric or humanized antibodies).
- Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired an adjuvant.
- adjuvants include, but are not limited to, keyhole limpet hemocyanin (KLH), serum albumin, bovine thryoglobulin, soybean trypsin inhibitor, complete Freund adjuvant (CFA), and MPL-TDM adjuvant.
- KLH keyhole limpet hemocyanin
- serum albumin serum albumin
- bovine thryoglobulin bovine thryoglobulin
- soybean trypsin inhibitor complete Freund adjuvant
- MPL-TDM adjuvant MPL-TDM adjuvant
- the antibodies may alternatively be monoclonal antibodies.
- Monoclonal antibodies may be produced using hybridoma methods (see, e.g., Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, D. W., et al., In Vitro, 18:377-381 (1982).
- the antibody of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
- the sequence encoding the antibody of interest may be maintained in the vector in a host cell, and the host cell can then be expanded and frozen for future use.
- the polynucleotide sequence may be used for genetic manipulation to “humanize” the antibody or to improve the affinity, or other characteristics of the antibody (e.g., genetically manipulate the antibody sequence to obtain greater affinity to LASV and/or LCMV glycoprotein and/or greater efficacy in inhibiting the fusion of LASV and/or LCMV to the host cell).
- the antibodies may also be humanized by methods known in the art (See, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; and 6,180,370).
- human antibodies may be obtained by using mice that have been engineered to express specific human immunoglobulin proteins.
- antibodies may be made recombinantly and expressed using any method known in the art.
- antibodies may be made recombinantly by phage display technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Winter et at., Annu. Rev. Immunol. 12:433-455 (1994).
- phage display technology McCafferty et al., Nature 348:552-553 (1990)
- Phage display can be performed in a variety of formats; for review, see Johnson, Kevin S.
- LASV and/or LCMV glycoprotein as described herein may be used as an antigen for the purposes of isolating recombinant antibodies by these techniques.
- Antibodies may be made recombinantly by first isolating the antibodies and antibody producing cells from host animals, obtaining the gene sequence, and using the gene sequence to express the antibody recombinantly in host cells (e.g., CHO cells). Another method that may be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been disclosed. See, for example, Peeters, et al. Vaccine 19:2756 (2001); Lonberg, N. and D. Huszar Int. Rev. Immunol 13:65 (1995); and Pollock, et al., J. Immunol. Methods 231:147 (1999). Methods for making derivatives of antibodies (e.g. humanized and single-chain antibodies, etc.) are known in the art.
- the antibodies described herein can be bound to a carrier by conventional methods for use in, for example, isolating or purifying LASV and/or LCMV glycoprotein or detecting LASV and/or LCMV glycoproteins, antigens, or particles in a biological sample or specimen.
- the neutralizing antibodies of the invention may be administered as a therapeutic treatment to a subject infected with or suspected of being infected with LASV or LCMV.
- the antibodies can be labeled, e.g., bound to a detectable labelling group such as a fluorescent dye (e.g., a ALEXA FLUOR® dye), a quantum dot label (e.g., a QDOT® label), R-phycoerythrin, streptavidin, biotin, an enzyme (e.g., Glucose Oxidase, Horseradish Peroxidase or Alkaline Phosphatase), a radioiosotope (e.g., iodine-125, indium-111), and the like.
- a detectable labelling group such as a fluorescent dye (e.g., a ALEXA FLUOR® dye), a quantum dot label (e.g., a QDOT® label), R-phycoerythrin, streptavidin, biotin, an enzyme (e.g., Glucose Oxidase, Horseradish Peroxidase or Alkaline
- nucleotide sequences encoding portions of heavy chain (HC) and light chain (LC) of each antibody are shown below.
- the illustrated nucleotide sequences encode portions of the HC and LC encompassing the variable regions thereof, i.e., the V H and V L regions, respectively, along with portions of vector sequences.
- V H and V L amino acid sequences of the antibodies and complementarity determining regions (CDR) of the V H and V L sequences are shown and discussed below.
- FIG. 7 provides a sequence alignment prepared using CLUSTAL OMEGATM (1.2.4) multiple sequence alignment (from EMBL-EBI, a part of the European Molecular Biology Laboratory) for the heavy chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with ⁇ circumflex over ( ) ⁇ ), and CDR3 (marked with #).
- FIG. 8 provides a sequence alignment prepared using CLUSTAL OMEGATM (1.2.4) multiple sequence alignment for the light chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with ⁇ circumflex over ( ) ⁇ ), and CDR3 (marked with #).
- the HC CDR Sequence Table below lists the sequences of CDR1, CDR 2, and CDR3 of the V H of each of the 16 neutralizing antibodies described herein.
- the LC CDR Sequence Table below lists the sequences of CDR1, CDR 2, and CDR3 of the V L of each of the 16 neutralizing antibodies described herein.
- the antibodies described herein may be used in a variety of immunoassays for LASV, LCMV, and other arenaviruses.
- the antibodies of the invention can be produced with high quality control and are suitable as reagents for the purposes of detecting antigen in biological samples.
- antibodies of the invention could be used as reagents in an ELISA assay to detect Lassa antigen in a biological sample from a subject.
- the antibodies can be labeled, e.g., bound to a detectable labelling group such as a fluorescent dye, a quantum dot label, R-phycoerythrin, streptavidin, biotin, an enzyme, a radioiosotope, and the like.
- a detectable labelling group such as a fluorescent dye, a quantum dot label, R-phycoerythrin, streptavidin, biotin, an enzyme, a radioiosotope, and the like.
- Vaccines for LASV, LCMV, and other arenaviruses also are described herein.
- the vaccines are DNA-based vaccines.
- One skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein in vivo. See, e.g., U.S. Pat. Nos. 6,436,908; 6,413,942; and 6,376,471.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art and non-limiting examples are described herein.
- Administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration. Targeted delivery of therapeutic compositions containing an expression vector or subgenomic polynucleotides can also be used.
- Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol . (1993) 11:202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J. A. Wolff, ed.) (1994); Wu et al., J. Biol. Chem . (1988) 263:621; Wu et al., J. Biol. Chem .
- Non-viral delivery vehicles and methods can also be employed, including but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Cunel, Hum. Gene Ther . (1992) 3:147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem . (1989) 264:16985); eukaryotic cell delivery vehicles (see, e.g., U.S. Pat. No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338); and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed.
- Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859.
- Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796, WO 94/23697, WO 9 1/14445; and EP 0524968. Additional approaches are described in Philip, Mol. Cell Biol . (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci . (1994) 91:1581.
- the codons comprising the polynucleotide encoding one or more antibodies specific for LASV glycoprotein and/or LCMV glycoprotein may be optimized for human use, a process that is standard in the art.
- one or more antibodies specific to LASV and/or LCMV or combinations thereof is used as a vaccine.
- the one or more antibodies or combination thereof may be administered by itself or in combination with an adjuvant.
- adjuvants include, but are not limited to, aluminum salts, water-in-soil emulsions, oil-in-water emulsions, saponin, QuilA and derivatives, iscoms, liposomes, cytokines including gamma-interferon or interleukin 12, DNA (e.g.
- unmethylated poly-CpG unmethylated poly-CpG
- microencapsulation in a solid or semi-solid particle Freunds complete and incomplete adjuvant or active ingredients thereof including muramyl dipeptide and analogues, DEAE dextrarilmineral oil, Alhydrogel, Auspharm adjuvant, and Algammulin.
- the antibody vaccine comprising one or more antibodies specific to LASV and/or LCMV or combinations thereof can be administered orally or by any parenteral route such as intravenously, subcutaneously, intraarterially, intramuscularly, intracardially, intraspinally, intrathoracically, intraperitoneally, intraventricularly, sublingually, and/or transdermally.
- Dosage and schedule of administration can be determined by methods known in the art. Efficacy of the one or more antibodies specific to LASV and/or LCMV or combinations thereof as a vaccine for Lassa virus, lymphocytic choriomeningitis virus, or related arenaviruses may also be evaluated by methods known in the art.
- polynucleotides, polypeptides, and antibodies described herein can further comprise pharmaceutically acceptable carriers, excipients, or stabilizers known in the art ( Remington: The Science and practice of Pharmacy 20th Ed., 2000, Lippincott Williams and Wilkins, Ed. K. E. Hoover), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the employed dosages and concentrations, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (e.g.
- octadecyldimethylbenzyl ammonium chloride hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, marmose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbi
- compositions used in the methods described herein generally comprise, by way of example and not limitation, an effective amount of a polynucleotide or polypeptide (e.g., an amount sufficient to induce an immune response) of the invention or antibody of the invention (e.g., an amount of a neutralizing antibody sufficient to mitigate infection, alleviate a symptom of infection and/or prevent infection).
- an effective amount of a polynucleotide or polypeptide e.g., an amount sufficient to induce an immune response
- antibody of the invention e.g., an amount of a neutralizing antibody sufficient to mitigate infection, alleviate a symptom of infection and/or prevent infection.
- the pharmaceutical composition can further comprise additional agents that serve to enhance and/or complement the desired effect.
- additional agents that serve to enhance and/or complement the desired effect.
- the pharmaceutical composition may further comprise an adjuvant. Examples of adjuvants are provided herein.
- the composition can further comprise other therapeutic agents (e.g., anti-viral agents).
- Kits for use in the instant methods include one or more containers comprising by way of example, and not limitation, polynucleotides encoding one or more antibodies specific to LASV and/or LCMV or combinations thereof or fragments thereof of the invention and instructions for use in accordance with any of the methods of the invention described herein.
- the antibodies are bound to a detectable label as discussed above.
- instructions comprise a description of administration or instructions for performance of an assay.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
- Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- kits are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
- a kit may have a sterile access port (e.g. the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container may also have a sterile access port (e.g.
- the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container.
- Example 1 LCMV Infection of the Mouse and Recombinant Arenaviruses are a Powerful Experimental System to Assess the Potency and Breath of LCMV Neutralizing mMAbs In Vivo
- LCMV Armstrong (ARM) strain results in an acute infection that induces a protective immune response that mediates virus clearance in 10 to 14 days, a process predominantly mediated by virus-specific CD8+ cytotoxic T lymphocytes (CTL).
- CTL cytotoxic T lymphocytes
- i.v. inoculation with a high dose of the immunosuppressive clone 13 (C1-13) strain of LCMV causes a persistent infection associated with sustained viremia and generalized immune suppression that can last for 60 to 100 days.
- This model is robust and has clear outcomes, which provide a valid and cost effective experimental system for initial evaluation of the efficacy of antibody-based strategies to control and clear a LCMV infection.
- the use of C1-13 based recombinant viruses expressing GPs of interest allows assessment of the safety and in vivo neutralizing activity of GP-specific BNmMAbs.
- This approach is feasible using state-of-the-art arenavirus reverse genetics that allows rescue of infectious recombinant LCM viruses with predetermined mutations of interest, as well as expressing heterologous either viral or non-viral genes of interest.
- Example 2 Identification of LASV (Josiah Strain) GP-Specific hMAbs that Cross-React with the GP of LCMV ARM Strain
- PBMCs Peripheral blood mononuclear cells isolated from 17 different LF survivors in Sierra Leone and Nigeria were used to identify B cell clones producing specific IgG to LASV GP. RNA from these B cell clones was used to clone the light chain (LC) and heavy chain (HC) genes. Paired LC and HC were expressed in human 293T cells to generate a collection of 120 LASV GP-specific hMAbs. These hMAbs arose from different germline genes and were likely independently derived.
- LC light chain
- HC heavy chain
- LASV GP consists of a SSP and GP1 and GP2 subunits, as shown in FIG. 1 , Panels A and B.
- an immunofluorescence assay was used to test the recognition by hMAbs of human 293T cells expressing either rGP1 or rGP2 alone, or full-length GP, shown in FIG. 1 , Panel C.
- hMAbs including three with neutralizing activity, reacted with LASV rGP1, shown by FIG. 1 , Panel C, left and Table 1.
- Fifty-seven hMAbs recognized LASV rGP2 but none of these exhibited neutralizing activity, as shown by FIG. 1 , Panel C, middle and Table 1.
- Seven hMAbs reacted with peptides representing three linear epitopes in GP2, whereas the remaining hMAbs appeared to recognize conformational epitopes.
- Twenty-seven hMAbs reacted with cells expressing full-length GP but did not react with either rGP1 or rGP2 expressed individually. Remarkably, thirteen of these hMAbs were neutralizing, as shown by FIG.
- Inhibitory concentration 50 (IC50) and 80 (IC80) neutralizing activity of LASV GP-specific hMAbs was evaluated using lentivirus particles pseudotyped with the different lineage I-IV LASV GPs. Results are shown in Table 1. Based on the data in Table 1, the antibodies can be classified as most potent (hMAbs exhibiting IC values of ⁇ 1 ⁇ g/mL); potent (hMAbs exhibiting IC values in the range of 1 to 2.5 ⁇ g/mL), weak (hMAbs exhibiting IC values of >3 and ⁇ 20 ⁇ g/mL); non-neutralizing (hMAbs exhibiting IC values >20 ⁇ g/mL).
- Neutralizing properties of LASV GP-specific hMAbs The neutralizing properties of the LASV GP-specific hMAbs were evaluated using envelope-deficient core HIV-1 pseudotyped with LASV GP (LASVpp) (shown in Table 1) and standard plaque reduction neutralization test (PRNT) with authentic LASV. Fifteen of the 120 hMAbs neutralized LASVpp expressing GP from Josiah strain of LASV lineage IV, as shown in Table 1. These neutralizing GP-specific hMAbs were also tested against LASVpp containing GP of the three other LASV lineages I-III (shown in Table 1).
- LASVpp envelope-deficient core HIV-1 pseudotyped with LASV GP
- PRNT standard plaque reduction neutralization test
- the IC50 and IC80 values showed that those with the greatest potency and breadth against all four LASV linages were 25.10C, 12.1F, 8.9F, 37.2D, 37.7H, 25.6A and 8.11G (Table 1). The remaining hMAbs showed weaker and variable potency. Neutralization activity of these GP-specific hMAbs was further confirmed for LASV Josiah strain using a LCMV-based pseudovirus assay. These results revealed that out of the 120 tested LASV GP-specific hMAbs, 15 neutralized to different degrees LASV Josiah strain, and some of them exhibited broad neutralizing activity against representative strains from LASV lineages I-II.
- Example 3 Identification of LASV GP-Specific hMAbs with Broad Cross-Reactivity Against GPs from Different LCMV Strains
- LASV GP-specific neutralizing hMAbs (as shown by FIG. 1 and Table 1) to recognize GPs from five LCMV strains associated with human cases of LCMV-induced disease was examined. These strains corresponded to the WE strain that caused a zoonotic infection in New York in 1935; Rhode Island (RI) strain, responsible for four human cases and three fatalities from a transplant case in 2005; Ohio (OH) strain that is similar to the Michigan LCMV strain responsible for a human case in 2005; Wisconsin (WI) strain responsible for four human deaths in 2003; and Massachusetts (MA) strain, responsible for two human deaths in 2008.
- LASV GP-specific neutralizing hMAbs 12.1F, 37.2D, 9.8A, 18.5C and 36.9F recognized all five LCMV GP strains.
- LASV GP-specific neutralizing hMAbs 37.7H, 25.6A, 37.2G and 2.9D recognized four LCMV strains (ARM, WE, WI, and MA, but not RI or AH). The rest of the hMAbs did not cross-react with any of the LCMV strains tested.
- Example 4 Identification of LASV GP-Specific hMAbs with Strong Broadly Neutralizing Activity (BNhMAbs) against GPs from Different LCMV Strains in Cell-Based Assays
- LASV GP-specific hMAbs that not only cross-reacted with different LCMV GPs, but also neutralized LCMV ARM, as they would represent primary candidates to display broadly antiviral activity in vivo against LCMV strains previously associated with disease cases in humans.
- LASV GP-specific neutralizing hMAbs six of them (12.1F, 37.2D, 9.8A, 18.5C, 37.2G and 36.9F) neutralized LCMV ARM, as shown in FIG. 2 , with IC50 ⁇ 1 ⁇ g/mL, with the exception of 18.5C that exhibited a higher (>10 ⁇ g/mL) IC50.
- Results are displayed in Table 2, which shows the neutralizing activity of the 15 LASV GP-specific neutralizing hMAbs against LCMV ARM, and in particular, the IC50 and IC80 values of the 15 LASV GP-specific neutralizing hMAbs against LCMV ARM. Values were obtained from the cell-based microneutralization assay (shown in FIG. 2 ) using LASV or LCMV GP-pseudotyped rLCMV ⁇ GP/GFP viruses. Grey indicates LASV GP-specific neutralizing hMAbs that neutralized LCMV GP ARM. Neutralization of LASV GP-pseudotyped rLCMV ⁇ GP/GFP was similar to neutralization results obtained using the LASV GP-pseudotyped lentivirus particles shown in Table 1.
- the well-characterized mouse model of LCMV infection was used to test whether LASV GP-specific neutralizing hMAbs with broadly neutralizing activity against LCMV (shown in FIG. 2 and Table 2) also exhibited in vivo neutralizing activity.
- the immunosuppressive Clone 13 (C1-13) strain of LCMV was used.
- Infection (i.v.) of B6 WT mice with a high dose ( ⁇ 10 6 PFU) of C1-13 results in transient generalized immunosuppression and establishment of a persistent infection with well-established parameters.
- Virus clearance takes place between days 60 to 100 (post inoculation (p.i.). However, treatment of C1-13 infected mice that results in reduced viral load accelerates C1-13 clearance.
- mice treated with hMAbs 12.1F, 37.2D, 9.8A and 36.9F prevented persistence of rCl-13/WT.
- hMAbs 37.2G and 18.5C did not prevent C1-13 persistence in vivo.
- hMAbs 19.7E and 8.9F did not prevent persistence of rCl-13.
- Table 3 displays a summary of the cross-reactivity and neutralizing activity in vitro and in vivo of LASV GP-specific hMAbs against six LCMV strains (ARM, WE, RI, OH, WI, and MA) tested.
- a panel of murine antibodies against Fab or F(ab′)2 fragments of leading candidate therapeutic BNhMAbs was derived for isolation of highly specific anti-idiotypic reagents for assay development.
- highly protective therapeutic BNhMAb cocktail containing two to four antibodies that together confer maximum pre- and post-exposure protection against LCMV infections, while minimizing the emergence of escape mutants, it is important to characterize the PK of each antibody when administered in a cocktail form.
- highly specific anti-idiotypic antibodies are the best tool available to rapidly determine concentration and clearance of individual hMAbs from the blood.
- a panel of anti-idiotypic antibodies to 37.2D and 12.1F has been developed.
- Anti-idiotypic mMAbs to 37.2D have specifically detected this BNhMAb when spiked into human serum.
- the anti-idiotypic antibodies do not capture or detect any other arenaviral BNhMAb tested or any other IgG specificity present in human serum on both ELISA and SPR based studies, and thus are useful for assaying 37.2D.
- Example 7 Therapeutic Efficacy of First-In-Class Human LASV-Specific Antibodies in Guinea Pig (GP) and Cynomolgus Macaque (CM) Models of Lassa Fever
- CM Cynomolgus macaque
- CMs At 8 days post-infection, untreated CMs had developed high viral loads and were extremely ill. CM also were protected from lethal LF induced by challenge with either strain Josiah (lineage IV) or a contemporary lineage II strain derived from a lethal case of LF in Nigeria, both with the first treatment administered at 8 days post-infection.
- Monomeric GPCysR4 was incubated with excess Fab 37.7H and subjected to SEC-MALS analysis.
- Crystals of both the monomeric and trimeric fractions of the GPCysR4-Fab 37.7H complex formed in space group P6122 and diffract to 3.2 ⁇ with a trimer of GP bound to three Fabs in the asymmetric unit. Phases were determined with an iterative approach by using molecular replacement with a related Fab structure and the LCMV GP crystal structure.
- the antibody 37.7H against LASV neutralizes viruses representing all four known lineages of LASV in vitro and offers protection from lethal LASV challenge in guinea pig and nonhuman primates.
- the antibody simultaneously binds two GP monomers at the base of the GP trimer, where it engages four discontinuous regions of LASV GP, two in “site A” and two in “site B”.
- Site A contains residues 62 to 63 of the N-terminal loop of GP1 and residues 387 to 408 in the T-loop and HR2 of GP2.
- Site B contains residues 269 to 275 of the fusion peptide and residues 324 to 325 of HR1 of GP2.
- the antibody 37.7H also recognizes the GPC of LCMV but does not recognize the GPC of the more distantly related Old World arenavirus LUJV nor the GPC of New World arenaviruses.
- a sequence comparison among these arenaviruses demonstrates nearly complete sequence conservation throughout the 37.7H epitope for all LASV lineages and LCMV.
- the sequences of LUJO, JUNV, and MACV GPCs are far more divergent, particularly in HR2 of GP2, which is heavily involved in binding to 37.7H.
- the 37.7H antibody neutralizes by stabilizing the prefusion GP.
- FIG. 6 shows the effect of antibodies on rVSV-LASV GP infection and fusion.
- Antibody-mediated neutralization of rVSV-LASV GP is shown in FIG. 6 , Panel A.
- Antibody-mediated neutralization of rVSV-VSV-G is shown in FIG. 6 , Panel B.
- the antibody 9.7A is non-neutralizing antibody and in the same competition group as 37.7H (GPC-B); 13.4E binds to a linear epitope in the T-loop of GP2; 12.1F binds to the GP1 subunit of LASV.
- Error bars indicate the standard deviation of at least six (two biological replicates, each having three or more technical replicates).
- FIG. 6 Panel D shows Fab 37.7H reduces binding of a LAMP1-Fc fusion protein to LASV GPCysR4. Error bars indicate the standard deviation of six and three technical replicates.
- LASV GP1 Before exposure of the GP2 fusion peptide and loop and subsequent fusion of the viral and host cell membranes, LASV GP1 engages LAMP1. Engagement of this receptor is thought to require conformational changes in GP1 that are triggered by exposure to the low pH in the endosome. Tomography of LASV spikes in the presence of low pH and LAMP1 shows an opening of the trimer compared with its neutral pH conformation. To determine whether 37.7H could prevent these conformational changes, the ability of GPCysR4 to bind to a soluble LAMP1-Fc fusion alone and when bound to Fab 37.7H was analyzed. In the absence of Fab 37.7H, GPCysR4 effectively bound to LAMP1 when exposed to low pH. In the presence of Fab 37.7H, however, interaction between GPCysR4 and LAMP1 was markedly reduced ( FIG. 6 , Panel D).
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
Disclosed herein are compositions comprising arenavirus monoclonal antibodies, as well as therapeutic, diagnostic, and preventative methods using the novel antibodies. Preventative methods include preparation of vaccines, as well as factors (e.g. small molecules, peptides) that inhibit Old World arenavirus infectivity, including LASV and LCMV. In some embodiments, the antibodies provide pan-arenavirus protection against a number of arenavirus types and strains. Diagnostic and therapeutic antibodies including neutralizing antibodies for the prevention and treatment of infection by LASV and other arenaviruses are also disclosed, as well as new tools and methods for the design, production, and use of arenavirus monoclonal antibodies, including expression in engineered bacterial- and mammalian-based systems.
Description
- This application is a divisional of U.S. application Ser. No. 16/466,544, filed on Jun. 4, 2019, now U.S. Pat. No. 11,198,723, which is a 371 of International Application No. PCT/US2017/064744, filed on Dec. 5, 2017, which claims the benefit of U.S. Provisional Application Ser. No. 62/430,225, filed on Dec. 5, 2016, each of which is incorporated herein by reference in its entirety.
- This invention was made, in part, with support provided by the United States government under Grant Nos. U19 AI109762, 1 R01 AI104621, R43 AI120472, and NIAID Project No. 272200900049C-0-0-1 from the National Institutes of Health. The Government may have certain rights in this invention.
- The present invention relates to novel arenavirus monoclonal antibodies, to compositions comprising the arenavirus monoclonal antibodies, and methods comprising the same.
- Biological sequence information for this application is included in an ASCII text file having the file name “TU-439-SEQ-R1.txt”, created on Aug. 28, 2019, and having a file size of 121,021 bytes, which is incorporated herein by reference.
- Lassa virus (LASV) and several other members of the Arenaviridae are classified as Biosafety
Level 4 and NIAID Biodefense Category A agents. The present invention will fill a vital biodefense need for rapid multiagent immunodiagnostic assays for arenaviruses and for effective therapeutics against arenaviral disease, and will provide a major advance for public health management of an important family of viral pathogens. Several arenaviruses, chiefly Lassa virus (LASV) in West Africa, cause hemorrhagic fever (HF) disease in humans and pose serious public health concerns in their endemic regions. The global endemicity of the prototypic arenavirus lymphocytic choriomeningitis virus (LCMV) is not a causative agent of HF, but mounting evidence indicates that LCMV is a neglected human pathogen of clinical significance that can cause neurologic disease in the fetus, child and adult stages. In addition, LCMV poses a special threat in immune-compromised individuals, as tragically illustrated by recent cases of transplant-associated infections by LCMV with a fatal outcome in the United States and Australia. Moreover, the high seroprevalence of LCMV within different urban populations across the world, including the US, has raised the question of whether LCMV may contribute to the many cases of undiagnosed aseptic meningitis reported yearly. - Lassa fever. The most prevalent arenaviral disease is Lassa fever (LF), an often-fatal hemorrhagic fever named for the Nigerian town in which the first described cases occurred in 1969 (Buckley and Casals, 1970). Parts of Guinea, Sierra Leone, Nigeria, and Liberia are endemic for the etiologic agent, LASV (Birmingham and Kenyon, 2001). Although detailed surveillance of LASV is hampered by many factors, including the lack of a widely available diagnostic test, it is clear that the public health impact is immense. There are as many as 300,000 cases of Lassa per year in West Africa and 5,000 deaths (see the CDC website at www(dot)cdc(dot)gov/ncidod/dvrd/spb/mnpages/dispages/lassaf(dot)htm). In some parts of Sierra Leone, 10-16% of all patients admitted to hospitals have Lassa fever. Case fatality rates for Lassa fever have typically been reported as 15% to 20%, and as high as 45% during epidemics, with a recent multi-year study in Sierra Leone reporting a 69% rate (Schaffer et al., 2014). LASV has been associated with severe nosocomial outbreaks involving health care workers and laboratory personnel (Fisher-Hoch et al., 1995). The mortality rate for women in the last month of pregnancy is always high, about 90%, and LASV infection causes high rates of fetal death at all stages of gestation (Walls, 1985). Mortality rates for Lassa appear to be higher in non-Africans, which is of concern because Lassa is the most commonly exported hemorrhagic fever (Haas et al., 2003; Holmes et al., 1990).
- Old and New World arenaviruses. Arenaviruses are enveloped viruses with a bi-segmented negative strand (NS) RNA genome. Each genomic RNA segment, L (ca. 7.3 kb) and S (ca. 3.5 kb), uses an ambisense coding strategy to direct the synthesis of two polypeptides in opposite orientation, separated by a non-coding intergenic region. The S RNA encodes the viral glycoprotein precursor (GPC) and the nucleoprotein (NP). GPC is co- and post-translationally processed to yield the two mature virion surface glycoproteins GP1 and GP2 that together with the stable signal peptide (SSP) form the GP complex that decorates the virus surface and directs virus cell entry via receptor-mediated endocytosis. The L RNA encodes the viral RNA dependent RNA polymerase (L polymerase), and the small RING finger protein Z that has functions of a bona fide matrix protein. The structure of arenavirus GP2 appears to be a class I fusion protein, which is common to envelope glycoproteins of myxoviruses, retroviruses and filoviruses (Gallaher, DiSimone, and Buchmeier, 2001). When viewed by transmission electron microscopy, the enveloped spherical virions (diameter: 110-130 nm) show grainy particles that are ribosomes acquired from the host cells (Murphy and Whitfield, 1975), hence the basis for the family name of the Latin word “arena,” which means “sandy.” The arenaviruses are divided into the Old World or lymphocytic choriomeningitis virus (LCMV)/LASV complex and the New World or Tacaribe complex (Bowen, Peters, and Nichol, 1997). There is considerable diversity amongst members of the Arenaviridae (
FIG. 1 ), and even within the same virus species (Bowen et al., 2000). In addition to LASV, other arenaviruses that cause severe illness in humans and are classified as BSL-4 and NIAID category A agents include the New World arenaviruses Machupo virus (MACV, Bolivian hemorrhagic fever), Junin virus (JUNV, Argentine hemorrhagic fever), Guanarito virus (GUAV, Venezuelan hemorrhagic fever) and Sabiá virus (SABV, Brazilian hemorrhagic fever). Arenaviruses are zoonotic; each virus is associated with a specific species of rodent (Bowen, Peters, and Nichol, 1997). The LCMV/LASV complex viruses are associated with Old World rats and mice (family Muridae, subfamily Murinae). Tacaribe complex viruses are generally associated with New World rats and mice (family Muridae, subfamily Sigmodontinae); however, the reservoir of Tacaribe virus itself appears to be a bat (Bowen, Peters, and Nichol, 1996). The reservoir of LASV is the “multimammate rat” of the genus Mastomys (Monath et al., 1974). Mastomys rats are ubiquitous in sub-Saharan Africa (Demby et al., 2001) and are known to be peridomestic, often living in human homes; however, many questions regarding the taxonomy, geographic distribution and ecobiology of Mastomys species are unanswered. As with the natural hosts of other arenaviruses, Mastomys show no symptoms of LASV infection, but shed the virus in saliva, urine and feces. Eradication of the widely distributed rodent reservoirs of LASV and other arenaviruses is impractical and ecologically undesirable. - Arenaviruses cause chronic infections of rodents across the world with human infections mostly occurring through mucosal exposure or by direct contact of abraded skin with infectious materials. Arenaviruses are easily transmitted to humans from rodents via direct contact with rodent excreta or by contact with or ingestion of excreta-contaminated materials (Bausch et al., 2001; Demby et al., 2001). In the case of Mastomys species, infection may also occur when the animals are caught, prepared as a food source and eaten. Most arenaviruses, including LASV, are readily transmitted between humans, thus making nosocomial infection another matter of great concern. Human-to-human transmission can occur via exposure to blood or body fluids. LASV can also be transmitted to sexual partners of convalescent men via semen up to six weeks post-infection.
- Natural history of Lassa fever. Signs and symptoms of Lassa fever, which occur 1-3 weeks after virus exposure, are highly variable, but typically begin with the insidious onset of fever and other nonspecific symptoms such as headache, generalized weakness, and malaise, followed within days by sore throat, retrosternal pain, conjunctival injection, abdominal pain, and diarrhea. LASV infects endothelial cells, resulting in increased capillary permeability, which can produce diminished effective circulating volume (Peters et al., 1989). Severe cases progress to facial and neck swelling, shock and multiorgan system failure. Frank bleeding, usually mucosal (gums, etc.), occurs in less than a third of cases, but confers a poor prognosis. Neurological problems have also been described, including hearing loss, tremors, and encephalitis. Patients who survive begin to defervesce 2-3 weeks after onset of the disease. Temporary or permanent unilateral or bilateral deafness that occurs in a third of Lassa patients during convalescence is not associated with the severity of the acute disease (Cummins et al., 1990; Rybak, 1990; Hartnet et al., 2015; Anderson et al., 2015; Branco et al., October 2011; Grove et al., 2011; Branco et al., 2010; Branco et al., August 2011).
- Potential for use of arenaviruses as bioweapons. In addition to high case fatality rates, arenaviruses have many features that enhance their potential as bioweapons. Arenaviruses have relatively stable virions, do not require passage via insect vectors, are spread easily by human-to-human contact, and may be capable of aerosol spread or other simple means of dispersal. The high prevalence of Lassa fever in western Africa coupled with the ease of travel to and from this area and endemic areas for MACV, JUNV, GUAV, SABV and other highly pathogenic arenaviruses permits easy access to these viruses for use as a bioweapon. A cluster of hemorrhagic fever cases in the United States caused by any arenavirus would be a major public health incident. Because febrile illnesses are common, and the use of reliable arenavirus diagnostic tests is not commonplace, an initial cluster of undiagnosed cases would greatly increase the impact of the attack and permit wider dissemination via human-to-human contact. The potential use of LASV and other arenaviruses as a biological weapon directed against civilian or military targets potentiated the commercial development of effective diagnostics, which the VHFC has accomplished, through the marketing of immunodiagnostic tests for the rapid detection of LASV infections (ReLASV Rapid Diagnotic Test [RDT]™, RePanLASV RDT™) and companion ELISA diagnostics for the detection of antigenemia and the immunoglobulin (Ig) M (IgM) and G (IgG) response to infection (www(dot)zalgenlabs(dot)com/products).
- Treatment/prevention of arenavirus infections. There are no Food and Drug Administration (FDA)-approved arenavirus vaccines and current anti-arenaviral therapy is limited to an off-label use of the antiviral drug ribavirin that is only partially effective and can cause significant side effects. Ribavirin may be effective in the treatment of Lassa fever only if administered early in the course of illness (Johnson et al., 1987; McCormick et al., 1986). Ribavirin administered to patients with a high virus load (and therefore a high risk for mortality) within the first six days of illness reduced the case-fatality rate from 55% to 5% (McCormick et al., 1986). Several anecdotal reports suggest that this drug can also be effective against other arenaviral hemorrhagic fevers (Barry et al., 1995; Kilgore et al., 1997; Weissenbacher et al., 1986a; Weissenbacher et al., 1986b). The efficacy of prophylactic treatments for Lassa fever is unknown, although it has been suggested that people with high-risk exposures be treated with oral ribavirin. Control of LCMV infection is mediated mainly by cellular immune responses, and significant titers of neutralizing antibodies to LCMV appear usually only after the patients have clinically recovered. However, passive antibody transfer has been shown to confer protection in animal models of LCMV infection (Enria et al., 1984; Frame et al., 1984; Jahrling, 1983; Jahrling and Peters, 1984; Jahrling, Peters, and Stephen, 1984; Weissenbacher et al., 1986a). Thus, antibody-based therapy may provide a safer alternative for treatment of LCMV based on predetermined correlates of protection. Previous studies of passive transfer of serum to treat Argentine hemorrhagic fever (AHF) and Lassa fever provide a strong rationale for the methods disclosed herein. Although passive transfer of serum has proven effective against the New and Old World virus, this approach is not scalable to protect large populations in the case of a hypothetical release of these viruses. Another issue is the safety of transfused serum or plasma, in particular those living in regions where circulating unknown pathogens are of concern. Recombinant, neutralizing, human antibodies have never been tested as potential therapeutics in arenavirus-induced HFs, but these limitations can be overcome. No arenavirus vaccine is currently available, although vaccines against LASV and JUNV are in development. Effective diagnostic assays are absolutely essential for development and field testing arenaviral vaccines.
- Antibody-based therapy to combat human viral infections. Viral antigenic variability can pose significant obstacles to the development of effective vaccines to combat human viral infections as illustrated in the cases of HIV and influenza virus. Notably, recent findings have shown that some infected individuals generate broadly neutralizing monoclonal antibodies (BNhMAbs) that target a conserved domain within the stem region of the viral surface envelope (Env) glycoprotein of HIV-1 or and are able to block infection by many phylogenetically distinct isolates. Likewise, a number of BNhMAbs have been shown to target a conserved domain within the proximal membrane stalk domain of influenza virus hemagglutinin (HA) and several BNhMAbs such as MAb F16 and MAb 5A7 proved to be protective when passively administered in mouse models of influenza virus infection. Antibodies typically exhibit desirable pharmacological characteristics including long serum half-lives, high potency, and limited off-target toxicity. Hence, the recent developments in the area of BNhMAbs have raised great interest in exploring their development as viable antiviral therapy. In addition, because BNhMAbs often recognize conserved epitopes within the region of the viral glycoproteins that mediate fusion between viral and cellular membranes, they can also facilitate the identification and structural characterization of highly conserved viral epitopes, knowledge that can be harnessed for the generation of universal vaccines and broad-spectrum antiviral drugs against these viral pathogens. As with HIV-1 and influenza, arenavirus cell entry requires a pH-dependent fusion event that is mediated by the fusogenic domain of GP2. The identification and characterization of LCMV GP-specific BNhMAbs will facilitate the development of a novel antibody-based therapy to treat LASV and LCMV induced disease in humans. In addition, this work may generate valuable information for the design of immunogens to facilitate the development of universal arenavirus vaccines, as well as broad-spectrum anti-arenaviral drugs targeting the conserved structural and functional motifs identified by BNhMAbs.
- Need for the invention. The work described herein combines the use of state-of-the-art arenavirus reverse genetics with the access to a unique collection of LASV GP-specific human monoclonal antibodies (hMAbs) that have been shown to cross-react and neutralize different strains of LCMV, including isolates from human cases of LASV and LCMV induced disease, as well as WE strain that causes a LF-like disease in non-human primates. The present disclosure provides an antibody-based therapy to treat human cases of LCMV-induced disease. Unlike vaccines that depend on the host's ability to mount an effective immune response, this novel approach can provide protection in immunosuppressed individuals, including cases of LASV and LCMV infection associated with severe clinical symptoms in individuals undergoing transplantation procedures. Moreover, a detailed characterization of the conserved epitopes within LCMV GPC recognized by these BNhMAbs may help to design immunogens aimed at developing a vaccine able to confer protection against all LASV and LCMV strains that have been linked to disease in humans. In addition, information obtained from the identification and characterization of LASV BNhMAbs will help to identify broad-spectrum anti-LASV and LCMV drugs via targeting conserved epitopes identified by these BNhMAbs. The experimental approach described herein involves the use of unique reagents and assays to identify and characterize LASV and LCMV BNhMAbs and their targets.
- There is an ongoing need to address LASV and LCMV infections from natural sources, as well as weaponized versions of these viruses. There also is a need for neutralizing antibodies to LASV and LCMV for diagnostic and analytical uses. The materials (e.g., antibodies and fragments thereof) and methods described herein address these needs.
- A single-cycle infectious, GFP-expressing, rLCMV has been generated in which the GP is replaced by GFP (rLCMVAGP/GFP). Genetic complementation with plasmids or stable cell lines expressing arenavirus GPs of interest results in production of the corresponding GP-pseudotyped rLCMVAGP/GFP that are used to evaluate neutralizing antibody responses to different LCMV strains using a novel GFP-based microneutralization assay. A tri-segmented LCMV platform has been developed within the backbone of ARM or C1-13 LCMV strains that allows expression of an arenavirus GP of choice and an appropriate reporter gene (e.g. fluorescent and luciferase proteins) together for facile identification of LCMV BNhMAbs and monitoring the emergence of BNhMAb LCMV escape mutants. Reverse genetics approaches have been developed that allow generation of rLCM viruses within the backbone of the immunosuppressive C1-13 LCMV strain expressing GPs of interest that can be used to characterize the therapeutic value in vivo of these BNhMAbs. Highly specific anti-idiotypic antibodies were generated to individually detect and characterize the PK, concentration, and clearance from the circulation of each MAb used in combination therapy to enhance neutralization potency while minimizing the emergence of escape mutants. A panel of anti-idiotype antibodies (anti-ids) to 37.2D specifically detected this BNhMAb when spiked into human serum and did not capture or detect any other arenaviral BNhMAb tested to date, or any other IgG specificity present in human serum on both ELISA and SPR based studies.
- Disclosed herein are compositions comprising arenavirus monoclonal antibodies (e.g., fully human monoclonal antibodies), as well as therapeutic, diagnostic, and preventative methods using the antibodies. Preventative methods include preparation of vaccines, as well as factors (e.g. small molecules, peptides) that inhibit Old World arenavirus infectivity, including LASV and LCMV. Diagnostic and therapeutic antibodies including neutralizing antibodies for the prevention and treatment of infection by LASV and other arenaviruses are also disclosed, as well as new tools and methods for the design, production, and use of arenavirus monoclonal antibodies, including expression in engineered bacterial- and mammalian-based systems.
- One embodiment of the materials and methods described herein relates to monoclonal antibodies and fragments thereof effective against LASV.
- Another embodiment of the materials and methods described herein relates to monoclonal antibodies or fragments thereof effective against LCMV.
- Another embodiment of the materials and methods described herein relates to methods of producing forms of monoclonal antibodies effective against LASV and/or LCMV.
- Another embodiment of the materials and methods described herein relates to expression vectors comprising polynucleotides encoding forms of the LASV or LCMV GP-specific hMAbs.
- An embodiment of the materials and methods described herein relates to diagnostic uses of antibodies or fragments thereof, such as neutralizing antibodies, specific for LASV or LCMV.
- Another embodiment of the materials and methods described herein relates to diagnostics comprising the antibodies or fragments thereof specific for LASV or LCMV, including labeled antibodies or fragments thereof of the invention.
- Another embodiment of the materials and methods described herein is directed to kits comprising the antibodies of the invention.
- The following non-limiting embodiments are provided to illustrate certain aspects and feature of the materials and methods described herein.
-
Embodiment 1 is an antigen-binding composition comprising a neutralizing antibody or neutralizing antigen-binding antibody fragment thereof specific to glycoprotein 1 (GP1), glycoprotein 2 (GP2), glycoprotein precursor (GPC), or full-length glycoprotein (GP) of Lassa virus (LASV), wherein the antibody or antibody fragment comprises a heavy chain variable region (VH) and a light chain variable region (VL), the VH and VL each comprising complementarity determining regions CDR1, CDR2 and CDR3 selected from the group consisting of: - (a) a VH CDR1 of SEQ ID NO: 65, a VH CDR2 of SEQ ID NO: 66, a VH CDR3 of SEQ ID NO: 67, a VL CDR1 of SEQ ID NO: 113, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 114 (from MAb 10.4B);
- (b) a VH CDR1 of SEQ ID NO: 68, a VH CDR2 of SEQ ID NO: 69, a VH CDR3 of SEQ ID NO: 70, a VL CDR1 of SEQ ID NO: 115, a VL CDR2 of sequence Lys Ala Ser, and a VL CDR3 of SEQ ID NO: 116 (from MAb 19.7E);
- (c) a VH CDR1 of SEQ ID NO: 71, a VH CDR2 of SEQ ID NO: 72, a VH CDR3 of SEQ ID NO: 73, a VL CDR1 of SEQ ID NO: 117, a VL CDR2 of sequence Trp Ala Ser, and a VL CDR3 of SEQ ID NO: 118 (from MAb 2.9D);
- (d) a VH CDR1 of SEQ ID NO: 74, a VH CDR2 of SEQ ID NO: 75, a VH CDR3 of SEQ ID NO: 76, a VL CDR1 of SEQ ID NO: 119, a VL CDR2 of sequence Glu Val Lys, and a VL CDR3 of SEQ ID NO: 120 (from MAb 25.6A);
- (e) a VH CDR1 of SEQ ID NO: 77, a VH CDR2 of SEQ ID NO: 78, a VH CDR3 of SEQ ID NO: 79, a VL CDR1 of SEQ ID NO: 121, a VL CDR2 of sequence Asp Ala Ser, and a VL CDR3 of SEQ ID NO: 122 (from MAb 36.1F);
- (f) a VH CDR1 of SEQ ID NO: 80, a VH CDR2 of SEQ ID NO: 81, a VH CDR3 of SEQ ID NO: 82, a VL CDR1 of SEQ ID NO: 123, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 124 (from MAb 36.9F);
- (g) a VH CDR1 of SEQ ID NO: 83, a VH CDR2 of SEQ ID NO: 84, a VH CDR3 of SEQ ID NO: 85, a VL CDR1 of SEQ ID NO: 125, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 126 (from MAb 37.2D);
- (h) a VH CDR1 of SEQ ID NO: 86, a VH CDR2 of SEQ ID NO: 87, a VH CDR3 of SEQ ID NO: 88, a VL CDR1 of SEQ ID NO: 127, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 128 (from MAb 37.2G);
- (i) a VH CDR1 of SEQ ID NO: 89, a VH CDR2 of SEQ ID NO: 90, a VH CDR3 of SEQ ID NO: 91, a VL CDR1 of SEQ ID NO: 129, a VL CDR2 of sequence Glu Val Arg, and a VL CDR3 of SEQ ID NO: 130 (from MAb 37.7H);
- (j) a VH CDR1 of SEQ ID NO: 92, a VH CDR2 of SEQ ID NO: 93, a VH CDR3 of SEQ ID NO: 94, a VL CDR1 of SEQ ID NO: 131, a VL CDR2 of sequence Glu Val Ser, and a VL CDR3 of SEQ ID NO: 132 (from MAb 8.9F);
- (k) a VH CDR1 of SEQ ID NO: 95, a VH CDR2 of SEQ ID NO: 96, a VH CDR3 of SEQ ID NO: 97, a VL CDR1 of SEQ ID NO: 133, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 134 (from MAb NE13);
- (l) a VH CDR1 of SEQ ID NO: 98, a VH CDR2 of SEQ ID NO: 99, a VH CDR3 of SEQ ID NO: 100, a VL CDR1 of SEQ ID NO: 135, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 136 (from MAb 12.1F);
- (m) a VH CDR1 of SEQ ID NO: 101, a VH CDR2 of SEQ ID NO: 102, a VH CDR3 of SEQ ID NO: 103, a VL CDR1 of SEQ ID NO: 137, a VL CDR2 of sequence Gln Ala Ser, and a VL CDR3 of SEQ ID NO: 138 (from MAb 9.8A);
- (n) a VH CDR1 of SEQ ID NO: 104, a VH CDR2 of SEQ ID NO: 105, a VH CDR3 of SEQ ID NO: 106, a VL CDR1 of SEQ ID NO: 139, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 140 (from MAb 18.5C);
- (o) a VH CDR1 of SEQ ID NO: 107, a VH CDR2 of SEQ ID NO: 108, a VH CDR3 of SEQ ID NO: 109, a VL CDR1 of SEQ ID NO: 141, a VL CDR2 of sequence Gly Ala Tyr, and a VL CDR3 of SEQ ID NO: 142 (from MAb 8.11G); and
- (p) a VH CDR1 of SEQ ID NO: 110, a VH CDR2 of SEQ ID NO: 111, a VH CDR3 of SEQ ID NO: 112, a VL CDR1 of SEQ ID NO: 143, a VL CDR2 of sequence Ala Ala Val, and a VL CDR3 of SEQ ID NO: 144 (from MAb 25.10C).
-
Embodiment 2 is the composition ofEmbodiment 1, wherein the composition comprises two or more of said antibodies or antigen-binding antibody fragments. -
Embodiment 3 is the composition of any one ofEmbodiments - (1) an antibody or antigen-binding antibody fragment comprising a VH CDR1 of SEQ ID NO: 83, a VH CDR2 of SEQ ID NO: 84, a VH CDR3 of SEQ ID NO: 85, a VL CDR1 of SEQ ID NO: 125, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 126 (from MAb 37.2D);
- (2) an antibody or antigen-binding antibody fragment comprising a VH CDR1 of SEQ ID NO: 92, a VH CDR2 of SEQ ID NO: 93, a VH CDR3 of SEQ ID NO: 94, a VL CDR1 of SEQ ID NO: 131, a VL CDR2 of sequence Glu Val Ser, and a VL CDR3 of SEQ ID NO: 132 (from MAb 8.9F); and
- (3) an antibody or antigen-binding antibody fragment comprising a VH CDR1 of SEQ ID NO: 98, a VH CDR2 of SEQ ID NO: 99, a VH CDR3 of SEQ ID NO: 100, a VL CDR1 of SEQ ID NO: 135, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 136 (from MAb 12.1F).
-
Embodiment 4 is the composition of any one ofEmbodiments 1 to 3, wherein the antibody is selected from the group consisting of a monoclonal antibody, and a recombinantly produced antibody. -
Embodiment 5 is the composition of any one ofEmbodiments 1 to 4, wherein the antibody comprises a human monoclonal antibody. -
Embodiment 6 is the composition of any one ofEmbodiments 1 to 3, wherein the antigen-binding antibody fragment is selected from the group consisting of a Fab, a Fab′, and a F(ab′)2 fragment. -
Embodiment 7 is a nucleic acid (e.g., a cDNA) having a sequence that encodes for a VH of the antibody or the antibody fragment of a composition ofEmbodiment 1. - Embodiment 8 is the nucleic acid of
Embodiment 7, wherein the nucleic acid includes a nucleic acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 16. - Embodiment 9 is a nucleic acid 9 e.g., a cDNA) having a sequence that encodes for a VL of the antibody or the antibody fragment of
Embodiment 1. -
Embodiment 10 is the nucleic acid of Embodiment 9, wherein the nucleic acid includes a nucleic acid sequence selected from the group consisting of SEQ ID NO: 17 through SEQ ID NO: 32. -
Embodiment 11 is an expression vector that contains the nucleic acid sequence of any one ofEmbodiments 7 to 10. - Embodiment 12 is an antigen-binding composition comprising a neutralizing antibody or neutralizing antigen-binding antibody fragment thereof specific to glycoprotein 1 (GP1), glycoprotein 2 (GP2), glycoprotein precursor (GPC), or full-length glycoprotein (GP) of Lassa virus (LASV), wherein the antibody or antibody fragment comprises a heavy chain variable region (VH) and a light chain variable region (VL) selected from the group consisting of:
- (a) a VH of SEQ ID NO: 33 and a VL of SEQ ID NO: 49 (from MAb 10.4B);
- (b) a VH of SEQ ID NO: 34 and a VL of SEQ ID NO: 50 (from MAb 19.7E);
- (c) a VH of SEQ ID NO: 35 and a VL of SEQ ID NO: 51 (from MAb 2.9D);
- (d) a VH of SEQ ID NO: 36 and a VL of SEQ ID NO: 52 (from MAb 25.6A);
- (e) a VH of SEQ ID NO: 37 and a VL of SEQ ID NO: 53 (from MAb 36.1F);
- (f) a VH of SEQ ID NO: 38 and a VL of SEQ ID NO: 54 (from MAb 36.9F);
- (g) a VH of SEQ ID NO: 39 and a VL of SEQ ID NO: 55 (from MAb 37.2D);
- (h) a VH of SEQ ID NO: 40 and a VL of SEQ ID NO: 56 (from MAb 37.2G);
- (i) a VH of SEQ ID NO: 41 and a VL of SEQ ID NO: 57 (from MAb 37.7F);
- (j) a VH of SEQ ID NO: 42 and a VL of SEQ ID NO: 58 (from MAb 8.9F);
- (k) a VH of SEQ ID NO: 43 and a VL of SEQ ID NO: 59 (from MAb NE13);
- (l) a VH of SEQ ID NO: 44 and a VL of SEQ ID NO: 60 (from MAb 12.1F);
- (m) a VH of SEQ ID NO: 45 and a VL of SEQ ID NO: 61 (from MAb 9.8A);
- (n) a VH of SEQ ID NO: 46 and a VL of SEQ ID NO: 62 (from MAb 18.5C);
- (o) a VH of SEQ ID NO: 47 and a VL of SEQ ID NO: 63 (from MAb 8.11G); and
- (p) a VH of SEQ ID NO: 48 and a VL of SEQ ID NO: 64 (from MAb 25.10C).
- Embodiment 13 is the composition of Embodiment 12, wherein the composition comprises two or more of said antibodies or antigen-binding antibody fragments.
-
Embodiment 14 is the composition of any one of Embodiments 12 and 13, wherein the composition comprises: - (1) an antibody or antigen-binding antibody fragment comprising a VH of SEQ ID NO: 39 and a VL of SEQ ID NO: 55 (from MAb 37.2D);
- (2) an antibody or antigen-binding antibody fragment comprising a VH of SEQ ID NO: 42 and a VL of SEQ ID NO: 58 (from MAb 8.9F); and
- (3) an antibody or antigen-binding antibody fragment comprising a VH of SEQ ID NO: 44 and a VL of SEQ ID NO: 60 (from MAb 12.1F).
-
Embodiment 15 is the composition of any one of Embodiments 12 to 14, wherein the the antibody is selected from the group consisting of a monoclonal antibody, and a recombinantly produced antibody. - Embodiment 16 is the composition of any one of Embodiments 12 to 15, wherein the antibody comprises a human monoclonal antibody.
- Embodiment 17 is the composition of any one of Embodiments 12 to 14, wherein the antigen-binding antibody fragment is selected from the group consisting of a Fab, a Fab′, and a F(ab′)2 fragment.
-
Embodiment 18 is a nucleic acid (e.g., a cDNA) having a sequence that encodes for a VH of the antibody or the antibody fragment of Embodiment 12. - Embodiment 19 is a nucleic acid (e.g., a cDNA) having a sequence that encodes for a VL of the antibody or the antibody fragment of Embodiment 12.
-
Embodiment 20 is an expression vector that contains the nucleic acid sequence of any one ofEmbodiments 18 to 19. -
Embodiment 21 is a vaccine for preventing or treating infection of a patient by Lassa virus or other arenaviridae comprising the antibody or antibody fragment of any one ofEmbodiments 1 to 6 and 12 to 17. - Embodiment 22 is the vaccine of
Embodiment 21, which is cross-protective against infection by other arenaviridae. - Embodiment 23 is the vaccine of any one of
Embodiments 21 to 22, which is cross-protective against infection by a lymphocytic choriomeningitis virus. - Embodiment 24 is a pharmaceutical composition for treating or preventing infection by a Lassa virus or other arenaviridae comprising the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 and a pharmaceutically acceptable carrier. -
Embodiment 25 is the antibody or antibody fragment of any one ofEmbodiments 1 to 6 and 12 to 17 for use in treating or preventing infection by a Lassa virus or other arenaviridae. - Embodiment 26 is the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 for use in treating or preventing a lymphocytic choriomeningitis virus infection. - Embodiment 27 is use of the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 for treating or preventing infection by a Lassa virus or other arenaviridae. - Embodiment 28 is use of the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 for treating or preventing a lymphocytic choriomeningitis virus infection. - Embodiment 29 is use of the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 for the preparation of a medicament for treating or preventing infection by a Lassa virus or other arenaviridae. - Embodiment 30 is use of the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 for the preparation of a medicament for treating or preventing a lymphocytic choriomeningitis virus infection. - Embodiment 31 is diagnostic kit for detecting infection of a subject by Lassa virus or other arenaviridae comprising at least one antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 bound to a detectable labelling group. - Embodiment 32 is an antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 bound to a detectable labelling group. - Embodiment 33 is a method of detecting infection by a Lassa virus or other arenaviridae comprising contacting a biological sample from a subject with at least one antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 bound to a detectable labelling group; and detecting a complex between the antibody or antibody fragment and a Lassa virus or other arenaviridae present in the sample. - Embodiment 34 is a method of treating or preventing infection by a Lassa virus or other arenaviridae in a subject comprising administering the antibody or antibody fragment of any one of
Embodiments 1 to 6 and 12 to 17 to the subject. -
Embodiment 35 is a method of treating or preventing a lymphocytic choriomeningitis virus infection in a subject comprising administering the antibody or antibody fragment of any one ofEmbodiments 1 to 6 and 12 to 17 to the subject. - Other embodiments and advantages of the materials and methods described herein are set forth in part in the description, which follows, and in part, may be understood by a person of ordinary skill in the art from this description, or from the practice or use of the materials and methods described herein.
-
FIG. 1 depicts (A) Schematic representation of LASV GP; (B) Arenavirus GP complex; and (C) Recognition of different LASV GP species by LASV hMAbs. (A) LASV GP is synthesized as the precursor protein GPC. Signal peptidase (Spase) cleaves the small stable signal peptide (SSP) that remains associated with GP1 and GP2 to form the GP complex (FIG. 1 , Panel B). The cellular protease SK1/S1P cleaves GPC into GP1 and GP2. Construct rGPe corresponds to a recombinant LASV GPC ectodomain lacking GP2 and with a non-cleavable linker replacing the SK1/S1P cleavage recognition site. Constructs expressing recombinant SSP-GP1 (rGP1) and SSP fused to GP2 (rGP2) were also generated. (B) GP-1 forms the globular head subunit that interact with the cellular receptor whereas GP2 mediates the fusion of the viral envelop with the cell membrane. SSP remains associated with both GP1 and GP2 and plays critical roles in the biology of the GP complex. (C) 293T cells were transfected with pCAGGS expressing plasmids encoding LASV rGP1, rGP2 and GPC and the reactivity of LASV hMAbs evaluated at 48 h post-transfection by immunofluorescence. The distribution of LASV GP-specific hMAbs by subunit specificity, neutralizing activity and reactivity to linear epitopes is indicated. -
FIG. 2 depicts in vitro neutralization of LCMV ARM with the 15 LASV GP-specific neutralizing hMAbs: LASV Josiah (squares) and LCMV ARM (triangles) GP-pseudotyped rLCMVΔGP/GFP viruses were incubated for 90 min at 37° C. with a 2-fold dilution of the indicated LASV GP-specific BNhMAb before infecting LCMV GP-expressing Vero cells (96 plate format, triplicates). Virus neutralization was determined under a fluorescent microscope and quantified using a GFP microplate reader at 72 hours post-infection. Results are presented as percent inhibition after normalizing to respective viral infections in the absence of hMAbs. Virus infection in the absence of hMAbs was used as internal control. Mean values and standard deviation are shown. Standard error was calculated based on 2-6 replicates. -
FIG. 3 depicts in vivo neutralization of the 6 LCMV neutralizing antibodies (12.1F, 9.8A, 37.2D, 36.9F, 37.2G, and 18.5C) using the non-crossreactive antibodies 19.7E and 8.9F as internal controls. Mice were infected with rCl-13 (2×106 pfu; i.v.) and treated with the indicated hMAb (20 mg/kg; i.p.), as well as an isotype hMAb control (20 mg/kg, i.p.) or vehicle. Atdays -
FIG. 4 illustrates Viremia data from treated and control GP plasma ondays day 7 treatment groups 37.7H, 12.1F, and 25.6A as well asday 14 12.1F, 37.2D, 19.7E, and 10.4B were below the limit of detection (LOD). Error bars represent standard deviation from mean values. *denotes P_0.05. **denotes P_0.001. ***denotes P<0.0001. -
FIG. 5 depicts clinical scores of HuMAb treated and untreated guinea pigs. HuMAbs 8.9F and 12.1 treated GP showed no variation in clinical score from baseline (data not shown). Error bars (thin lines) represent standard deviation from mean values. -
FIG. 6 illustrates the effect of antibodies on rVSV-LASV GP infection and fusion. Antibody-mediated neutralization of (A) rVSV-LASV GP or (B) rVSV-VSV-G. The antibody 9.7A is non-neutralizing and in the same competition group as 37.7H (GPC-B); 13.4E binds to a linear epitope in the T-loop of GP2; 12.1F binds to the GP1 subunit of LASV. Error bars indicate the standard deviation of at least six (two biological replicates, each having three or more technical replicates). (C) Antibody-mediated inhibition of rVSVLASV GP fusion at the cell surface. Error bars indicate the standard error of the mean of six (except 37.7H, where N=9). (D) Fab 37.7H reduces binding of a LAMP1-Fc fusion protein to LASV GPCysR4. Error bars indicate the standard deviation of six and three technical replicates. -
FIG. 7 provides a sequence alignment prepared using CLUSTAL OMEGA™ (1.2.4) multiple sequence alignment (from EMBL-EBI, a part of the European Molecular Biology Laboratory) for the heavy chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with {circumflex over ( )}), and CDR3 (marked with #). The sequences shown include 10.4B (SEQ ID NO: 33), 19.7E (SEQ ID NO: 34), 2.9D (SEQ ID NO: 35), 25.6A (SEQ ID NO: 36), 36.1F (SEQ ID NO: 37), 36.9F (SEQ ID NO: 38), 37.2D (SEQ ID NO: 39), 37.2G (SEQ ID NO: 40), 37.7H (SEQ ID NO: 41), 8.9F (SEQ ID NO: 42), NE13 (SEQ ID NO: 43), 12.1F (SEQ ID NO: 44), 9.8A (SEQ ID NO: 45), 18.5C (SEQ ID NO: 46), 8.11G (SEQ ID NO: 47), and 25.10C (SEQ ID NO: 48). -
FIG. 8 provides a sequence alignment prepared using CLUSTAL OMEGA™ (1.2.4) multiple sequence alignment for the light chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with {circumflex over ( )}), and CDR3 (marked with #). The sequences shown include 10.4B (SEQ ID NO: 49), 19.7E (SEQ ID NO: 50), 2.9D (SEQ ID NO: 51), 25.6A (SEQ ID NO: 52), 36.1F (SEQ ID NO: 53), 36.9F (SEQ ID NO: 54), 37.2D (SEQ ID NO: 55), 37.2G (SEQ ID NO: 56), 37.7H (SEQ ID NO: 57), 8.9F (SEQ ID NO: 58), NE13 (SEQ ID NO: 59), 12.1F (SEQ ID NO: 60), 9.8A (SEQ ID NO: 61), 18.5C (SEQ ID NO: 62), 8.11G (SEQ ID NO: 63), and 25.10C (SEQ ID NO: 64). - The practice of the materials and methods described herein will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry, and immunology, which are all within the normal skill of the art. Such techniques are fully explained in the literature, such as, for example, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press; Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (I. E. Cellis, ed., 1998) Academic Press; Animal Cell Culture (R. I. Freshney, ed., 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds., 1993-8) J. Wiley and Sons; Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M. Weir and C. C. Blackwell, eds.); Gene Transfer Vectors for Mammalian Cells (J. M. Miller and M. P. Cabs, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel, et aL, eds., 1987); PCR: The Polymerase Chain Reaction, (Mullis, et al., eds., 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: a practical approach (D. Catty, ed., IRL Press, 1988-1989); Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J. D. Capra, eds., Harwood Academic Publishers, 1995).
- As used herein, the singular form “a”, “an”, and “the” includes plural references unless indicated otherwise. For example, “a” monoclonal antibody includes one or more monoclonal antibodies.
- Generally, monoclonal antibodies specific for LASV, monoclonal antibodies specific for LCMV, the polynucleotides encoding the antibodies, and methods for using these antibodies in prevention, diagnosis, detection, and treatment are described herein. Specifically, human monoclonal antibodies specific for LASV, human monoclonal antibodies specific for LCMV, and combinations thereof for development and production of diagnostics, vaccines, therapeutics, and screening tools are provided. Generally, B cell clones producing specific IgG to GP of any Lassa virus isolate or strain may be utilized to derive the antibodies described herein.
- The term polynucleotide is used broadly and refers to polymeric nucleotides of any length (e.g., oligonucleotides, genes, small inhibiting RNA, fragments of polynucleotides encoding a protein, etc.). By way of example and not limitation, the polynucleotides of the invention may comprise a sequence encoding all or part of the ectodomain and part of the transmembrane domain. The polynucleotide of the invention may be, for example, linear, circular, supercoiled, single-stranded, double-stranded, branched, partially double-stranded or partially single-stranded. The nucleotides comprised within the polynucleotide may be naturally occurring nucleotides or modified nucleotides.
- Functional equivalents of these polynucleotides are also intended to be encompassed by this invention. By way of example and not limitation, functionally equivalent polynucleotides are those that possess one or more of the following characteristics: the ability to generate antibodies (including, but not limited to, viral neutralizing antibodies) capable of recognizing LASV GP or the ability to generate antibodies specific to LASV GP that show neutralizing activity against LASV lineages I-IV, and proposed new lineages (e.g. lineage V from Mali, lineage VI from Togo and Benin.
- Polynucleotide sequences that are functionally equivalent may also be identified by methods known in the art. A variety of sequence alignment software programs are available to facilitate determination of homology or equivalence. Non-limiting examples of these programs are BLAST family programs including BLASTN, BLASTP, BLASTX, TBLASTN, and TBLASTX (BLAST is available from the National Institutes of Health website), FASTA™, COMPARE, DOTPLOT™, BESTFIT™, GAP™, FRAMEALIGN™, CLUSTALW™, and PILEUP. Other similar analysis and alignment programs can be purchased from various providers such as DNA Star's MEGALIGN′, or the alignment programs in GENEJOCKEY™. Alternatively, sequence analysis and alignment programs can be accessed through the world wide web at sites such as the CMS Molecular Biology Resource at San Diego Supercomuter Center (SDSC) website; and the Swiss Institute of Bioinformatics SIB Bioinformatics Resource Portal website ExPASy Proteomics Server. Any sequence database that contains DNA or protein sequences corresponding to a gene or a segment thereof can be used for sequence analysis. Commonly employed databases include but are not limited to GenBank, EMBL, DDBJ, PDB, SWISS-PROT, EST, STS, GSS, and HTGS.
- Parameters for determining the extent of homology set forth by one or more of the aforementioned alignment programs are well established in the art. They include but are not limited to p value, percent sequence identity and the percent sequence similarity. P value is the probability that the alignment is produced by chance. For a single alignment, the p value can be calculated according to Karlin et al. (1990) Proc. Natl. Acad. Sci. (USA) 87: 2246. For multiple alignments, the p value can be calculated using a heuristic approach such as the one programmed in BLAST. Percent sequence identify is defined by the ratio of the number of nucleotide or amino acid matches between the query sequence and the known sequence when the two are optimally aligned. The percent sequence similarity is calculated in the same way as percent identity except one scores amino acids that are different but similar as positive when calculating the percent similarity. Thus, conservative changes that occur frequently without altering function, such as a change from one basic amino acid to another or a change from one hydrophobic amino acid to another are scored as if they were identical.
- The term “analog” includes any polypeptide having an amino acid residue sequence substantially identical to a polypeptide of the invention in which one or more residues have been conservatively substituted with a functionally similar residue and which displays the functional aspects of the polypeptides as described herein. Examples of conservative substitutions include the substitution of one non-polar (hydrophobic) residue such as isoleucine, valine, leucine or methionine for another; the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, between glycine and serine; the substitution of one basic residue such as lysine, arginine or histidine for another; and the substitution of one acidic residue, such as aspartic acid or glutamic acid or another.
- The phrase “conservative substitution” also includes the use of a chemically derivatized residue in place of a non-derivatized residue. “Chemical derivative” refers to a subject polypeptide having one or more amino acid residues chemically derivatized by reaction of a functional side group. Examples of such derivatized amino acids include for example, those amino acids in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups. Also, the free carboxyl groups of amino acids may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides. Also, the free hydroxyl groups of certain amino acids may be derivatized to form 0-acyl or 0-alkyl derivatives. Also, the imidazole nitrogen of histidine may be derivatized to form N-imbenzylhistidine. Also included as chemical derivatives are those proteins or peptides which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. For example, 4-hydroxyproline may be substituted for proline, 5-hydroxylysine may be substituted for lysine, 3-methylhistidine may be substituted for histidine, homoserine may be substituted for serine, and ornithine may be substituted for lysine. Polypeptides of the present invention also include any polypeptide having one or more additions and/or deletions of residues relative to the sequence of any one of the polypeptides whose sequence is described herein.
- Two polynucleotide or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence as described below. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity. A “comparison window” as used herein, refers to a segment of at least about 20 contiguous positions, usually 30 to about 75 contiguous positions, or 40 to about 50 contiguous positions, in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Optimal alignment of sequences for comparison may be conducted using the MEGALIGN™ program in the LASERGENE™ suite of bioinformatics software (DNASTAR, Inc., Madison, Wis.), using default parameters. This program embodies several alignment schemes described in the following references: Dayhoff, M. O. (1978) “A model of evolutionary change in proteins—Matrices for detecting distant relationships” in Dayhoff, M. O. (ed.) Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, Washington D.C. Vol. 5, Suppl. 3, pp. 345-358 (1978); Hem J., “Unified Approach to Alignment and Phylogenes” pp. 626-645 Methods in Enzymology vol. 183, Academic Press, Inc., San Diego, Calif. (1990); Higgins, D. G. and Sharp, P. M., 1989, CABIOS 5:151-153; Myers, E. W. and Muller W., 1988, CABIOS 4:11-17; Robinson, E. D., 1971, Comb. Theor. 11:105; Santou, N., Nes, M., 1987, Mol. Biol. Evol. 4:406-425; Sneath, P. H. A. and Sokal, R. R., 1973, Numerical Taxonomy the Principles and Practice of Numerical Taxonomy, Freeman Press, San Francisco, Calif.; Wilbur, W. J. and Lipman, D. J., 1983, Proc. Natl. Acad. Sci. USA 80:726-730.
- Preferably, the “percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e., the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
- Expression vectors comprising at least one polynucleotide encoding an antibody or antibody fragment protein also are described herein. Expression vectors are well known in the art and include, but are not limited to viral vectors or plasmids. Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art. Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos. 5,219,740 and 4,777,127), alphavirus-based vectors (e.g., Sindbis virus vectors, Semliki forest virus), Ross River virus, adeno-associated virus (AAV) vectors (see, e.g., PCT Publication Nos. WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655), vaccinia virus (e.g., Modified Vaccinia virus Ankara (MVA) or fowlpox), Baculovirus recombinant system and herpes virus.
- Nonviral vectors, such as plasmids, are also well known in the art and include, but are not limited to, yeast- and bacteria-based plasmids.
- Methods of introducing the vectors into a host cell and isolating and purifying the expressed protein are also well known in the art (e.g., Molecular Cloning: A Laboratory Manual, second edition, Sambrook, et al., 1989, Cold Spring Harbor Press). Examples of host cells include, but are not limited to, mammalian cells such as NS0 and CHO cells.
- By way of example, vectors comprising the polynucleotides described herein may further comprise a tag polynucleotide sequence to facilitate protein isolation and/or purification. Examples of tags include but are not limited to the myc-epitope, S-tag, his-tag, HSV epitope, V5-epitope, FLAG and CBP (calmodulin binding protein). Such tags are commercially available or readily made by methods known to the art.
- The vector may further comprise a polynucleotide sequence encoding a linker sequence. Generally, the linking sequence is positioned in the vector between the antibody polynucleotide sequence and the polynucleotide tag sequence. Linking sequences can encode random amino acids or can contain functional sites. Examples of linking sequences containing functional sites include but are not limited to, sequences containing the Factor Xa cleavage site, the thrombin cleavage site, or the enterokinase cleavage site.
- By way of example, and not limitation, an antibody specific for LASV may be generated as described herein using mammalian expression vectors in mammalian cell culture systems or bacterial expression vectors in bacterial culture systems. By way of example, and not limitation, an antibody specific for LCMV may be generated as described herein using mammalian expression vectors in mammalian cell culture systems or bacterial expression vectors in bacterial culture systems.
- Examples of antibodies disclosed herein, include, but are not limited to, antibodies specific for LASV or LCMV, antibodies that cross react with native Lassa virus antigens and/or native lymphocytic choriomeningitis virus antigens, and neutralizing antibodies. By way of example, a characteristic of a neutralizing antibody includes the ability to block or prevent infection of a host cell. The antibodies may be characterized using methods well known in the art.
- The antibodies useful in the compositions and methods described herein can encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab′, F(ab′)2, Fv, Fc, etc.), chimeric antibodies, bi-specific antibodies, heteroconjugate antibodies, single-chain fragments (e.g. ScFv), mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies. The antibodies may be murine, rat, human, or of any other origin (including chimeric or humanized antibodies).
- Methods of preparing monoclonal and polyclonal antibodies are well known in the art. Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired an adjuvant. Examples of adjuvants include, but are not limited to, keyhole limpet hemocyanin (KLH), serum albumin, bovine thryoglobulin, soybean trypsin inhibitor, complete Freund adjuvant (CFA), and MPL-TDM adjuvant. The immunization protocol can be determined by one of skill in the art.
- The antibodies may alternatively be monoclonal antibodies. Monoclonal antibodies may be produced using hybridoma methods (see, e.g., Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, D. W., et al., In Vitro, 18:377-381 (1982).
- If desired, the antibody of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest may be maintained in the vector in a host cell, and the host cell can then be expanded and frozen for future use. In an alternative embodiment, the polynucleotide sequence may be used for genetic manipulation to “humanize” the antibody or to improve the affinity, or other characteristics of the antibody (e.g., genetically manipulate the antibody sequence to obtain greater affinity to LASV and/or LCMV glycoprotein and/or greater efficacy in inhibiting the fusion of LASV and/or LCMV to the host cell).
- The antibodies may also be humanized by methods known in the art (See, for example, U.S. Pat. Nos. 4,816,567; 5,807,715; 5,866,692; 6,331,415; 5,530,101; 5,693,761; 5,693,762; 5,585,089; and 6,180,370). In yet another alternative, human antibodies may be obtained by using mice that have been engineered to express specific human immunoglobulin proteins.
- In another alternative embodiment, antibodies may be made recombinantly and expressed using any method known in the art. By way of example, antibodies may be made recombinantly by phage display technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265,150; and Winter et at., Annu. Rev. Immunol. 12:433-455 (1994). Alternatively, phage display technology (McCafferty et al., Nature 348:552-553 (1990)) can be used to produce human antibodies and antibody fragments in vitro. Phage display can be performed in a variety of formats; for review, see Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3:564-571 (1993). By way of example, LASV and/or LCMV glycoprotein as described herein may be used as an antigen for the purposes of isolating recombinant antibodies by these techniques.
- Antibodies may be made recombinantly by first isolating the antibodies and antibody producing cells from host animals, obtaining the gene sequence, and using the gene sequence to express the antibody recombinantly in host cells (e.g., CHO cells). Another method that may be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been disclosed. See, for example, Peeters, et al. Vaccine 19:2756 (2001); Lonberg, N. and D. Huszar Int. Rev. Immunol 13:65 (1995); and Pollock, et al., J. Immunol. Methods 231:147 (1999). Methods for making derivatives of antibodies (e.g. humanized and single-chain antibodies, etc.) are known in the art.
- The antibodies described herein can be bound to a carrier by conventional methods for use in, for example, isolating or purifying LASV and/or LCMV glycoprotein or detecting LASV and/or LCMV glycoproteins, antigens, or particles in a biological sample or specimen. Alternatively, by way of example, the neutralizing antibodies of the invention may be administered as a therapeutic treatment to a subject infected with or suspected of being infected with LASV or LCMV. A “subject,” includes but is not limited to humans, simians, farm animals, sport animals, and pets. Veterinary uses are also encompassed by methods described herein. For diagnostic purposes, the antibodies can be labeled, e.g., bound to a detectable labelling group such as a fluorescent dye (e.g., a ALEXA FLUOR® dye), a quantum dot label (e.g., a QDOT® label), R-phycoerythrin, streptavidin, biotin, an enzyme (e.g., Glucose Oxidase, Horseradish Peroxidase or Alkaline Phosphatase), a radioiosotope (e.g., iodine-125, indium-111), and the like. Such labelling techniques are well known in the antibody art.
- Sixteen neutralizing antibodies against LASV were identified, which are designated herein as 10.4B, 19.7E, 2.9D, 25.6A, 36.1F, 36.9F, 37.2D, 37.2G, 37.7H, 8.9F, NE13, 12.1F, 9.8A, 18.5C, 8.11G, and 25.10C. Nucleotide sequences (cDNA) encoding portions of heavy chain (HC) and light chain (LC) of each antibody are shown below. The illustrated nucleotide sequences encode portions of the HC and LC encompassing the variable regions thereof, i.e., the VH and VL regions, respectively, along with portions of vector sequences.
-
(10.4B VH) SEQ ID NO: 1 tgcgcgttac ngatccaagc tgtgaccggc gcctacctga gatcaccggt gctagcacca 60 tggagacaga cacactcctg ctatgggtac tgctgctctg ggttccaggt tccactggtg 120 accaggtgca gctggtacag tctgggggag gcgtggtcca gcctgggagg tccctgagag 180 tctcctgtgt tacgtctgga ttcaatttca gagcctacgg catgcactgg gtccgccaga 240 ttccaggcaa gggactggag tgggtggcag atatttggtc tgccgagact aatagacact 300 atgcagattc cgtgaagggc cgattcacca tctccagaga caactccaag agcacactgt 360 atctgcaaat gaacagcctg agagccgagg acacgggcgt atatttctgt gccaaagcgc 420 gaccaggcta tgattatgtc gttgacttat ggggccaggg aacgctggtc atcgtctcct 480 cagcttccac caagggccca tcggtcttcc ccctggcgcc ctgctccagg agcacctctg 540 ggggcacagc ggccctgggc tgcctggtca aggactactt ccccgaaccg gtgacggtgt 600 cgtggaactc aggcgccctg accagcggcg tgcacacctt cccggctgtc ctacagtcct 660 caggactcta 670 (19.7E VH) SEQ ID NO: 2 atccagctgt gaccggcgcc tacctgagat caccggtgct agcaccatgg agacagacac 60 actcctgcta tgggtactgc tgctctgggt tccaggttcc actggtgacg aggtgcagct 120 ggtggagtct gggggaggct tagttcggcc tggggggtcc ctgagactct cctgtgcagc 180 ctctggattc tccttcagta gctactcgat gcactgggtc cgccatgttc ctgggaaggg 240 gctggtgtgg gtctcatata ttaatagtga tgggagtact aaaatctacg cggactccgt 300 gaagggccga ttctccatct ccagagacaa tgccaagaac aagctctatc tgcaaatgga 360 cagtttgaga gtcgaggaca cggctgtata ttcgtgtgta aggcttgtac attacgactg 420 gtccccattc gtgtggggcc agggaaccct ggtcaccgtc tcctcagcct ccaccaaggg 480 cccatcggtc ttccccctgg caccctcctc caagagcacc tctgggggca cagcggccct 540 gggctgcctg gtcaaggact acttccccga accggtgacg gtgtcgtgga actcaggcgc 600 cctgaccagc ggcgtgcaca ccttcccggc tgtcctacag tcctcaggac tctactccct 660 cagcagcgtg gtgaccgtgc cctccagcag cttgggcacc cagacctaca tctgcaacgt 720 gaatcacaag cccagcaaca ccaaggtgga caagaaagtt gagccccaat cttgtgacaa 780 aactcacaca tgcccaccgt gcccagcacc tgaactcct 819 (2.9D VH) SEQ ID NO: 3 gtcactgcac ctcggttcta tcgattggct agcaccatgg agacagacac actcctgcta 60 tgggtactgc tgctctgggt tccaggttcc actggtgacg aggtgcagct ggtggagtct 120 gggggaggcc tggtcaagcc tggggggtcc cttagactct cctgtgcagc ctctggattc 180 accttcacta gatttacttt gacctgggtc cgccaggctc cagggaaggg gctggagtgg 240 gtctcatcca ttagtagtgg gagtagtgac ataaactacg cagactcagt gaagggccga 300 ttcaccatat ccagagacaa cgccaggaac tccctgttcc tgcaaatgag cagcctgaga 360 gtcgacgaca cggctgtgta ttactgtgcg aaagatcccc ggtcggggat ctctggtcgc 420 tacgggatgg acgtctgggg ccaagggacc acggtcatcg tctcctcagc ttccaccaag 480 ggcccatcgg tcttccccct ggcgccctgc tccaggagca cctctggggg cacagcggcc 540 ctgggctgcc tggtcaagga ctacttcccc gaaccggtga cggtgtcgtg gaactcaggc 600 gccctgacca gcggcgtgca caccttcccg gctgtcctac agtcctcagg actctactcc 660 ctcagcagcg tggtgaccgt gccctccagc agcttgggca cccagaccta catctgcaac 720 gtgaatcaca agcccagcaa caccaaggtg gacaagagag ttgagcccaa atcttgtgac 780 aaaactcaca catgcccacc gtgcccagca cctgaactcc tggggggacc gtcagtcttc 840 ctcttccccc caaaacccaa ggacaccctc atgatctccc ggacccctga ggtcacatgc 900 gtggtggtgg acgtgagcca 920 (25.6A VH) SEQ ID NO: 4 acctcggttc ttcgattggc tagcaccatg gagacagaca cactcctgct atgggtactg 60 ctgctctggg ttccaggttc cactggtgac caggtgcagc tgcaggagtc aggaggaggc 120 ctggtcaagg ctggggggtc cctgagactc tcctgtgcag cctctggatt catgttcgag 180 agatatagcc ttcactgggt ccgtcagact ccaggcaagg ggctggagtg ggtctcatcc 240 attagtagtc ttagtggcag tcacataaac tacgcagact cagtgaaggg ccgattcacc 300 atctccagag acaacgccaa gaattcactg tctctgcaaa tgaacagcct gagagtcgaa 360 gacacggcta tatattattg tgcgagagat cgacgttcgg ggagttcccc cgtccccttg 420 gacgtctggg gccaagggac cacggtcacc gtctcctctg cctccaccaa gggcccatcg 480 gtcttccccc tggcaccctc ctccaagagc acctctgggg gcacagcggc cctgggctgc 540 (36.1F VH) SEQ ID NO: 5 gtcactgccc tcggttctat cgattggcta gcaccatgga gacagacaca ctcctgctat 60 gggtactgct gctctgggtt ccaggttcca ctggtgacca ggtgcagctg caggagtcgg 120 gcgcgggact ggtgaagcct tcggagaccc tgtccctcac ctgcgctgtc tcaggtggac 180 ccttcagcgg tgcctactgg acgtggatcc gccaaactcc agggaagggg ctggagtgga 240 ttggagaggc cggtcggagt ggaaccacca actacaatcc gtccctcaag agtcgagtca 300 ccatatcact ggacacgtcc aagagccagt tttccctgaa gctgacttcc gtgaccgccg 360 cggacacggc tgtttacttc tgtgggagac gccaaataat gtctttgagt aatctttata 420 agagacccgt tgactcttgg ggccggggaa ccccggtcat cgtctcctca gcctccacca 480 agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg ggcacagcgg 540 ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg tggaactcag 600 gcgccctgac cagcggcgtg cacaccttcc cggctgtcct acagtcctca ggactctact 660 ccctcagcag cgtggtgacc gtgccctcca gcagcttggg cacccagacc tacatctgca 720 acgtgaatca caagcccagc aacaccaagg tggacaagag agttgagccc aaatcttgtg 780 acaaaactca cacatgccca ccgtgcccag cacctgaact cctgggggga ccgtcagtct 840 tcctcttccc cccaa 855 (36.9F VH) SEQ ID NO: 6 gtcactgccc tcggttctat cgattggcta gcaccatgga gacagacaca ctcctgctat 60 gggtactgct gctctgggtt ccaggttcca ctggtgacga ggtgcagctg gtgcagtctg 120 gaggaggcct ggtcaaggcg ggggggtccc tgaaactctc ctgtggagcc tctggattca 180 ccttcagtag ttatagcatg agctgggtcc gccaggctcc agggaagggg ctggagtggg 240 tctcatacat tagtagtggt gggagttcta tacactacgc agactcagtg aagggccgat 300 tcaccatctc cagagacaac gccaagaatt cactgtatct gcaaatgaag aacctgaggg 360 tcgacgacac gggtcggtat tattgtgtga gagatccccg atcggggatc tctggtcggt 420 acggtatgga cgtctggggt caagggacca cggtcaccgt ctcctcagcc tccaccaagg 480 gcccatcggt cttccccctg gcaccctcct ccaagagcac ctctgggggc acagcggccc 540 tgggctgcct ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg aactcaggcg 600 ccctgaccag cggcgtgcac accttcccgg ctgtcctaca gtcctcagga ctctactccc 660 tcagcagcgt ggtgaccgtg ccctccagca gcttgggcac ccagacctac atctgcaacg 720 tgaatcacaa gcccagcaac accaaggtgg acaagagagt tgagcccaaa tcttgtgaca 780 aaactcacac atgcccaccg tgcccagcac ctgaactcct ggggggaccg tcagtcttcc 840 tcttcccccc aaacccaagg acaccctcat gatc 874 (37.2D VH) SEQ ID NO: 7 tcactgccct cggttctatc gattggctag caccatggag acagacacac tcctgctatg 60 ggtactgctg ctctgggttc caggttccac tggtgacgaa gtgcagctgg tgcagtctgg 120 agctgaggtg aagaagcctg gggcttcagt gaaggtgtcc tgcaaggcct ctggttacac 180 ctttacgaaa tacggaatca gctgggtgcg acaggcccct ggacaagggc ttgagtggat 240 gggatggatc agcgcgttta atggttacac aaggtatggt cagagattcc agggcaaagt 300 caccatgacc acagacacat ccacgaacac agcctctttg gaggtgagga ccctgacatc 360 taacgacacg gccgtctatt actgtgcgag acaatatccc gaccaatata gtagcagcgg 420 ttggccccgc ctcttcgcca tggacgtctg gggccaaggg accacggtca tcgtctcccc 480 agcctccacc aagggcccat cggtcttccc cctggcaccc tcctccaaga gcacctctgg 540 gggcacagcg gccctgggct gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc 600 gtggaactca ggcgccctga ccagcggcgt gcacaccttc ccggctgtcc tacagtcctc 660 aggactctac tccctcagca gcgtggtgac cgtgccctcc agcagcttgg gcacccagac 720 ctacatctgc aacgtgaatc acaagcccag caacaccaag gtggacaaga gagttgagcc 780 caaatcttgt gacaaaactc acacatgccc accgtgccca gcacctgaac tcctgggggg 840 accgtcagtc ttcctcttc 859 (37.2G VH) SEQ ID NO: 8 tcactgccct cggttctatc gattggctag caccatggag acagacacac tcctgctatg 60 ggtactgctg ctctgggttc caggttccac tggtgacgag gtgcagctgg tggagtctgg 120 gggaggcctg gtcaagccgg gggggtcccg gagactctcc tgtgctgcct ctggattcac 180 cttcagtaga gataccatga cctgggtccg ccaggctcca gggaaggggc tggagtgggt 240 cgcatccata agtagtggta gcagtgacat aaactacgca gactcagtga agggccgatt 300 caccatctcc agagacaacg gcaagaactc actgtatctg cacatgaaca gcctgagagc 360 cgacgacacg gctatatatt actgtgcgag agatccccgg tcgggaatct ctggtcggta 420 tggtatggac gtctggggcc aagggaccac ggtcaccgtc tcctcagcct ccaccaaggg 480 cccatcggtc ttccccctgg caccctcctc caagagcacc tctgggggca cagcggccct 540 gggctgcctg gtcaaggact acttccccga accggtgacg gtgtcgtgga actcaggcgc 600 cctgaccagc ggcgtgcaca ccttcccggc tgtcctacag tcctcaggac tctactccct 660 cagcagcgtg gtgaccgtgc cctccagcag cttgggcacc cagacctaca tctgcaacgt 720 gaatcacaag cccagcaaca ccaaggtgga caagagagtt gagcccaaat cttgtgacaa 780 aactcacaca tgcccaccgt gcccagcacc tgaactcctg gggggaccgt cagtcttcct 840 cttcccccca aaacccaagg acaccctcat gatctcccgg acccctgagg tcacatgcgt 900 ggtggtggac gtgagccacg aagaccctga ggtcaagttc aactggtacg tggacggcgt 960 (37.7H VH) SEQ ID NO: 9 gtcactgcac ctcggttcta tcgattggct agcaccatgg agacagacac actcctgcta 60 tgggtactgc tgctctgggt tccaggttcc actggtgacg aggtgcagct ggtgcagtct 120 ggaggaggcc tggtcaaggc gggggggtcc ctgaggctct cctgtgcagc ctccggattc 180 acattcagca cctacagtat gaactggatc cgccaggctc cagggaaggg gctggagtgg 240 gtcgcttcca ttagtagtcg aagtggcagt cacataaact acgtagactc agtgaaggga 300 cgattcacca tctccagaga caacgccagg gacttattgt atctgcaaat gaacagcctg 360 agagtcgacg actcggctct ctattactgt gcgagagatc gccgttcggg gacttctccc 420 ctccccttgg acgtctgggg ccaagggacc acggtcaccg tcttctcagc ctccaccaag 480 ggcccatcgg tcttccccct ggcaccctcc tccaagagca cctctggggg cacagcggcc 540 ctgggctgcc tggtcaagga ctacttcccc gaaccggtga cggtgtcgtg gaactcaggc 600 gccctgacca gcggcgtgca caccttcccg gctgtcctac agtcctcagg actctactcc 660 ctcagcagcg tggtgaccgt gccctccagc agcttgggca cccagaccta catctgcaac 720 gtgaatcaca agcccagcaa caccaaggtg gacaagagag ttgagcccaa atcttgtgac 780 aaaactcaca catgcccacc gtgcccagca cctgaactcc tggggggacc gtcagtcttc 840 ctcttccccc caaaacccaa ggacaccctc atgatctccc ggacccctga ggtcacatgc 900 gtggtggtgg acgtgagcca cgaa 924 (8.9F VH) SEQ ID NO: 10 cctcggttct atcgattggc tagcaccatg gagacagaca cactcctgct atgggtactg 60 ctgctctggg ttccaggttc cactggtgac cagggcacct tgagggagtc tggtccagga 120 ctggtgaggc cttcggagac cctgtccctc acctgcggtg tctctggtta ttccatcagt 180 agtggttact actggggctg gatccggcag cccccaggga aggggctgga gtggattggg 240 aatatctatc gtagtgggag cacctactac aacccgtccc tcaagagtcg agtcaccgtc 300 tcaatagaca cgtccaaaaa ccagttctcc ctgaagttga attctgtgac cgccgcagac 360 acggccgtgt attactgtgc gagatcgggt ataaaagtgg ctgacgacta ttactacgaa 420 atggacgtct ggggccaagg gaccgacgac tactcttacg ctatggacgt ctggggccaa 480 gggaccacgg tcaccgtctc ctcagcctcc accaagggcc catcggtctt ccccctggca 540 ccctcctcca agagcacctc tgggggcaca gcggccctgg gctgcctggt caaggactac 600 ttccccgaac cggtgacggt gtcgtggaac tcaggcgccc tgaccagcgg cgtgcacacc 660 ttcccggctg tcctacagtc ctcaggactc tactccctca gcagcgtggt gaccgtgccc 720 tccagcagct tgggcaccca gacctacatc tgcaacgtga atcacaagcc cagcaacacc 780 aaggtggaca agagagttga gcccaaatct tgtgacaaaa ctcacacatg cccaccgtgc 840 ccagcacctg aactcctggg gggaccgtca gtcttcctct tccccccaaa acccaaggac 900 accctcatga t 911 (NE13 VH) SEQ ID NO: 11 actgcacctc ggttctatcg attggctagc accatggaga cagacacact cctgctatgg 60 gtactgctgc tctgggttcc aggttccact ggtgacgagg ttcagctggt ggagtctggg 120 ggaggcctgg tcaagcctgg ggggtccctg agactctcct gtgtagcctc tggattcacc 180 ttcagttcct atagcatgaa ctgggtccgc caggctccag ggaaggggct ggagtgggtc 240 tcatccatta gtagtggtag tagttacata gagtacgcag actcagtgaa gggccgactc 300 accatctcca gagacaacgc caagaagtca ctgtatctgc aactgaacag cctgagagcc 360 gaggacacgg ctgtgtatta ctgtgcgaga cacacagctc gaatcgactc ttaccacggt 420 atggacgtct ggggccaagg gaccacagtc accgtctcct cagcctccac caagggccca 480 tcggtcttcc ccctggcacc ctcctccaag agcacctctg ggggcacagc ggccctgggc 540 tgcctggtca aggactactt ccccgaaccg gtgacggtgt cgtggaactc aggcgccctg 600 accagcggcg tgcacacctt cccggctgtc ctacagtcct caggactcta ctccctcagc 660 agcgtggtga ccgtgccctc cagcagcttg ggcacccaga cctacatctg caacgtgaat 720 cacaagccca gcaacaccaa ggtggacaag agagttgagc ccaaatcttg tgacaaaact 780 cacacatgcc caccgtgccc agcacctgaa ctcctggggg gaccgtcagt cttcctcttc 840 cccccaaaac ccaaggacac cctcatgatc tcccggaccc c 881 (12.1F VH) SEQ ID NO: 12 gtcactgcac ctcggttcta tcgattggct agcaccatgg agacagacac actcctgcta 60 tgggtactgc tgctctgggt tccaggttcc actggtgacc aggtgcagct gcaggagtcg 120 ggcgcaggac tgttgaagcc ttcggagacc ctgtccctca gttgcactgt cgatggtgag 180 tccttcaatg gtttcttctg gacgtggatc cgccagcccc cagggaaggg tctggagtgg 240 attggagaaa tcaatcatct tgcaagcacc ggctacaacc cgtccctcaa gagtcgagtc 300 accatttcag tagacacgtc caagaaccag ttctctttga agttgacctc tgtgaccgcc 360 gcggacacgg ctgtgtatta ctgtgcgaga ggatacagct atggttttgc atggcccaac 420 taccactatt tggacgtctg gggcaaaggg accacggtca ccgtctcctc agcctccacc 480 aagggcccat cggtcttccc cctggcaccc tcctccaaga gcacctctgg gggcacagcg 540 gccctgggct gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc gtggaactca 600 ggcgccctga ccagcggcgt gcacaccttc ccggctgtcc tacagtcctc aggactctac 660 tccctcagca gcgtggtgac cgtgccctcc agcagcttgg gcacccagac ctacatctgc 720 aacgtgaatc acaagcccag caacaccaag gtggacaaga gagttgagcc caaatcttgt 780 gacaaaactc acacatgccc accgtgccca gcacctgaac tcctgggggg accgtcagtc 840 ttcctcttnc ccccaaaacc caaggacacc ctcatgatct cccggacccc tgaggtcaca 900 tgcgtggtgg tggacgtgag c 921 (9.8A VH) SEQ ID NO: 13 ttctatcgat ttggctagca ccatggagac 9.8A agacacactc ctgctatggg tactgctgct 60 ctgggttcca ggttccactg gtgacgaggt gcagctggtg cagtctggag gacgcttggt 120 acagcctggg gggtccctga gactctcctg tgtagcctct ggattcacct ttagcagcca 180 tgccatgagc tgggtccgcc aggctccagg gaaggggctg gagtgggtct caggttttag 240 tggtagtagt ggtaccacaa agtacgcaga ctccgtgaag ggccggttca ccatctccag 300 agacaattcc aagaaaacgc tgtatctgca aatgaacagc ctgagagccg aggacacggc 360 cgtatattac tgtgcgaaag gcttctcccc atttcgggga gtacaattcc cctactttga 420 ctactggggc cagggaacgc tggtcaccgt ctcctcagcc tccaccaagg gcccatcggt 480 cttccccctg gcaccctcct ccaagagcac ctctgggggc acagcggccc tgggctgcct 540 ggtcaaggac tacttccccg aaccggtgac ggtgtcgtgg aactcaggcg ccctgaccag 600 cggcgtgcac accttcccgg ctgtcctaca gtcctcagga ctctactccc tcagcagcgt 660 ggtgaccgtg ccctccagca gcttgggcac ccagacctac atctgcaacg tgaatcacaa 720 gcccagcaac accaaggtgg acaagagagt tgagcccaaa tcttgtgaca aaactcacac 780 atgcccaccg tgcccagcac ctgaactcct ggggggaccg tcagtcttcc tcttcccccc 840 aaaacccagg acaccctcat gatctcccgg accc 874 (18.5C VH) SEQ ID NO: 14 gtccactgca cctcggttct atcgattggc tagcaccatg gagacagaca cactcctgct 60 atgggtactg ctgctctggg ttccaggttc cactggtgac gaggttcagc tggtggagtc 120 tgggggaggc ctggtcaggc cgggggggtc ccttagactc tcctgtgcag ccgctggatt 180 cactttcaag agttatagca tgaattgggt ccgccaggct ccagggaggg gcctggagtg 240 ggtctcatct atcactagtg gtggtagtaa gacatactat gcagacgtag tgaagggccg 300 attcaccgtc tccagagaca acgccaagca gtcgctctat ctgcaaatga acagcctgag 360 agccgaggac acggctatat acttctgtgc gagatcccta catagtacca gccagcctag 420 ctacatggac gtctggggca gaaagatcac ggtcatcgtc tcctcagcct ccaccaaggg 480 cccatcggtc ttccccctgg caccctcctc caagagcacc tctgggggca cagcggccct 540 gggctgcctg gtcaaggact acttccccga accggtgacg gtgtcgtgga actcaggcgc 600 cctgaccagc ggcgtgcaca ccttcccggc tgtcctacag tcctcaggac tctactccct 660 cagcagcgtg gtgaccgtgc cctccagcag cttgggcacc cagacctaca tctgcaacgt 720 gaatcacaag cccagcaaca ccaaggtgga caagagagtt gagcccaaat cttgtgacaa 780 aactcacaca tgcccaccgt gcccagcacc tgaactcctg gggggaccgt cagtcttcct 840 cttcccccca aaacccaagg acaccctcat gatctcccgg acccctgagg tcacatgc 898 (8.11G VH) SEQ ID NO: 15 tgcacctcgg ttctatcgat tggctagcac catggagaca gacacactcc tgctatgggt 60 actgctgctc tgggttccag gttccactgg tgaccaggtg cagctgcagg agtcgggtcc 120 aggactggtg aagccttcgg agaccctgtc cctcacctgc agtatttctg gtgtgtccac 180 cagaaattat tattggagct ggatccgcca gtccccaggg aagggactgg agtggattgg 240 atatatcttt aacattggga ccaccaacta caatccgtcc ctcaagagtc gactcaccat 300 atctgtagac acgtcgaaga accagttctc cctgaagatc acctctgtga ccgctgcgga 360 cacggccgtc tattactgtg cgagtggatt tgagtacggt gactatacct tcgactactg 420 gggccaggga accccggtca ccgtctcctc agcctccacc aagggcccat cggtcttccc 480 cctggcaccc tcctccaaga gcacctctgg gggcacagcg gccctgggct gcctggtcaa 540 ggactacttc cccgaaccgg tgacggtgtc gtggaactca ggcgccctga ccagcggcgt 600 gcacaccttc ccggctgtcc tacagtcctc aggactctac tccctcagca gcgtggtgac 660 cgtgccctcc agcagcttgg gcacccagac ctacatctgc aacgtgaatc acaagcccag 720 caacaccaag gtggacaaga gagttgagcc caaatcttgt gacaaaactc acacatgccc 780 accgtgccca gcacctgaac tcctgggggg accgtcagtc ttcctcttcc ccccaaaacc 840 caaggacacc ctcatgatct tccggacccc tgaggtcaca tgcgtggtgg tggacgtgag 900 cca 903 (25.10C VH) SEQ ID NO: 16 ctcggttcta tcgattggct agcaccatgg agacagacac actcctgcta tgggtactgc 60 tgctctgggt tccaggttcc actggtgacc aggtgcagct gcaggagtct gggggaggcc 120 tggtcaagcc tggggggtcc ctgagactct cctgtacagc ctctggattc aacttcaata 180 aatataacat gaactgggtc cgccaggctc cagggaaggg gctggagtgg gtctcatcca 240 ttagtgctct tagcacttac atctattatg cagactcgct gaagggccga ttcaccgtct 300 ccagagacaa cgccaagaac tcactgtttc tgcaaatgaa cagcctgaga gacgacgaca 360 cggctgttta ttactgtgcg agagaaatac gacgtgccag tacctggtcc gccgacctct 420 ggggccgtgg cactctggtc actgtctcct cagcctccac caagggccca tcggtcttcc 480 ccctggcacc ctcctccaag agcacctctg ggggcacagc ggccctgggc tgcctggtca 540 aggactactt ccccgaaccg gtgacggtgt cgtggaactc aggcgccctg accagcggcg 600 tgcacacctt cccggctgtc ctacagtcct caggactcta ctccctcagc agcgtggtga 660 ccgtgccctc cagcagcttg ggcacccaga cctacatctg caacgtgaat cacaagccca 720 gcaacaccaa ggtggacaag agagttgagc ccaaatcttg tgacaaaact cacacatgcc 780 caccgtgccc agcacctgaa ctcctggggg gaccgtcagt cttcctcttc cctccaaacc 840 caaggacacc ctcatgatct 860 (10.4B VL) SEQ ID NO: 17 agctgtgacc ggcgcctacc tgagatcacc ggtgctagca ccatggagac agacacactc 60 ctgctatggg tactgctgct ctgggttcca ggttccactg gtgacgaaat tgtgttgaca 120 cagtctccat cctcactgtc tgcgtctgta ggagacagag tcaccatcac ttgtcgggcg 180 agtcgggaca tcaatactta tttaggttgg tttcagcaga gaccagggaa agcccctaag 240 tccctgatct atggtgcatc taatttgcaa aatggggtcc catcaaggtt cagcggcagt 300 ggatctggga cgtattttac tctcaccatc aacggcctgc agactgaaga ctttgcgact 360 tattattgcc aacaatatag catctacccg ctcagtctcg gcggagggac caaggcggac 420 atgaagcgaa ctgtggctgc accatctgtc ttcatcttcc cgccatctga tgagcagttg 480 aaatctggaa ctgcctctgt tgtgtgcctg ctgaataact tctatcccag agaggccaaa 540 gtacagtgga aggtggataa cgccctccaa tcgggtaact cccaggagag tgtcacagag 600 caggacagca aggacagcac ctacagcctc agcagcaccc tgacgctgag caaagcagac 660 tacgagaaac acaaagtcta cgcctgcgaa gtcacccatc agggcctgag ctcgcc 716 (19.7E VL) SEQ ID NO: 18 tcagctgtga ccggcgccta cctgagatca ccggtgctag caccatggag acagacacac 60 tcctgctatg gctcctgctg ctctgggttc caggttccac tggtgacgaa attgtgttga 120 cacagtctcc ttccaccctg tctgcatctg tgggagacag agtcaccatc acttgccggg 180 ccagtcagag tattaataat tggttggcct ggtatcagga gaaaccaggg aaagccccta 240 agctcctgat aaataaggcg tctagtttag aaagtggggt cccatcaagg ttcagcggca 300 gtggatctgg gacagaattc actctcacca tcaccagcct gcagcctgat gattttgcaa 360 cttattactg ccaacaatat aatagtaatt cgtggacgtt cggccaaggg accaaggtgg 420 acatgaaacg aactgtggct gcaccatctg tcttcatctt cccgccatct gatgagcagt 480 tgaaatctgg aactgcctct gttgtgtgcc tgctgaataa cttctatccc agagaggcca 540 aagtacagtg gaaggtggat aacgccctcc aatcgggtaa ctcccaggag agtgtcacag 600 agcaggacag caaggacagc acctacagcc tcagcagcac cctgacgctg agcaaagcag 660 actacgagaa acacaaagtc tacgcctgcg aagtcaccca tcagggcctg agctcgcccg 720 tcacaaagag cttcaacagg ggagagtgtt agagggagct agctcgacat gataagatac 780 attgatgagt ttgggacaac cacaactaga atgcagtgaa aaaaatgctt tatttgtgaa 840 atttgtgatg ctattgcttt tattgtgaaa tttgtgatgc tattgcttta tttgtaacca 900 ttataa 906 (2.9D VL) SEQ ID NO: 19 actgcacctc ggttctatcg attggctagc accatgaaga cagacacact cctgctatgg 60 gtactgctgc tctgggttcc aggttccact ggtgacgaca ttgtgctgac ccagtctcca 120 gactccctgg ctgtgtctct gggcgagagg gccaccatca actgcaagtc cagccagagt 180 gttttataca gctccaacaa taagaactac ttagcttggt accagcagaa gccaggacag 240 cctcctaagc tgctcattta ctgggcatct acccgggaat ccggggtccc tgaccgattc 300 agtggcagcg ggtctgggac agatttcact ctcaccatca gcagcctgca ggctgaagat 360 gtggcagttt attactgtca gcaatattat agtactcctc cgacgttcgg ccaagggacc 420 aaggtggaaa tcaaacgaac tgtggctgca ccatctgtct tcatcttccc gccatctgat 480 gagcagttga aatctggaac tgcctctgtt gtgtgcctgc tgaataactt ctatcccaga 540 gaggccaaag tacagtggaa ggtggataac gccctccaat cgggtaactc ccaggagagt 600 gtcacagagc aggacagcaa ggacagcacc tacagcctca gcagcaccct gacgctgagc 660 aaagcagact acgagaaaca caaagtctac gcctgcgaag tcacccatca gggcctgagc 720 tcgcccgtca caaagagctt caacagggga gagtgttagg cggccgcaag cttggccgcc 780 atggcccaac ttgtttattg cagcttataa tggttacaaa taaagcaata gcatcacaaa 840 tttcacaaat aaagcatttt tttcactgca ttctagttgt ggtttgtcca actc 894 (25.6A VL) SEQ ID NO: 20 ctcggttcta tcgattggct agcaccatgg agacagacac actcctgcta tgggtactgc 60 tgctctgggt tccaggttcc actggtgacc tgcctgtgct gactcagcct gcctccgtgt 120 ctgggtctcc tggacagtcg atcaccatct cctgcactgg aaccagcagt gacgttggtg 180 cttataacta tgtctcctgg taccaacagc acccaggcaa agcccccaaa ctcataattt 240 atgaagtcaa gattcggccg tcaggggtgt ctaatcgttt ctctggctcc aagtctggca 300 acacggcctc cctgaccatc tctgggctcc aggctgagga cgaggctgat tatttttgca 360 gctcatattc aaccaacagc ccttgggtgt tcggcggagg gacgaaggtg accgtcctac 420 gtcagcccaa ggctgccccc tcggtcactc tgttcccacc ctcctctgag gagcttcaag 480 ccaacaaggc cacactggtg tgtctcataa gtgacttcta cccgggagcc gtgacagtgg 540 cctggaaggc agatagcagc cccgtcaagg cgggagtgga gaccaccaca ccctccaaac 600 aaagcaacaa caagtacgcg gccagcagct acctgagcct gacgcctgag cagtggaagt 660 cccacagaag ctacagctgc caggtcacgc atgaagggag caccgtggag aagacagtgg 720 cccctacaga atgttcatga gcggccgcaa gcttggccgc catggcccaa cttgtttatt 780 gcagcttata atggttacaa ataaagcaat agcatcacaa atttcacaaa taaagcattt 840 ttttcactgc attctagttg tggtttgtcc aaactcatca atgtatctta tcatgtctgg 900 atc 903 (36.1F VL) SEQ ID NO: 21 tccaggtcac tgcacctcgg ttctatcgat tggctagcac catggagaca gacacactcc 60 tgctatgggt actgctgctc tgggttccag gttccactgg tgacgaaatt gtgctgacac 120 agtctccagg caccctgtct ttgtctccag gggaaagagc caccctctcc tgcagggcca 180 gtcagagtgt tactaaaaac tacttagcct ggtaccagca gaaacctggc caggctccca 240 ccctcgtcat ctatgatgca tccaccaggg ccagtggcat cccagacagg ttcattggca 300 gtgggtctgg gacagacttc actctcacca tcagcagact ggagcctgaa gattttgcag 360 tatattactg ccaccagtat ggcagctcac ctccgtacac ttttggccgg gggaccaagc 420 tggagatcaa acgaactgtg gctgcaccat ctgtcttcat cttcccgcca tctgatgagc 480 agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat cccagagagg 540 ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag gagagtgtca 600 cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg ctgagcaaag 660 cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc ctgagctcgc 720 ccgtcacaaa gagcttcaac aggggagagt gttaggcggc cgcaagcttg gccgccatgg 780 cccaacttgt ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc 840 acaaataaag catttttttc actgcattct agttgtgggt tgtccaaact catcaatgta 900 (36.9F VL) SEQ ID NO: 22 aggtcactgc acctcggttc tatcgattgg ctagcaccat ggagacagac acactcctgc 60 tatgggtact gctgctctgg gttccaggtt ccactggtga cgacatcgtg atgacccagt 120 ctccagactc cctggctgtg tctctgggcg agagggccac catcaactgc aagtccagcc 180 agactgtttt gttcacctcc tattacgtag cttggtatca acaaaagcca gggcagccgc 240 ctaagttgct cttttccggg gcctcttctc gggaatccgg ggtccctgac cgattcagtg 300 ccggcgggtc tgggacagat ttctatctca ccatcaacag cctgcaggct gaagatgtgg 360 cagattacta ttgtcagcaa tatcatactc ctcctttcac tttcggcgga gggaccaagc 420 tggagatcag acgaactgtg gctgcaccat ctgtcttcat cttcccgcca tctgatgagc 480 agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa taacttctat cccagagagg 540 ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag gagagtgtca 600 cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg ctgagcaaag 660 cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc ctgagctcgc 720 ccgtcacaaa gagcttcaac aggggagagt gttaggcggc cgcaagcttg gccgccatgg 780 cccaacttgt ttattgcagc ttataatggt tacaaataaa gcaatagcat cacaaatttc 840 acaaataaag catttttttc actgcattct agttgtggtt tgtccaaact catcaatgta 900 tcttatcatg tctggatcgg ga 922 (37.2D VL) SEQ ID NO: 23 tcactgcacc tcggttctat cgattggcta gcaccatgga gacagacaca ctcctgctat 60 gggtactgct gctctgggtt ccaggttcca ctggtgacga aacgacactc acgcagtctc 120 cagccaccct gtctgtgtct ccaggggaaa cagccaccct ctcctgcagg gccagtcaaa 180 atgttatcaa caacttagcc tggtaccagc agaaacctgg ccaggctccc aggctcctca 240 tttatggtgc atccaccagg gccactggta tcccagccag gttcagtggc agtgggtctg 300 ggacagagtt cactctcacc atcagcagca tgcagtctga agattttgca gtttattact 360 gtcagcaata taatgactgg cctcgaagtt ttggccaggg gaccaggctg gacatcagac 420 gaactgtggc tgcaccatct gtcttcatct tcccgccatc tgatgagcag ttgaaatctg 480 gaactgcctc tgttgtgtgc ctgctgaata acttctatcc cagagaggcc aaagtacagt 540 ggaaggtgga taacgccctc caatcgggta actcccagga gagtgtcaca gagcaggaca 600 gcaaggacag cacctacagc ctcagcagca ccctgacgct gagcaaagca gactacgaga 660 aacacaaagt ctacgcctgc gaagtcaccc atcagggcct gagctcgccc gtcacaaaga 720 gcttcaacag gggagagtgt taggcggccg caagcttggc cgccatggcc caacttgttt 780 attgcagctt ataatggtta caaataaagc aatagcatca caaatttcac aaataaagca 840 tttttttcac tgcattct 858 (37.2G VL) SEQ ID NO: 24 tccaggtcac tgccctcggt tctatcgatt ggctagcacc atggagacag acacactcct 60 gctatgggta ctgctgctct gggttccagg ttccactggt gacgacattg tgctgaccca 120 gtctccaggc accctgtctt tgtctccagg ggaaagagcc accctctcct gcagggccag 180 tcagagtgtg aacagcatct tcttagcctg gtaccagcag aaacctggcc aggctcccag 240 gctcctcatc tatggtgcat ccagcagggc cactggcatc ccagacaggt tcagtggcag 300 tgggtctggg acagacttca ctctcaccat cagcagactg gagcctgagg attttgcagt 360 gtattactgt cagcagtatc atagctcacc taagctcact ttcggcggag ggaccaaggt 420 ggagatcaaa cgaactgtgg ctgcaccatc tgtcttcatc ttcccgccat ctggtgagca 480 gttgaaatct ggaactgcct ctgttgtgtg cctgctgaat aacttctatc ccagagaggc 540 caaagtacag tggaaggtgg ataacgccct ccaatcgggt aactcccagg agagtgtcac 600 agagcaggac agcaaggaca gcacctacag cctcagcagc accctgacgc tgagcaaagc 660 agactacgag aaacacaaag tctacgcctg cgaagtcacc catcagggcc tgagctcgcc 720 cgtcacaaag agcttcaaca ggggagagtg ttaggcggcc gcaagcttgg ccgccatggc 780 ccaacttgtt tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca 840 caaataaagc atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat 900 cttatcatgt ctggatcggg aattaattcg gcgcagcacc atggcctgaa ataacctc 958 (37.7H VL) SEQ ID NO: 25 tcactgcacc tcggttctat cgattggcta gcaccatgga gacagacaca ctcctgctat 60 gggtactgct gctctgggtt ccaggttcca ctggtgacca gtctgccctg actcagcctg 120 cctccgtgtc tgggtctcct ggacagtcga tcaccatctc ctgcactgga accggcagtg 180 acattggtgg ttataacttt gtctcctggt accaacagta tcccggcaaa gcccccaaac 240 tcattattta tgaggtccgt attcgggcct caggggtttc caatcgcttc tctggctcca 300 agtctggcaa cacggcctcc ctgaccatct ctggactcca ggctgaggac gaggctgatt 360 attactgcaa ctcatattca atccacagcc cttgggtgtt cggcggaggg accaagttga 420 ccgtcctgcg tcagcccaag gctgccccct cggtcactct gttcccaccc tcctctgagg 480 agcttcaagc caacaaggcc acactggtgt gtctcataag tgacttctac ccgggagccg 540 tgacagtggc ctggaaggca gatagcagcc ccgtcaaggc gggagtggag accaccacac 600 cctccaaaca aagcaacaac aagtacgcgg ccagcagcta cctgagcctg acgcctgagc 660 agtgggagtc ccacagaagc tacagctgcc aggtcacgca tgaagggagc accgtggaga 720 agacagtggc ccctacagaa tgttcatgag cggccgcaag cttggccgcc atggcccaac 780 ttgtttattg cagcttataa tggttacaaa taaagcaata gcatcacaaa tttcacaaat 840 aaagcatttt tttcactgca ttctagttgt ggtttgtcca aactcatcaa tgtatcttat 900 catgtctgga tcgggaatta attcggcgca gcaccatggc ctgaaatacc ctctgaaaga 960 ggaacttggt taggtacctt ctgaggcgga aagaaccatc tgtggaatgt gtgtc 1015 (8.9F VL) SEQ ID NO: 26 cactgccctc ggttctatcg attggctagc accatggaga cagacacact cctgctatgg 60 gtactgctgc tctgggttcc aggttccact ggtgaccagg cagggctgac tcagcctgcc 120 tccgtgtctg ggtctcctgg acagtcgatc accatctcct gcactgcagc caacagtgac 180 attggtgatt ttaactttgt ctcctggtac caacagcgcc cagacaaagc ccccaaactc 240 atggtttatg aggtcagcag tcggccctca ggggtttcta atcgcttctc tggctccaag 300 tctggcaaca cggcctccct gaccatctct gggctccagg ctgaggacga ggctgattat 360 tactgcacct catatacaag cagcagcact tttgtcttcg gaactgggac caaggtcacc 420 gtcctaggtc agcccaaggc caaccccact gtcactctgt tcccgccctc ctctgaggag 480 cttcaagcca acaaggccac actggtgtgt ctcataagtg acttctaccc gggagccgtg 540 acagtggcct ggaaggcaga tagcagcccc gtcaaggcgg gagtggagac caccacaccc 600 tccaaacaaa gcaacaacaa gtacgcggcc agcagctacc tgagcctgac gcctgagcag 660 tggaagtccc acagaagcta cagctgccag gtcacgcatg aagggagcac cgtggagaag 720 acagtggccc ctacagaatg ttcatgagcg gccgcaagct tggccgccat ggcccaactt 780 gtttattgca gcttataatg gttacaaata aagcaatagc atcacaaatt tcacaaataa 840 agcatttttt tcactgcatt ctagttgtgg tttgtccaaa ctcatcaatg tatcttatca 900 tgtctggatc 910 (NE13 VL) SEQ ID NO: 27 ctcccaggtc actgcacctc ggttctatcg attggctagc accatggaga cagacacact 60 cctgctatgg gtactgctgc tctgggttcc aggttccact ggtgacgaaa cgacactcac 120 gcagtctcca ggcaccctgt ctttgtctcc aggggaaaga gccaccctct cctgcagggc 180 cagtcagagt gttagcagca cctacttagc ctggtaccag cagaaacctg gccagtctcc 240 caggctcctc atttatggtg catccagtag ggccactggc atcccagaca ggttcagtgg 300 cagtgggtct gggacacagt tcactctcac catcaacaga ctggagcctg aagattttgc 360 agtgtattac tgtcagcagt ttggtagccc gtggacattc ggccaaggga ccaaggtgga 420 aatcaaacga actgtggctg caccatctgt cttcatcttc ccgccatctg atgagcagtt 480 gaaatctgga actgcctctg ttgtgtgcct gctgaataac ttctatccca gagaggccaa 540 agtacagtgg aaggtggata acgccctcca atcgggtaac tcccaggaga gtgtcacaga 600 gcaggacagc aaggacagca cctacagcct cagcagcacc ctgacgctga gcaaagcaga 660 ctacgagaaa cacaaagtct acgcctgcga agtcacccat cagggcctga gctcgcccgt 720 cacaaagagc ttcaacaggg gagagtgtta ggcggccgca agcttggccg ccatggccca 780 acttgtttat tgcagcttat aatggttaca aataaagcaa tagcatcaca aatttcacaa 840 ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc aatgtatctt 900 atcatgtc 908 (12.1F VL) SEQ ID NO: 28 gtcactgcac ctcggttcta tcgattggct agcaccatgg agacagacac actcctgcta 60 tgggtactgc tgctctgggt tccaggttcc actggtgacg aaacgacact cacgcagtct 120 ccagccaccc tgtctttgtc tccaggggag agagccaccc tctcctgtag ggccagtcag 180 agtgttagca gctacttagc ctggtaccaa cacaaacctg gccaggctcc caggctcctc 240 atctatggtg catcaaagag ggccactggc atcccgtcca ggttcagtgg cagtgggtct 300 gggacagact tcagtctcac catcagcagc ctagagcctg aagattttgc agtttactac 360 tgtcagcacc gaagcgactg gcggactacc ttcggccaag ggacacgact ggagattaaa 420 cgaactgtgg ctgcaccatc tgtcttcatc ttcccgccat ctgatgagca gttgaaatct 480 ggaactgcct ctgttgtgtg cctgctgaat aacttctatc ccagagaggc caaagtacag 540 tggaaggtgg ataacgccct ccaatcgggt aactcccagg agagtgtcac agagcaggac 600 agcaaggaca gcacctacag cctcagcagc accctgacgc tgagcaaagc agactacgag 660 aaacacaaag tctacgcctg cgaagtcacc catcagggcc tgagctcgcc cgtcacaaag 720 agcttcaaca ggggagagtg ttaggcggcc gcaagcttgg ccgccatggc ccaacttgtt 780 tattgcagct tataatggtt acaaataaag caatagcatc acaaatttca caaataaagc 840 atttttttca ctgcattcta gttgtggttt gtccaaactc atcaatgtat cttatcatgt 900 ctggatcggg aaattaatcg gcgcagcacc at 932 (9.8A VL) SEQ ID NO: 29 ggttctatcg attggctagc accatggaga cagacacact cctgctatgg gtactgctgc 60 tctgggttcc aggttccact ggtgacgaca tcgtgatgac ccagtctcct tccaccctgt 120 ctgcatctgt aggagacaga gtcaccatca cttgccgggc cagtcagagt attgataggt 180 ggttggcctg gtatcagcag aaaccaggga aagcccctaa gctcctgatc tatcaggcat 240 ctagtttaga aagaggggtc ccatcaaggt tcagcggcag tggatctggg acagaattca 300 ctctcaccat cagcagcctg cagcccgatg attttgcaac ttattactgc caacagtata 360 atggttaccc tctcactttc ggcggaggga ccaaggtgga gatcaaacga actgtggctg 420 caccatctgt cttcatcttc ccgccatctg atgagcagtt gaaatctgga actgcctctg 480 ttgtgtgcct gctgaataac ttctatccca gagaggccaa agtacagtgg aaggtggata 540 acgccctcca atcgggtaac tcccaggaga gtgtcacaga gcaggacagc aaggacagca 600 cctacagcct cagcagcacc ctgacgctga gcaaagcaga ctacgagaaa cacaaagtct 660 acgcctgcga agtcacccat cagggcctga gctcgcccgt cacaaagagc ttcaacaggg 720 gagagtgtta ggcggccgca agcttggccg ccatggccca acttgtttat tgcagcttat 780 aatggttaca aataaagcaa tagcatcaca aatttcacaa ataaagcatt tttttcactg 840 cattctagtt gtggtttgtc caaactcatc aatgtatctt atcatgtctg gatcg 895 (18.5C VL) SEQ ID NO: 30 tccaggtcca ctgcacctcg gttctatcga ttggctagca ccatggagac agacacactc 60 ctgctatggg tactgctgct ctgggttcca ggttccactg gtgacgacat ccagatgacc 120 cagtctccag gcaccctgtc tttgtctcca ggggaaagag ccaccctctc ctgcagggcc 180 agtcagagtg ttatcagtta ctacgtagcc tggtaccagc acaaaggtgg ccaggctccc 240 aggctcctca tttatggtgc atccagcagg gccactggcg tcccagacag gttcagtggc 300 agtgggtctg ggacagactt cactctcacc atcagcagcc tggagcctga agattttgca 360 ctgtattact gtcagtacta tgggagctca cctctgtggg cgttcggcca agggaccaag 420 gtggaaatca aacgaactgt ggctgcacca tctgtcttca tcttcccgcc atctgatgag 480 cagttgaaat ctggaactgc ctctgttgtg tgcctgctga ataacttcta tcccagagag 540 gccaaagtac agtggaaggt ggataacgcc ctccaatcgg gtaactccca ggagagtgtc 600 acagagcagg acagcaagga cagcacctac agcctcagca gcaccctgac gctgagcaaa 660 gcagactacg agaaacacaa agtctacgcc tgcgaagtca cccatcaggg cctgagctcg 720 cccgtcacaa agagcttcaa caggggagag tgttaggcgg ccgcaagctt ggccgccatg 780 gccc 784 (8.11G VL) SEQ ID NO: 31 cggttctatc gattggctag caccatggag acagacacac tcctgctatg ggtactgctg 60 ctctgggttc caggttccac tggtgacgaa attgtgctga ctcagtctcc agccaccctg 120 tctgtgtctc cagggggtag ggcctccctc tcctgccggg ccagtcagag tattggcgac 180 aagttatcct ggtatcagca gaaacctggg caggctccca ggctcgtcat ctatggtgca 240 tataccaggg ccactgatat ctcacccagg ttcagtggca gtaggtctgg gacagacttc 300 aatctcacca tcagcagaat gcagtctgga gactttgcag tttatttctg tcagcagtat 360 gaaaactggc ctcggacttt tggccagggg accaagctgg agatcaaacg aactgtggct 420 gcaccatctg tcttcatctt cccgccatct gatgagcagt tgaaatctgg aactgcctct 480 gttgtgtgcc tgctgaataa cttctatccc agagaggcca aagtacagtg gaaggtggat 540 aacgccctcc aatcgggtaa ctcccaggag agtgtcacag agcaggacag caaggacagc 600 acctacagcc tcagcagcac cctgacgctg agcaaagcag actacgagaa acacaaagtc 660 tacgcctgcg aagtcaccca tcagggcctg agctcgcccg tcacaaagag cttcaacagg 720 ggagagtgtt aggcggccgc aagcttggcc gccatggccc aacttgttta ttgcagctta 780 taatggttac aaataaagca atagcatcac aaatttcaca aataaagcat ttttttcact 840 gcatt 845 (25.10C VL) SEQ ID NO: 32 cctcggttct atcgattggc tagcaccatg gagacagaca cactcctgct atgggtactg 60 ctgctctggg ttccaggttc cactggtgac gacatccaga tgacccagtc tccatcctcc 120 ctgtctgcat ctgttggaga cagagtcatc atcacttgcc gggcaagtca gagcatcagc 180 agctctttaa attggtatca gcagaaacca gggaaagccc ctaagctcct gatctatgct 240 gcagtcaatt tggagactgg ggtcccgtca aggttcagtg gcagtggatt tgggacagat 300 ttcactctcg ccatcagcaa tgtgcaacct gaagattttg caacttacta ctgtcaacag 360 agcgatactc ggacttttgg ccgggggacc aagctggacg tcaaacgaac tgtggctgca 420 ccatctgtct tcatcttccc gccatctgat gagcagttga aatctggaac tgcctctgtt 480 gtgtgcctgc tgaataactt ctatcccaga gaggccaaag tacagtggaa ggtggataac 540 gccctccaat cgggtaactc ccaggagagt gtcacagagc aggacagcaa ggacagcacc 600 tacagcctca gcagcaccct gacgctgagc aaagcagact acgagaaaca caaagtctac 660 gcctgcgaag tcacccatca gggcctgagc tcgcccgtca caaagagctt caacagggga 720 gaagtgttag gcggccgcaa gcttggccgc catggcccaa cttgtttatt gcagcttata 780 atggttacaa ataaagcaat agcatcacaa atttcacaaa taaagcattt ttttcactgc 840 attctagttg tggtttgtcc aaactcatca atgtatctta tcatgtctgg atcgggaatt 900 - The VH and VL amino acid sequences of the antibodies and complementarity determining regions (CDR) of the VH and VL sequences are shown and discussed below.
-
(10.4B VH) SEQ ID NO: 33 METDTLLLWVLLLWVPGSTGDQVQLVQSGGGVVQPGRSLRVSCVISGFNF RAYGMHWVRQIPGKGLEWVADIWSAETNRHYADSVKGRFTISRDNSKSTL YLQMNSIRAEDIGVYFCAKARPGYDYVVDLWGQGTLVIVSSASTKGPSVF PLAPCSRSTSGGTAPLLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGL (19.7E VH) SEQ ID NO: 34 METDTLLLWVLLLWVPGSTGDEVQLVESGGGIVRPGGSLRLSCAASGYSF ESYSMHWVREVPGKGINWVSYINSDGSTKIYADSVKGRFSISRDNAKNKL YLQMDSLRVEDTAVYSCVRLVHYDWSPFVWGQGTLVTVSSASTKGPSVFP LAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPQSCDKTHTCP PCPAPELL (2.9D VH) SEQ ID NO: 35 METDTLLLWVLLLWVPGSTGDEVQLVESGGGLVKPGGSLRLSCAASGFTF TRFTLTWVRQAPGKGLEWVSSISSGSSDINYADSVKGRFTISRDNARNSL FLQMSSLRVDDTAVYYCAKDPRSGISGRYGMDVWGQGTTVIVSSASTKGP SVFPLAPCSRSTSGGIAALGCLVKDYFPEPVTVEWNSGALTSGVHTYPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRIPEVTCVVVDVS (25.6A VH) SEQ ID NO: 36 METDTLLLWVLLLWVPGSTGDQVQLQESGGGLVKAGGSLRLSCAASGFMF ERYSLHWVRQTPGKGLEWVSSISSLSGSHINYADSVKGRFTISRDNAKNS LSLQMNSLBVEDTAIYYCARDRRSGSSPVPLDVWGQGTTVTVSSASTKGP SVFPLAPSSKSTSGGTAALGC (36.1F VH) SEQ ID NO: 37 METDTLLLWVLLLWVPGSTGDQVQLQESGAGIVKPSETLSLTCAVSGGPF SGAYWTWIRQTPGKGLEWIGEAGRSGTTNYNPSLKSRVTISLDISKSQFS LKLTSVTAADTAVYFCGRRQIMSLSNLYKRPVDSWGRGTPVIVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTYPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK THTCPPCPAPELLGGPSVFLFPPX (36.9F VH) SEQ ID NO: 38 METDTLLLTWVLLLWVPGSTGDEVQLVQSGGGLVKAGGSLKLSCGASGFT FSSYSMSWVRQAPGKGLEWVSYISSGGSSIHYADSVKGRFTISRDNAKNS LYLQMKNLRVDDTGRYYCVRDPRSGISGRYGMDVWGQGTTVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVETFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK THTCPPCDAPELLGGPSVFLPPNPRTPS*S (37.2D VH) SEQ ID NO: 39 METDTLLLWVLLLWVPGSTGDEVQLVQSGAEVKKPGASVKVSCKASGYTF TKYGISWVRQAPGQGLEWMGWISAFNGYTRYGQRFQGKVTMTTDTSTNTA SLEVRTLTSNDTAVYYCARQYPDQYSSSGWPRIFAMDVWGQGTTVIVSPA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVEWNSGALTSGVH TFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SCDKTHTCPPCPAPELLGGPSVFLF (37.2G VH) SEQ ID NO: 40 METDTLLLWVLLLWVPGSTGDEVQLVESGGGLVKPGGSRRLSCAASGFTF SRDTMTWVRQAPGKGLEWVASISSGSSDINYADSVKGRFTISRDNGKNSL YLHMNSLRADDTAIYYCARDPRSGISGRYGMDVWGQGTTVTVSSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGV (37.7H VH) SEQ ID NO: 41 METDTLLLWVLLLWVPGSTGDEVQLVQSGGGLVKAGGSLRLSCAASGFTF STYSMNWIRQAPGKGLEWVASISSRSGSHINYVDSVKGRFTISRDNARDL LYLQMNSLRVDDSALYYCARDRRSGTSPLPLDVWGQGTTVTVFSASTKGP SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKT HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE (8.9F VH) SEQ ID NO: 42 METDTLLLWVLLLWVPGSTGDQGTLRESGPGLVRPSETLSLTCGVSGYSI SSGYYNGWIRQPPGKGLEWIGNIYRSGSTYYNPSLKERVTVSIDTSKNQF SLKLNSVTAADTAVYYCARSGIKVADDYYYEMDVWGQGTDDYSYAMDVWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYETEPVTVSW NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN TKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMX (NE13 VH) SEQ ID NO: 43 METDTLLLWVLLLWVPGSTGDEVQLVESGGGLVKPGGSLRLSCVASGFTF SSYSMNWVRQAPGKGLEWVSSISSGSSYIEYADSVKGRLTISRDNAKKSL YLQLNSLRAEDTAVYYCARHTARIDSYHGMDVWGQGTTVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNIKVDKRVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP (12.1F VH) SEQ ID NO: 44 METDTLLLWVLLLWVPGSTGDQVQLQESGAGLLKPSETLSLSCTVDGESF NGFFWTWIRQPPGKGLEWIGEINHLASTGYNPSLKSRVTISVDTSKNQFS LKLTSVTAADTAVYYCARGYSYCFAWPNYHYLDVWGKGTTVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYYPEPVTVWNSGALTSGVHTFPAV ILQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK THTCPPCPAPELLGGPSVFLXDPKPKDTLMISRTPEVTCVVVDVS (9.8A VH) SEQ ID NO: 45 METDTDLLLWVLLLWVPGSTGDEVQLVQSGGRLVQPGGSLRLSCVASGFT FSSHAMSWVRQAPGKGLEWVSGFSGSSGTIKYADSVKGRFTISRDNSKKT LYLQMNSLRAEDTAVYYCAKGFSPFRGVQFPYFDYWGQGTLVTVSSASTK GPSVFPLAPSSKSTSGGTAALGCLVKDYTPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD KTHTCPPCPAPELLGGPSVFLFDPKPRIPS*SPGP (18.5C VH) SEQ ID NO: 46 METDTMLLWVLLLWVPGSTGDRVQLVESGGCLVRPGGSLRLSCAAAGFTF KSYSMNWVRQAPGRGLEWVSSITSGGSKTYYADVVKGRFTVSRDNAKQSL YLQMNSLRAEDTAIYFCARSLHSTSQPSYMDVWGRKITVIVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPRVTC (8.11G VH) SEQ ID NO: 47 METDTLLLWVLLLWVPGSTGDQVQLQESGPGLVKPSETLSLTCSISGVST RNYYWSWIRQSPGKGLEWIGYIFNIGTTNYNPSLKSRLTISVDTSKNQFS LKITSVTAADTAVYYCASGFEYGDYTFDYWGQGTPVTVSSASTKGPSVET LAPSSKSTSGGTAALGCLVKDYFPEPVTVEWNSGALTSGVHTYPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMIFRTPEVTCVVVDVS (25.10C VH) SEQ ID NO: 48 METDTLLLWVLLLWVPGSTGDTQLQESGGGLVKPGGSLRLSCTASGFNFN KYNKNWVRQAPGKGLEWVSSISALSTYIYYADSLKGRFTVSRDNAKNSLF LQMNSLRDDDTAVYYCAREIRRASTWSADLWGRGTLVTVSSASTKGPSVF PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTC PPCPAPELLGGPSVFLFPPNPRTPS (10.4B VL) SEQ ID NO: 49 METDTLLLWVLLLWVPGSTGDEIVLTQSPSSLSASVGDRVTITCRASRDI NTYLGWFQQRPGKAPKSLIYGASNLQNGVPSRFSGSGSGTYFTLTINGLQ TEDFATYYCQQYSIYPLSLGGGTKADMKRTVAAPSVFIFPPSDEQLKEGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYFKHKVYACEVTHQGLSSP (19.7E VL) SEQ ID NO: 50 METDTLLLWLLLLWVPGSTGDEIVLTQPSTLSASVGDRVTITCRASQSIN NWLAWYQEKPGKAPKLLINKASSLESGVPSRFSGSGSGTEFTLTITSLQP DDFATYYCQQYNSNSWTFGQGTKVDMKRTVAAPSVFIFPPSDEQLKSGTA SVVCLLNNFYPREAKVQWKVDNALQSGNESQESVTEQSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (2.9D VL) SEQ ID NO: 51 MKTDTLLLWVLLLWVPGSTGDDIVLTQSPDSLAVSLGERATINCKSSQSV LYSSNNKNYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTL TISSLQAEDVAVYYCQQYYSTPPTFGQGTKVEIKRTVAAPSVFIFPPSDE QLKSGTASVVCLLNNTYPREAKVQWKVDNALQSGNSQESVTFQDSKDSTY SLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (25.6A VL) SEQ ID NO: 52 METDTLLLWVLLLWVPGSTGDLPVLTQPASVSGSPGQSITISCTGTSSDV GAYNYVSWYQQHPGKAPKLIIYEVKIRPSGVSNRFSGSKSGNTASLTISG LQAEDEADYFCSSYSTNSPWVFCGGTKVTVLRQPKAAPSVTLFPPSSEEL QANKATLVCLISDFYPCAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS* (36.1F VL) SEQ ID NO: 53 METDTLLLWVLLLWVPGSTGDEIVLTQSPGTLSLSPGERATLSCRASQSV TKNYLAWYQQKPGQAPTLVIYDASTRASGIPDRFIGSGSGTDFTLTISRL EPEDFAVYYCHQYGSSPPYTFGRGTKLEIKRTVAAPSVFIFPPSDEQLKS GTASVVCLLNNEYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (36.9F VL) SEQ ID NO: 54 METDTLLLWVLLLWVPGSTGDDIVMTQSPDSLAVSLGERATINCKSSQTV LFTSYYVAWYQQKPGQPPKLLFSGASSRESGVPDRESAGGSGTDFYLTIN SLQAEDVADYYCQQYHTPPFTFGGGTKLEIRRTVAAPSVFIFPPSDEQLK SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLS SILTLSKADYEKHKVYACEVTHQGLSSPVTKEFNRGEC* (37.2D VL) SEQ ID NO: 55 METDTLLLWVLLLWVPGSTGDETTLTQSPATLSVSPGETATISCRASQNV INNLAWYQQKPGQAPRLLIYGASTRATGIPARFSGSGSGTEFTLTISSMQ SEDFAVYYCQQYNDWPRSFGQGTRLDIRRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNEYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (37.2G VL) SEQ ID NO: 56 METDTLLLWLLLWVPGSTGDDIVLTQSPGTLSLSPGERATLSCRASQSVN SIFLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLE PEDFAVYYCQQYHSSPKLTFGGGTKVEIKRTVAAPSVFIFPPSGEQLKSG TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (37.7H VL) SEQ ID NO: 57 METDTLLLWVLLLWVPGSTGDQSALTQPASVSGSPGQSITISCTGTGSDI GGYNFVSWYQQYPGKAPKLIIYEVRIRASGVSNRFSGSKSGNTASLTISG LQAEDEADYYCNSYSIHSPWVFGGGTKLTVLRQPKAAPSVTLFPPSSEEL QANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWESHRSYSCQVTHEGSTVEKTVAPTECS* (8.9F VL) SEQ ID NO: 58 METDTLLLWVLLLWVPGSTGDQAGLTQPASVSGSPGQSITISCTAANSDI GDFNFVSWYQQRPDKAPKLMVYEVSSRPSGVSNRFSGSKSGNTASLTISG LQAEDEADYYCTSYTSSSTFVFGTGTKVTVLGQPKANPTVTLFPPSSEEL QANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAAS SYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS* (NE13 VL) SEQ ID NO: 59 TMETDTLLLWVLLLWVPGSTGDETTLTQSPGTLSLSPGERATLSCRASQS VSSTYLAWYQQKPGQSPRLLIYGASSRATGIPDRFSGSGSGTQFTLTINR LEPEDFAVYYCQQFGSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSG TASVVCLLNNEYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (12.1F VL) SEQ ID NO: 60 METDTLLLWVLLLWVPGSTGDETTLTQSPATLSLSPGERATLSCRASQSV SSYLAWYQHKPGQAPRLLIYGASKRATGIPSRFSGSGSGTDFSLTISSLE PEDFAVYYCQHRSDWRTTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFKRGEC* (9.8A VL) SEQ ID NO: 61 METDTLLLWVLLLWVPGSTGDDIVMTQSPSTLSASVGDRVTITCRASQSI DRWLAWYQQKPGKAPKLLIYQASSLERGVPSRFSGSGSGTEFTLTISSLQ PDDFATYYCQQYNGYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSEFRGEC* (18.5C VL) SEQ ID NO: 62 METDTLLLWVLLLWVPGSTGDDIQMTQSPGTLSLSPGERATLSCRASQSV ISYYVAWYQHKGGQAPRLLIYGASSRATGVPDRFSGSGSGTDFTLTISSL EPEDFALYYCQYYGSSPLWAFGQGTKVEIKRTVAAPSVFIFPPSDEQLKS GTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESV7EQDSKD5TYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (8.11G VL) SEQ ID NO: 63 METDTLLLWVLLLWVPGSTGDEIVLTQSPATLSVSPGGRASLSCRASQSI GDKLSWYQQKPGQAPRLVIYGAYTRATDISPRFSGSRSGTDFNLTISRMQ SGDFAVYFCQQYENWPRTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGT ASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* (25.10C VL) SEQ ID NO: 64 METDTLLLWVLLLWVPGSTGDDIQMTQSPSSLSASVGDRVIITCRASQSI SSSLNWYQQKPGKAPKLLIYAAVNLETGVPSRFSGSGFGTDFTLAISNVQ PEDFATTYCQQSDTRTFGRGTKLDVKRTVAAPSVFIFPPSDEQLKSGTAS VVCLLNNFYPREAKVQWKVDNAIQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVIKSENRGEVLGGRKLGBEGPTCLLQL TMVTNKAIASQISQIKHFFHCILVVVCPNSSMYLIMSGSGI -
FIG. 7 provides a sequence alignment prepared using CLUSTAL OMEGA™ (1.2.4) multiple sequence alignment (from EMBL-EBI, a part of the European Molecular Biology Laboratory) for the heavy chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with {circumflex over ( )}), and CDR3 (marked with #). -
FIG. 8 provides a sequence alignment prepared using CLUSTAL OMEGA™ (1.2.4) multiple sequence alignment for the light chain variable region amino acid sequences, with CDRs highlighted in bold typeface: CDR1 (marked with +), CDR 2 (marked with {circumflex over ( )}), and CDR3 (marked with #). - The HC CDR Sequence Table below lists the sequences of CDR1,
CDR 2, and CDR3 of the VH of each of the 16 neutralizing antibodies described herein. The LC CDR Sequence Table below lists the sequences of CDR1,CDR 2, and CDR3 of the VL of each of the 16 neutralizing antibodies described herein. -
HC CDR Sequence Table. Antibody HC CDR1 HC CDR2 HC CDR3 10.4B GFNFRAYG IWSAETNRH AKARPGYDYVVDL (SEQ ID NO: 65) (SEQ ID NO: 66) (SEQ ID NO: 67) 19.7E GFSFSSYS INSDGSTKI VRLVHYDWSPFV (SEQ ID NO: 68) (SEQ ID NO: 69) (SEQ ID NO: 70) 2.9D GFTFTRFT ISSGSSDIN AKDPRSGISGRYGMDV (SEQ ID NO: 71) (SEQ ID NO: 72) (SEQ ID NO: 73) 25.6A GFMFERYS ISSLSGSHIN ARDRRSGSSPVPLDV (SEQ ID NO: 74) (SEQ ID NO: 75) (SEQ ID NO: 76) 36.1F GGPFSGAY AGRSGTTN GRRQIMSLSNLYKRPVDS (SEQ ID NO: 77) (SEQ ID NO: 78) (SEQ ID NO: 79) 36.9F GFTFSSYS ISSGGSSIH VRDPRSGISGRYGMDV (SEQ ID NO: 80) (SEQ ID NO: 81) (SEQ ID NO: 82) 37.2D GYTFTKYG ISAFNGYTR ARQYPDQYSSSGWPRLFA (SEQ ID NO: 83) (SEQ ID NO: 84) MDV (SEQ ID NO: 85) 37.2G GFTFSRDT ISSGSSDIN ARDPRSGISGRYGMDV (SEQ ID NO: 86) (SEQ ID NO: 87) (SEQ ID NO: 88) 37.7H GFTFSTYS ISSRSGSHIN ARDRRSGTSPLPLDV (SEQ ID NO: 89) (SEQ ID NO: 90) (SEQ ID NO: 91) 8.9F GYSISSGYY IYRSGSTY ARSGIKVADDYYYEMDVW (SEQ ID NO: 92) (SEQ ID NO: 93) GQGTDDYSYAMDV (SEQ ID NO: 94) NE13 GFTFSSYS ISSGSSYIE ARHTARIDSYHGMDV (SEQ ID NO: 95) (SEQ ID NO: 96) (SEQ ID NO: 97) 12.1F GESFNGFF INHLASTG ARGYSYGFAWPNYHYLDV (SEQ ID NO: 98) (SEQ ID NO: 99) (SEQ ID NO: 100) 9.8A GFTFSSHA FSGSSGTTK AKGFSPFRGVQFPYFDY (SEQ ID NO: 101) (SEQ ID NO: 102) (SEQ ID NO: 103) 18.5C GFTFKSYS ITSGGSKTY ARSLHSTSQPSYMDV (SEQ ID NO: 104) (SEQ ID NO: 105) (SEQ ID NO: 106) 8.11G GVSTRNYY IFNIGTTN ASGFEYGDYTFDY (SEQ ID NO: 107) (SEQ ID NO: 108) (SEQ ID NO: 109) 25.10C GFNFNKYN ISALSTYIY AREIRRASTWSADL (SEQ ID NO: 110) (SEQ ID NO: 111) (SEQ ID NO: 112) LC CDR Sequence Table. Antibody LC CDR1 LC CDR2 LC CDR3 10.4B RDINTY GAS QQYSIYPLS (SEQ ID NO: 113) (SEQ ID NO: 114) 19.7E QSINNW KAS QQYNSNSWT (SEQ ID NO: 115) (SEQ ID NO: 116) 2.9D QSVLYSSNNKNY WAS QQYYSTPPT (SEQ ID NO: 117) (SEQ ID NO: 118 25.6A SSDVGAYNY EVK SSYSTNSPWV (SEQ ID NO: 119) (SEQ ID NO: 120) 36.1F QSVTKNY DAS HQYGSSPPYT (SEQ ID NO: 121) (SEQ ID NO: 122) 36.9F QTVLFTSYY GAS QQYHTPPFT (SEQ ID NO: 123) (SEQ ID NO: 124) 37.2D QNVINN GAS QQYNDWPRS (SEQ ID NO: 125) (SEQ ID NO: 126) 37.2G QSVNSIF GAS QQYHSSPKLT (SEQ ID NO: 127 (SEQ ID NO: 128) 37.7H GSDIGGYNF EVR NSYSIHSPWV (SEQ ID NO: 129) (SEQ ID NO: 130) 8.9F NSDIGDFNF EVS TSYTSSSTFV (SEQ ID NO: 131) (SEQ ID NO: 132) NE13 QSVSSTY GAS QQFGSPWT (SEQ ID NO: 133) (SEQ ID NO: 134) 12.1F QSVSSY GAS QHRSDWRTT (SEQ ID NO: 135) (SEQ ID NO: 136) 9.8A QSIDRW QAS QQYNGYPLT (SEQ ID NO: 137) (SEQ ID NO: 138) 18.5C QSVISYY GAS QYYGSSPLWA (SEQ ID NO: 139) (SEQ ID NO: 140) 8.11G QSIGDK GAY QQYENWPRT (SEQ ID NO: 141) (SEQ ID NO: 142) 25.10C QSISSS AAV QQSDTRT (SEQ ID NO: 143) (SEQ ID NO: 144) - The antibodies described herein may be used in a variety of immunoassays for LASV, LCMV, and other arenaviruses. The antibodies of the invention can be produced with high quality control and are suitable as reagents for the purposes of detecting antigen in biological samples. By way of example and not limitation, antibodies of the invention could be used as reagents in an ELISA assay to detect Lassa antigen in a biological sample from a subject. The antibodies can be labeled, e.g., bound to a detectable labelling group such as a fluorescent dye, a quantum dot label, R-phycoerythrin, streptavidin, biotin, an enzyme, a radioiosotope, and the like. Such labelling techniques are well known in the antibody art.
- Vaccines for LASV, LCMV, and other arenaviruses also are described herein. In one aspect the vaccines are DNA-based vaccines. One skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein in vivo. See, e.g., U.S. Pat. Nos. 6,436,908; 6,413,942; and 6,376,471. Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art and non-limiting examples are described herein.
- Administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration. Targeted delivery of therapeutic compositions containing an expression vector or subgenomic polynucleotides can also be used. Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol. (1993) 11:202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J. A. Wolff, ed.) (1994); Wu et al., J. Biol. Chem. (1988) 263:621; Wu et al., J. Biol. Chem. (1994) 269:542; Zenke et al., Proc. Natl. Acad. Sci. USA (1990) 87:3655; Wu et al., J. Biol. Chem. (1991) 266:338.
- Non-viral delivery vehicles and methods can also be employed, including but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Cunel, Hum. Gene Ther. (1992) 3:147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem. (1989) 264:16985); eukaryotic cell delivery vehicles (see, e.g., U.S. Pat. No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338); and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed. Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859. Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796, WO 94/23697, WO 9 1/14445; and EP 0524968. Additional approaches are described in Philip, Mol. Cell Biol. (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci. (1994) 91:1581.
- For human administration, the codons comprising the polynucleotide encoding one or more antibodies specific for LASV glycoprotein and/or LCMV glycoprotein may be optimized for human use, a process that is standard in the art.
- In another aspect, one or more antibodies specific to LASV and/or LCMV or combinations thereof is used as a vaccine. The one or more antibodies or combination thereof may be administered by itself or in combination with an adjuvant. Examples of adjuvants include, but are not limited to, aluminum salts, water-in-soil emulsions, oil-in-water emulsions, saponin, QuilA and derivatives, iscoms, liposomes, cytokines including gamma-interferon or interleukin 12, DNA (e.g. unmethylated poly-CpG), microencapsulation in a solid or semi-solid particle, Freunds complete and incomplete adjuvant or active ingredients thereof including muramyl dipeptide and analogues, DEAE dextrarilmineral oil, Alhydrogel, Auspharm adjuvant, and Algammulin.
- The antibody vaccine comprising one or more antibodies specific to LASV and/or LCMV or combinations thereof can be administered orally or by any parenteral route such as intravenously, subcutaneously, intraarterially, intramuscularly, intracardially, intraspinally, intrathoracically, intraperitoneally, intraventricularly, sublingually, and/or transdermally.
- Dosage and schedule of administration can be determined by methods known in the art. Efficacy of the one or more antibodies specific to LASV and/or LCMV or combinations thereof as a vaccine for Lassa virus, lymphocytic choriomeningitis virus, or related arenaviruses may also be evaluated by methods known in the art.
- The polynucleotides, polypeptides, and antibodies described herein can further comprise pharmaceutically acceptable carriers, excipients, or stabilizers known in the art (Remington: The Science and practice of Pharmacy 20th Ed., 2000, Lippincott Williams and Wilkins, Ed. K. E. Hoover), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the employed dosages and concentrations, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (e.g. octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl or benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, marmose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG). Pharmaceutically acceptable excipients are further described herein.
- The compositions used in the methods described herein generally comprise, by way of example and not limitation, an effective amount of a polynucleotide or polypeptide (e.g., an amount sufficient to induce an immune response) of the invention or antibody of the invention (e.g., an amount of a neutralizing antibody sufficient to mitigate infection, alleviate a symptom of infection and/or prevent infection).
- The pharmaceutical composition can further comprise additional agents that serve to enhance and/or complement the desired effect. By way of example, to enhance the efficacy of the one or more antibodies specific to LASV and/or LCMV or combinations thereof administered as a pharmaceutical composition, the pharmaceutical composition may further comprise an adjuvant. Examples of adjuvants are provided herein.
- Also by way of example and not limitation, if the one or more antibodies specific to LASV and/or LCMV or combinations thereof of the invention is being administered to augment the immune response in a subject infected with or suspected of being infected with LASV or LCMV and/or if antibodies of the present invention are being administered as a form of passive immunotherapy, the composition can further comprise other therapeutic agents (e.g., anti-viral agents).
- Kits for use in the instant methods also are described. Kits include one or more containers comprising by way of example, and not limitation, polynucleotides encoding one or more antibodies specific to LASV and/or LCMV or combinations thereof or fragments thereof of the invention and instructions for use in accordance with any of the methods of the invention described herein. In some embodiments of the kit, the antibodies are bound to a detectable label as discussed above.
- Generally, instructions comprise a description of administration or instructions for performance of an assay. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- The kits are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump. A kit may have a sterile access port (e.g. the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (e.g. the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container.
- The following non-limiting examples are provided to illustrate certain aspects and features of the materials and methods described herein.
- Both host and viral factors, as well as route of infection and dose of virus influence the outcome of LCMV infection of the mouse. Thus, intravenous (i.v.) inoculation of adult immune competent mice with LCMV Armstrong (ARM) strain results in an acute infection that induces a protective immune response that mediates virus clearance in 10 to 14 days, a process predominantly mediated by virus-specific CD8+ cytotoxic T lymphocytes (CTL). In contrast, i.v. inoculation with a high dose of the immunosuppressive clone 13 (C1-13) strain of LCMV causes a persistent infection associated with sustained viremia and generalized immune suppression that can last for 60 to 100 days. This model is robust and has clear outcomes, which provide a valid and cost effective experimental system for initial evaluation of the efficacy of antibody-based strategies to control and clear a LCMV infection. In this regard, the use of C1-13 based recombinant viruses expressing GPs of interest allows assessment of the safety and in vivo neutralizing activity of GP-specific BNmMAbs. This approach is feasible using state-of-the-art arenavirus reverse genetics that allows rescue of infectious recombinant LCM viruses with predetermined mutations of interest, as well as expressing heterologous either viral or non-viral genes of interest. A single-cycle infectious, reporter expressing, recombinant LCMV in which the GP ORF is replaced by GFP (rLCMVΔGP/GFP) was generated. Genetic complementation with plasmids or stable cell lines expressing arenavirus GPs of interest produces the corresponding GP-pseudotyped rLCMVΔGP/GFP that can be used to evaluate antibody responses to HF arenaviruses using a BSL2 platform.
- Generation of LASV GP-specific hMAbs: Peripheral blood mononuclear cells (PBMCs) isolated from 17 different LF survivors in Sierra Leone and Nigeria were used to identify B cell clones producing specific IgG to LASV GP. RNA from these B cell clones was used to clone the light chain (LC) and heavy chain (HC) genes. Paired LC and HC were expressed in human 293T cells to generate a collection of 120 LASV GP-specific hMAbs. These hMAbs arose from different germline genes and were likely independently derived. All but one (8.9F) of the hMAbs reacted in ELISA with GP from Josiah strain of LASV (lineage IV), which is closely related to the currently circulating LASV strains in Sierra Leone. LASV GP consists of a SSP and GP1 and GP2 subunits, as shown in
FIG. 1 , Panels A and B. To define the GP subunits recognized by the LASV hMAbs, an immunofluorescence assay was used to test the recognition by hMAbs of human 293T cells expressing either rGP1 or rGP2 alone, or full-length GP, shown inFIG. 1 , Panel C. Twenty-nine hMAbs, including three with neutralizing activity, reacted with LASV rGP1, shown byFIG. 1 , Panel C, left and Table 1. Fifty-seven hMAbs recognized LASV rGP2 but none of these exhibited neutralizing activity, as shown byFIG. 1 , Panel C, middle and Table 1. Seven hMAbs reacted with peptides representing three linear epitopes in GP2, whereas the remaining hMAbs appeared to recognize conformational epitopes. Twenty-seven hMAbs reacted with cells expressing full-length GP but did not react with either rGP1 or rGP2 expressed individually. Remarkably, thirteen of these hMAbs were neutralizing, as shown byFIG. 1 , Panel C, right and Table 1. Inhibitory concentration 50 (IC50) and 80 (IC80) neutralizing activity of LASV GP-specific hMAbs was evaluated using lentivirus particles pseudotyped with the different lineage I-IV LASV GPs. Results are shown in Table 1. Based on the data in Table 1, the antibodies can be classified as most potent (hMAbs exhibiting IC values of <1 μg/mL); potent (hMAbs exhibiting IC values in the range of 1 to 2.5 μg/mL), weak (hMAbs exhibiting IC values of >3 and <20 μg/mL); non-neutralizing (hMAbs exhibiting IC values >20 μg/mL). -
TABLE 1 Neutralizing activity of LASV GP-specific hMAbs against LASV lineages I-IV. LASV Josiah (IV) LASV 237 (III) LASV A19 (II) LASV Pinneo (I) Mab IC50 IC80 IC50 IC80 IC50 IC80 IC50 IC80 25.10C 0.094 0.174 0.058 0.180 0.104 0.364 0.226 0.564 12.1F 0.158 0.562 0.146 0.458 0.463 2.266 0.285 0.692 8.9F 0.126 1.604 0.182 3.097 0.125 0.467 0.403 2.210 37.2D 0.559 1.983 0.256 0.844 0.469 1.154 0.537 1.861 37.7H 0.191 0.532 0.077 0.202 0.255 0.537 0.301 1.658 25.6A 0.743 1.999 0.169 0.603 0.483 3.509 1.826 3.114 9.8A 1.309 2.423 0.193 0.494 0.150 0.527 1.003 2.587 18.5C 1.935 3.985 0.621 3.231 1.200 4.633 6.111 12.170 8.11G 0.361 1.736 1.166 3.637 1.481 4.591 3.245 10.540 37.2G 5.599 16.000 2.020 5.231 1.100 10.000 >20 >20 2.9D 6.895 16.700 1.582 5.511 3.072 14.780 10.130 >20 NE13 10.690 19.500 2.136 7.000 5.409 13.180 >20 >20 19.7E 5.908 >20 1.062 15.000 >20 >20 1.558 3.273 36.9F 18.000 >20 4.687 19.350 13.000 >20 6.984 >20 36.1F 0.248 0.755 >20 >20 >20 >20 >20 >20 10.4B >20 >20 >20 >20 >20 >20 >20 >20 - Neutralizing properties of LASV GP-specific hMAbs: The neutralizing properties of the LASV GP-specific hMAbs were evaluated using envelope-deficient core HIV-1 pseudotyped with LASV GP (LASVpp) (shown in Table 1) and standard plaque reduction neutralization test (PRNT) with authentic LASV. Fifteen of the 120 hMAbs neutralized LASVpp expressing GP from Josiah strain of LASV lineage IV, as shown in Table 1. These neutralizing GP-specific hMAbs were also tested against LASVpp containing GP of the three other LASV lineages I-III (shown in Table 1). The IC50 and IC80 values showed that those with the greatest potency and breadth against all four LASV linages were 25.10C, 12.1F, 8.9F, 37.2D, 37.7H, 25.6A and 8.11G (Table 1). The remaining hMAbs showed weaker and variable potency. Neutralization activity of these GP-specific hMAbs was further confirmed for LASV Josiah strain using a LCMV-based pseudovirus assay. These results revealed that out of the 120 tested LASV GP-specific hMAbs, 15 neutralized to different degrees LASV Josiah strain, and some of them exhibited broad neutralizing activity against representative strains from LASV lineages I-II.
- Cross-reactivity of LASV GP-specific hMAbs with LCMV ARM: The 16 LASV GP-specific hMAbs with neutralizing activity (as shown in Table 1) were characterized with respect their ability to recognize LCMV ARM strain GP expressed in human 293T cells transfected with GP-expressing plasmids by immunofluorescence. Human 293T cells transfected with LASV GPs from linages I-IV were included as controls. Nine of the LASV GP-specific neutralizing hMAbs (12.1F, 37.7H, 37.2D, 25.6A, 9.8A, 18.5C, 37.2G, 2.9D and 36.9F) cross-reacted with LCMV ARM GP.
- The ability of LASV GP-specific neutralizing hMAbs (as shown by
FIG. 1 and Table 1) to recognize GPs from five LCMV strains associated with human cases of LCMV-induced disease was examined. These strains corresponded to the WE strain that caused a zoonotic infection in New York in 1935; Rhode Island (RI) strain, responsible for four human cases and three fatalities from a transplant case in 2005; Ohio (OH) strain that is similar to the Michigan LCMV strain responsible for a human case in 2005; Wisconsin (WI) strain responsible for four human deaths in 2003; and Massachusetts (MA) strain, responsible for two human deaths in 2008. LASV GP-specific neutralizing hMAbs 12.1F, 37.2D, 9.8A, 18.5C and 36.9F recognized all five LCMV GP strains. LASV GP-specific neutralizing hMAbs 37.7H, 25.6A, 37.2G and 2.9D recognized four LCMV strains (ARM, WE, WI, and MA, but not RI or AH). The rest of the hMAbs did not cross-react with any of the LCMV strains tested. - A validated cell-based microneutralization assay was used to identify LASV GP-specific hMAbs that not only cross-reacted with different LCMV GPs, but also neutralized LCMV ARM, as they would represent primary candidates to display broadly antiviral activity in vivo against LCMV strains previously associated with disease cases in humans. From the 15 LASV GP-specific neutralizing hMAbs, six of them (12.1F, 37.2D, 9.8A, 18.5C, 37.2G and 36.9F) neutralized LCMV ARM, as shown in
FIG. 2 , with IC50<1 μg/mL, with the exception of 18.5C that exhibited a higher (>10 μg/mL) IC50. Results are displayed in Table 2, which shows the neutralizing activity of the 15 LASV GP-specific neutralizing hMAbs against LCMV ARM, and in particular, the IC50 and IC80 values of the 15 LASV GP-specific neutralizing hMAbs against LCMV ARM. Values were obtained from the cell-based microneutralization assay (shown inFIG. 2 ) using LASV or LCMV GP-pseudotyped rLCMVΔGP/GFP viruses. Grey indicates LASV GP-specific neutralizing hMAbs that neutralized LCMV GP ARM. Neutralization of LASV GP-pseudotyped rLCMVΔGP/GFP was similar to neutralization results obtained using the LASV GP-pseudotyped lentivirus particles shown in Table 1. -
TABLE 2 Neutralizing activity of 15 LASV GP-specific neutralizing hMAbs against LCMV Armstrong strain (ARM). LASV Josiah (IV) LCMV ARM hMAb IC50 IC80 IC50 IC80 25.10C 0.160 0.247 >10 >10 12.1F 0.172 0.258 0.167 0.265 8.9F 0.134 >10 >10 >10 37.2D 0.137 0.260 0.518 2.358 37.7H 0.134 0.214 >10 >10 25.6A 0.188 0.300 >10 >10 9.8A 0.139 0.253 0.112 0.248 18.50 >10 >10 2.207 4.83 8.11G >10 >10 >10 >10 37.2G 0.405 1.776 0.525 2.461 2.9D 0.942 2.706 >10 >10 NE13 0.567 1.763 >10 >10 19.7E 1.189 >10 >10 >10 36.9F 0.570 2.228 0.591 3.328 36.1F 0.132 0.206 >10 >10 10.4B >10 >10 >10 >10 - The well-characterized mouse model of LCMV infection was used to test whether LASV GP-specific neutralizing hMAbs with broadly neutralizing activity against LCMV (shown in
FIG. 2 and Table 2) also exhibited in vivo neutralizing activity. The immunosuppressive Clone 13 (C1-13) strain of LCMV was used. Infection (i.v.) of B6 WT mice with a high dose (≥106 PFU) of C1-13 results in transient generalized immunosuppression and establishment of a persistent infection with well-established parameters. Virus clearance takes place betweendays 60 to 100 (post inoculation (p.i.). However, treatment of C1-13 infected mice that results in reduced viral load accelerates C1-13 clearance. Therefore, it was predicted that LASV GP-specific neutralizing hMAbs exhibiting in vivo neutralizing activity would either prevent the establishment of C1-13 persistence or accelerate its clearance. Mice were treated with the indicated hMAbs at 20 mg/Kg intraperitoneally (i.p.) and were infected with either rCl-13/WT or rCl-13/LASV-GP(mCD). rCl-13/LASV-GP(mCD) was used because it contains mutations C459K and K461G within the cytosolic domain of GP that enhance persistence in mice. The in vivo results are shown inFIG. 3 and correlate with those previously documented in cultured cells (shown inFIG. 2 and Table 2). Mice treated with hMAbs 12.1F, 37.2D, 9.8A and 36.9F prevented persistence of rCl-13/WT. Unexpectedly, hMAbs 37.2G and 18.5C did not prevent C1-13 persistence in vivo. As expected, based on cross-reactivity and neutralization results in cultured cells, hMAbs 19.7E and 8.9F did not prevent persistence of rCl-13. - Table 3 displays a summary of the cross-reactivity and neutralizing activity in vitro and in vivo of LASV GP-specific hMAbs against six LCMV strains (ARM, WE, RI, OH, WI, and MA) tested.
-
TABLE 3 Summary of the cross-reactivity and neutralizing activity in vitro and in vivo of LASV GP-specific hMAbs against LCMV. Cross-reactivity Neutralizing activity LCMVARM LCMVWE LCMVRI LCMVOH LCMVWI LCMVMA In vitro In vivo 25.10C − − − − − − − − 8.9F − − − − − − − − 12.1F + + + + + + + + 37.7H + + − − + + − − 36.1F − − − − − − − − 8.11G − − − − − − − − 37.2D + + + + + + + + 25.6A + + − − + + − − 9.8A + + + + + + + + 18.5C − − − − − − + − 37.2G + + − − + + + − 19.7E − − − − − − − − 2.9D + + − − + + − − NE13 − − − − − − − − 36.9F + + + + + + + + 10.4B − − − − − − − − - A panel of murine antibodies against Fab or F(ab′)2 fragments of leading candidate therapeutic BNhMAbs was derived for isolation of highly specific anti-idiotypic reagents for assay development. In order to develop a highly protective therapeutic BNhMAb cocktail containing two to four antibodies that together confer maximum pre- and post-exposure protection against LCMV infections, while minimizing the emergence of escape mutants, it is important to characterize the PK of each antibody when administered in a cocktail form. To distinguish between all BNhMAbs included in the cocktail after administration, highly specific anti-idiotypic antibodies are the best tool available to rapidly determine concentration and clearance of individual hMAbs from the blood. A panel of anti-idiotypic antibodies to 37.2D and 12.1F has been developed. Anti-idiotypic mMAbs to 37.2D have specifically detected this BNhMAb when spiked into human serum. The anti-idiotypic antibodies do not capture or detect any other arenaviral BNhMAb tested or any other IgG specificity present in human serum on both ELISA and SPR based studies, and thus are useful for assaying 37.2D.
- These studies were done under BSL-4 biocontainment at the Galveston National Laboratory. Outbred Hartley strain GP were challenged i.p. with 1,000 pfu of GP adapted (GPA) LASV Josiah strain (N=5/group). This model has been described recently for testing therapeutics against LASV. The advantage of using outbred animals to model human infection is inferred from the higher variability of immune responses inherent in outbred populations. Viremia was compared by Kruskal-Wallis test supported by Dunn's Multiple comparison posttest (
PRISM 5™ software available from GraphPad Software, La Jolla, Calif.) to detect differences from the control group for time points relevant to onset (day 7) or peak viremia (day 14) as determined from historical data. - Eleven LASV hMAbs tested in a Hartley GP model of LF segregated into three distinct protection groups: (1) 25.6A, 2.9D, 8.9F, 12.1F, and 37.7H conferred 100% protection and no change in clinical score in GPs. (2) 37.2D, 19.7E, and 37.2G protected 80 to 90% of animals. (3) 10.4B, 25.10C, and 36.1F, conferred 40%, 30%, and 20% protection, respectively. An irrelevant recombinant human isotype control (IgG1) Ab did not confer protection (0% survival).
- With respect to viremia, untreated control animals averaged 3.5 and 4.5 Log PFU/mL on
days FIG. 4 . Despite 100% protection at the study endpoint, some animals from treatment group 8.9F or 37.7H, 2.9D, and 25.6A had low level viremia onday day 7, but byday 14 mean viremia was markedly lower than control animals. Groups with 80 to 90% survival exhibited relatively low mean clinical scores (FIG. 5 ) and all remaining treatment groups exhibited concomitant increases in mean clinical scores with decreases in survival per group. Endpoint viremia was not determined for these studies as survival was the primary metric of interest, though all surviving animals demonstrated no clinical signs. - Results from the guinea pig studies informed studies for the Cynomolgus macaque (CM) model of LF. These studies demonstrated that several of the antibodies with high potency in the GP model also protected 100% of the CMs when administered on the day of challenge. 19.7E protected 75% of CMs. Notably a treatment dose as low as 6 mg/kg of hMAb 37.2D provided 100% protection in CMs, whereas 19.7E protected 75% of CMs. A cocktail of three human MAbs (37.2D, 12.1F, and 8.9F at 15 mg/kg each) rescued 100% of CMs even after delay in the start of treatment to 3, 6, or 8 days post-infection (therapeutic walk-out studies). At 8 days post-infection, untreated CMs had developed high viral loads and were extremely ill. CM also were protected from lethal LF induced by challenge with either strain Josiah (lineage IV) or a contemporary lineage II strain derived from a lethal case of LF in Nigeria, both with the first treatment administered at 8 days post-infection.
- Monomeric GPCysR4 was incubated with excess Fab 37.7H and subjected to SEC-MALS analysis. SEC-MALS indicated the formation of trimeric GP-Fab complexes in addition to monomeric GP-Fab complexes. Crystals of both the monomeric and trimeric fractions of the GPCysR4-Fab 37.7H complex formed in space group P6122 and diffract to 3.2 Å with a trimer of GP bound to three Fabs in the asymmetric unit. Phases were determined with an iterative approach by using molecular replacement with a related Fab structure and the LCMV GP crystal structure.
- The antibody 37.7H against LASV neutralizes viruses representing all four known lineages of LASV in vitro and offers protection from lethal LASV challenge in guinea pig and nonhuman primates. The antibody simultaneously binds two GP monomers at the base of the GP trimer, where it engages four discontinuous regions of LASV GP, two in “site A” and two in “site B”. Site A contains residues 62 to 63 of the N-terminal loop of GP1 and residues 387 to 408 in the T-loop and HR2 of GP2. Site B contains residues 269 to 275 of the fusion peptide and residues 324 to 325 of HR1 of GP2. In total, 37.7H buries about 1620 Å2 of GP: about 1000 Å2 of GP at site A and about 620 Å2 of GP at site B. Although nearly the entire surface buried on GP belongs to GP2, the presence of both GP1 and GP2 is critical for 37.7H recognition, likely because GP1 is required to maintain the proper prefusion conformation of GP2 for 37.7H binding.
- The antibody 37.7H also recognizes the GPC of LCMV but does not recognize the GPC of the more distantly related Old World arenavirus LUJV nor the GPC of New World arenaviruses. A sequence comparison among these arenaviruses demonstrates nearly complete sequence conservation throughout the 37.7H epitope for all LASV lineages and LCMV. However, the sequences of LUJO, JUNV, and MACV GPCs are far more divergent, particularly in HR2 of GP2, which is heavily involved in binding to 37.7H. The 37.7H antibody neutralizes by stabilizing the prefusion GP.
- The quaternary nature and the involvement of the fusion peptide in the 37.7H epitope suggest that this antibody neutralizes the virus by stabilizing GPC in the prefusion conformation, thereby preventing the conformational changes required for infection. This was verified by analyzing the ability of LASV GP-pseudotyped recombinant vesicular stomatitis virus (rVSV-LASV GP) to mediate fusion with cell membranes.
- First the ability of 37.7H to neutralize rVSVLASV GP was determined.
FIG. 6 shows the effect of antibodies on rVSV-LASV GP infection and fusion. Antibody-mediated neutralization of rVSV-LASV GP is shown inFIG. 6 , Panel A. Antibody-mediated neutralization of rVSV-VSV-G is shown inFIG. 6 , Panel B. The antibody 9.7A is non-neutralizing antibody and in the same competition group as 37.7H (GPC-B); 13.4E binds to a linear epitope in the T-loop of GP2; 12.1F binds to the GP1 subunit of LASV. Error bars indicate the standard deviation of at least six (two biological replicates, each having three or more technical replicates).FIG. 6 , Panel C shows antibody-mediated inhibition of rVSVLASV GP fusion at the cell surface. Error bars indicate the standard error of the mean of six (except 37.7H, where N=9).FIG. 6 , Panel D shows Fab 37.7H reduces binding of a LAMP1-Fc fusion protein to LASV GPCysR4. Error bars indicate the standard deviation of six and three technical replicates. - 37.7H effectively prevented cellular infection by rVSV-LASV GP, as did the antibody 12.1F, which binds to the upper, (3-sheet face of LASV GP1 and is presumed to block cell attachment. In contrast, antibodies 13.4E, which binds a linear epitope in the T-loop, and 9.7A, which is a non-neutralizing GPC-B antibody, did not prevent viral infection (
FIG. 6 , Panels A and B). - Next, the ability of 37.7H to prevent fusion of rVSV-LASV GP with cell membranes when exposed to low pH was examined. Unlike the non-neutralizing antibodies 9.7A and 13.4E, which were not effective in preventing fusion, 37.7H reduced fusion by nearly 80% compared with rVSV-LASV GP alone (
FIG. 6 , Panel C). In contrast, the neutralizing antibody against GP1 (anti-GP1), 12.1F, showed only a slight reduction in infectivity, suggesting that the effect of 37.7H was strictly due to disruption in fusogenicity of the GPC and not attachment to cells. - Before exposure of the GP2 fusion peptide and loop and subsequent fusion of the viral and host cell membranes, LASV GP1 engages LAMP1. Engagement of this receptor is thought to require conformational changes in GP1 that are triggered by exposure to the low pH in the endosome. Tomography of LASV spikes in the presence of low pH and LAMP1 shows an opening of the trimer compared with its neutral pH conformation. To determine whether 37.7H could prevent these conformational changes, the ability of GPCysR4 to bind to a soluble LAMP1-Fc fusion alone and when bound to Fab 37.7H was analyzed. In the absence of Fab 37.7H, GPCysR4 effectively bound to LAMP1 when exposed to low pH. In the presence of Fab 37.7H, however, interaction between GPCysR4 and LAMP1 was markedly reduced (
FIG. 6 , Panel D). - Based on crystallographic data, the footprint of 37.7H and the footprint of LAMP1 are separated by about 50 Å, and the angle adopted by the bound Fab fragments of 37.7H suggests that it is unlikely to sterically interfere with LAMP1. Thus, there are likely to be conformational changes in GP1 required for LAMP1 binding that are prevented by this human survivor antibody. Taken together, these results demonstrate that the probable mechanism of action for 37.7H and probably for other antibodies in its potent GPC-B competition group is stabilization of the prefusion GPC trimer and prevention of the conformational changes required for binding of LAMP1 and triggering of the GP2 fusion peptide and fusion loop in the endosome.
- Other embodiments and uses of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. All references cited herein, including all publications, U.S. and foreign patents and patent applications, are specifically and entirely incorporated by reference. It is intended that the specification and examples be considered exemplary only with the true scope and spirit of the invention indicated by the claims.
- The following reference articles are incorporated herein by reference.
-
- 1. Auperin, D. D., Sasso, D. R. and McCormick, J. B. (1986). Nucleotide sequence of the glycoprotein gene and intergenic region of the Lassa virus S genome RNA. Virology 154, 155-167.
- 2. Beyer, W. R., Popplau, D., Garten, W., von Laer, and Lenz O. (2003). Endoproteolytic processing of the lymphocytic choriomeningitis virus glycoprotein by the sibtilase SKI-1/S1P. J. Virol. 77, 2866-2872.
- 3. Buchmeier, M. J. (2002). Arenaviruses: protein structure and function. Curr. Top. Microbiol. Immunol. 262, 259-173.
- 4. Buchmeier, M. J., and Parekh, B. S. (1987). Protein structure and expression among arenaviruses. Current Topics in Microbiology and Immunology 133, 41-57.
- 5. Buchmeier, M. J., Lewicki, H. A., Tomor, O., and Jonhson, K. M. (1980). Monoclonal antibodies to lymphocytic choriomeningitis virus reacts with pathogenic arenaviruses. Nature, London 288, 4876-4877.
- 6. Burnette, W. N. (1981). “Western Blotting”: electrophoretic transfer of proteins from sodium dodecyl sulfate-polyacrylamide gels to unmodified nitrocellulose and radiographic detection with antibody and radioiodinated protein A. Analytical Biochemistry 112, 195-203.
- 7. Clegg, J. C. and Lloyd, G. (1983). Structural and cell-associated proteins of Lassa virus. Journal of General Virology 64, 1127-1136.
- 8. Eichler, R., Lenz, O., Strecker, T., Eickmann, M., Klenk, H. D., and Garten, W. (2004). Lassa virus glycoprotein signal peptide displays a novel topology with an extended ER-luminal region. J. Biol. Chem. 279, 12293-12299.
- 9. Eichler, R., Lenz, O., Strecker, T., Eickmann, M., Klenk, H. D., and Garten, W. (2003). Identification of Lassa virus glycoprotein signal peptide as a trans-acting maturation factor. EMBO Rep. 4, 1084-1088.
- 10. Eichler, R., Lenz, O., Strecker, T., Eickmann, and Garten, W. (2003). Signal peptide of Lassa virus glycoprotein GP-C exhibits an unusual length. FEBS Lett. 538, 203-206.
- 11. Elagoz, A., Benjannet, S., Mammarbassi, A., Wickham, L., and Seidah, N. G. (2002). Biosynthesis and cellular trafficking of the convertase SKI-1/S1P: ectodomain shedding requires SKI-1 activity. J. Biol. Chem. 277, 11265-11275.
- 12. Hufert, F. T., Ludke, W., and Schmitz, H. (1989). Epitope mapping of the Lassa virus nucleocapsid protein using monoclonal anti-nucleocapsid antibodies. Archives of Virology 106, 201-212.
- 13. Lenz, O., ter Meulen, J., Feldmann, H., Lenk, H.-D., and Garten, W. (2000). Identification of a novel consensus sequence at the cleavage site of the Lassa virus glycoprotein. J. Virol. 74, 11418-11421.
- 14. Lukashevich L. S., Clegg J. C., and Sidibe K. (1993). Lassa virus activity in Guinea: distribution of human antiviral antibody defined using enzyme-linked immunosorbent assay with recombinant antigen. J Med Virol. 40, 210-7.
- 15. McCormick, J. B., and Fisher-Hoch, S. P. (2002). Lassa Fever. Curr. Top. Microbiol. Immunol. 262, 75-109.
- 16. Ruo, S. L., Mitchell, S. W., Killey, M. P., Roumillat, L. F., Fisher-Hoch, S. P., and McCormick, J. B. (1991). Antigenic relatedness between arenaviruses defined at the epitope level by monoclonal antibodies. Journal of General Virology 72, 549-555.
- 17. Sanchez, A., Pifat, D. Y., Kenyon, R. H., Peters, C. J., McCormick, J. B., and Kiley, M. P. (1989). Junin virus monoclonal antibodies: characterization and cross-reactivity with other arenaviruses. J. Gen. Virol. 70, 1125-1132.
- 18. Spiropoulou, C. F., Kunz, S., Rollin, P. E., Campbell, K. P., and Oldstone, M. B. A. (2002). New World arenavirus clade C, but not clade A and B viruses, utilizes a-dystroglycan as its major receptor. J. Virol. 76, 5140-5146.
- 19. ter Meulen J., Badusche M., Kuhnt K., Doetze A., Satoguina J., Marti T., Loeliger C., Koulemou K., Koivogui L., Schmitz H., Fleischer B., and Hoerauf A. (2000). Characterization of human CD4(+) T-cell clones recognizing conserved and variable epitopes of the Lassa virus nucleoprotein. J. Virol. 74, 2186-92.
- 20. ter Meulen, J., Koulemou K., Wittekindt T., Windisch K., Strigl S., Conde S., and Schmitz H. (1998). Detection of Lassa Virus Antinucleoprotein Immunoglobulin G (IgG) and IgM Antibodies by a Simple Recombinant Immunoblot Assay for Field Use. J. Clin. Microbiol. 36, 3143-3148.
- 21. York, J., Agnihothram, S. S., Ronamowski, V., and Nunberg, J. H. (2005). Genetic analysis of heptad-repeat regions in the G2 fusion subunit of the Junin arenavirus envelope glycoprotein. Virology 343, 267-279.
- 22. York, J., Ronamowski, V., Lu, M., and Nunberg, J. H. (2004). The signal peptide of the Junin arenavirus envelope glycoprotein is myristoylated and forms an essential subunit of the mature G1-G2 complex. J. Virol. 78, 10783-10792.
- 23. Shaffer J G, Grant D S, Schieffelin J S, Boisen M L, Goba A, et al. 2014. Lassa Fever in Post-Conflict Sierra Leone. PLoS Negl Trop Dis 8: e2748.
- 24. Hartnett J N, Boisen M L, Oottamasathien D, Jones A B, Millett M M, . . . Garry R F, Branco L M & the VHFC (2015). Current and emerging strategies for the diagnosis, prevention and treatment of Lassa fever. Future Virology. Review. Vol. 10, No. 5, Pages 559-584.
- 25. Andersen K G, Shapiro B J, Matranga C B, Sealfon R, Lin A E, . . . Branco L M, Gire S K, Phelan E, Tariyal R, Tewhey R, . . . Garry R F, Sabeti P C. Clinical Sequencing Uncovers Origins and Evolution of Lassa Virus. Cell. 2015 Aug. 13; 162(4):738-50.
- 26. Luis M Branco, Jessica N Grove, Matt L Boisen, Jeffrey G Shaffer, Augustine Goba, . . . Robert F Garry. Emerging trends in Lassa fever: redefining the role of immunoglobulin M and inflammation in diagnosing acute infection. Virology Journal 2011, 8:478 (24 Oct. 2011).
- 27. Jessica N Grove, Luis M Branco, Matt L Boisen, Ivana J Muncy, Lee A Henderson, . . . Robert F Garry. Capacity building permitting comprehensive monitoring of a severe case of Lassa hemorrhagic fever in Sierra Leone with a positive outcome: Case Report. Virology Journal 2011, 8:314 (20 Jun. 2011).
- 28. Luis M Branco, Jessica N Grove, Frederick J Geske, Matt L Boisen, Ivana J Muncy, . . . Robert F Garry. Lassa virus-like particles displaying all major immunological determinants as a vaccine candidate for Lassa hemorrhagic fever. Virology Journal 2010, 7:279 (20 Oct. 2010).
- 29. Luis M Branco, Matt L Boisen, Kristian G Andersen, Jessica N Grove, Lina M Moses, . . . Robert F Garry. Lassa Hemorrhagic Fever in a Late Term Pregnancy from Northern Sierra Leone with a Positive Maternal Outcome: Case Report. Virology Journal 2011, 8:404 (15 Aug. 2011).
Claims (27)
1. An antigen-binding composition comprising a neutralizing antibody or neutralizing antigen-binding antibody fragment thereof specific to glycoprotein 1 (GP1), glycoprotein 2 (GP2), glycoprotein precursor (GPC), or full-length glycoprotein (GP) of Lassa virus (LASV), wherein the antibody or antibody fragment comprises a heavy chain variable region (VH) and a light chain variable region (VL), the VH and VL each comprising complementarity determining regions CDR1, CDR2 and CDR3 selected from the group consisting of:
(a) a VH CDR1 of SEQ ID NO: 71, a VH CDR2 of SEQ ID NO: 72, a VH CDR3 of SEQ ID NO: 73, a VL CDR1 of SEQ ID NO: 117, a VL CDR2 of sequence Trp Ala Ser, and a VL CDR3 of SEQ ID NO: 118;
(b) a VH CDR1 of SEQ ID NO: 74, a VH CDR2 of SEQ ID NO: 75, a VH CDR3 of SEQ ID NO: 76, a VL CDR1 of SEQ ID NO: 119, a VL CDR2 of sequence Glu Val Lys, and a VL CDR3 of SEQ ID NO: 120;
(c) a VH CDR1 of SEQ ID NO: 77, a VH CDR2 of SEQ ID NO: 78, a VH CDR3 of SEQ ID NO: 79, a VL CDR1 of SEQ ID NO: 121, a VL CDR2 of sequence Asp Ala Ser, and a VL CDR3 of SEQ ID NO: 122;
(d) a VH CDR1 of SEQ ID NO: 80, a VH CDR2 of SEQ ID NO: 81, a VH CDR3 of SEQ ID NO: 82, a VL CDR1 of SEQ ID NO: 123, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 124;
(e) a VH CDR1 of SEQ ID NO: 83, a VH CDR2 of SEQ ID NO: 84, a VH CDR3 of SEQ ID NO: 85, a VL CDR1 of SEQ ID NO: 125, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 126;
(f) a VH CDR1 of SEQ ID NO: 86, a VH CDR2 of SEQ ID NO: 87, a VH CDR3 of SEQ ID NO: 88, a VL CDR1 of SEQ ID NO: 127, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 128;
(g) a VH CDR1 of SEQ ID NO: 89, a VH CDR2 of SEQ ID NO: 90, a VH CDR3 of SEQ ID NO: 91, a VL CDR1 of SEQ ID NO: 129, a VL CDR2 of sequence Glu Val Arg, and a VL CDR3 of SEQ ID NO: 130;
(h) a VH CDR1 of SEQ ID NO: 92, a VH CDR2 of SEQ ID NO: 93, a VH CDR3 of SEQ ID NO: 94, a VL CDR1 of SEQ ID NO: 131, a VL CDR2 of sequence Glu Val Ser, and a VL CDR3 of SEQ ID NO: 132;
(i) a VH CDR1 of SEQ ID NO: 95, a VH CDR2 of SEQ ID NO: 96, a VH CDR3 of SEQ ID NO: 97, a VL CDR1 of SEQ ID NO: 133, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 134;
(j) a VH CDR1 of SEQ ID NO: 101, a VH CDR2 of SEQ ID NO: 102, a VH CDR3 of SEQ ID NO: 103, a VL CDR1 of SEQ ID NO: 137, a VL CDR2 of sequence Gln Ala Ser, and a VL CDR3 of SEQ ID NO: 138;
(k) a VH CDR1 of SEQ ID NO: 104, a VH CDR2 of SEQ ID NO: 105, a VH CDR3 of SEQ ID NO: 106, a VL CDR1 of SEQ ID NO: 139, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 140;
(l) a VH CDR1 of SEQ ID NO: 107, a VH CDR2 of SEQ ID NO: 108, a VH CDR3 of SEQ ID NO: 109, a VL CDR1 of SEQ ID NO: 141, a VL CDR2 of sequence Gly Ala Tyr, and a VL CDR3 of SEQ ID NO: 142; and
(m) a VH CDR1 of SEQ ID NO: 110, a VH CDR2 of SEQ ID NO: 111, a VH CDR3 of SEQ ID NO: 112, a VL CDR1 of SEQ ID NO: 143, a VL CDR2 of sequence Ala Ala Val, and a VL CDR3 of SEQ ID NO: 144.
2. The composition of claim 1 , wherein the composition comprises two or more of said antibodies or antigen-binding antibody fragments.
3. The composition of claim 1 , wherein the composition comprises:
(1) an antibody or antigen-binding antibody fragment comprising a VH CDR1 of SEQ ID NO: 83, a VH CDR2 of SEQ ID NO: 84, a VH CDR3 of SEQ ID NO: 85, a VL CDR1 of SEQ ID NO: 125, a VL CDR2 of sequence Gly Ala Ser, and a VL CDR3 of SEQ ID NO: 126; or
(2) an antibody or antigen-binding antibody fragment comprising a VH CDR1 of SEQ ID NO: 92, a VH CDR2 of SEQ ID NO: 93, a VH CDR3 of SEQ ID NO: 94, a VL CDR1 of SEQ ID NO: 131, a VL CDR2 of sequence Glu Val Ser, and a VL CDR3 of SEQ ID NO: 132.
4. The composition of claim 1 , wherein the antibody is selected from the group consisting of a monoclonal antibody, and a recombinantly produced antibody.
5. The composition of claim 1 , wherein the antibody comprises a human monoclonal antibody.
6. The composition of claim 1 , wherein the antigen-binding antibody fragment is selected from the group consisting of a Fab, a Fab′, and a F(ab′)2 fragment.
7. A nucleic acid having a sequence that encodes for a VH of the antibody or the antibody fragment of the composition of claim 1 .
8. The nucleic acid of claim 7 , wherein the nucleic acid includes a nucleic acid sequence selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, and SEQ ID NO: 16.
9. A nucleic acid having a sequence that encodes for a VL of the antibody or the antibody fragment of the composition of claim 1 .
10. The nucleic acid of claim 9 , wherein the nucleic acid includes a nucleic acid sequence selected from the group consisting of SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 15, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, and SEQ ID NO: 32.
11. An expression vector that contains the nucleic acid sequence of claim 7 .
12. An antigen-binding composition comprising a neutralizing antibody or neutralizing antigen-binding antibody fragment thereof specific to glycoprotein 1 (GP1), glycoprotein 2 (GP2), glycoprotein precursor (GPC), or full-length glycoprotein (GP) of Lassa virus (LASV), wherein the antibody or antibody fragment comprises a heavy chain variable region (VH) and a light chain variable region (VL) selected from the group consisting of:
(a) a VH of SEQ ID NO: 35 and a VL of SEQ ID NO: 51;
(b) a VH of SEQ ID NO: 36 and a VL of SEQ ID NO: 52;
(c) a VH of SEQ ID NO: 37 and a VL of SEQ ID NO: 53;
(d) a VH of SEQ ID NO: 38 and a VL of SEQ ID NO: 54;
(e) a VH of SEQ ID NO: 39 and a VL of SEQ ID NO: 55;
(f) a VH of SEQ ID NO: 40 and a VL of SEQ ID NO: 56;
(g) a VH of SEQ ID NO: 41 and a VL of SEQ ID NO: 57;
(h) a VH of SEQ ID NO: 42 and a VL of SEQ ID NO: 58;
(i) a VH of SEQ ID NO: 43 and a VL of SEQ ID NO: 59;
(j) a VH of SEQ ID NO: 45 and a VL of SEQ ID NO: 61;
(k) a VH of SEQ ID NO: 46 and a VL of SEQ ID NO: 62;
(l) a VH of SEQ ID NO: 47 and a VL of SEQ ID NO: 63; and
(m) a VH of SEQ ID NO: 48 and a VL of SEQ ID NO: 64.
13. The composition of claim 12 , wherein the composition comprises two or more of said antibodies or antigen-binding antibody fragments.
14. The composition of claim 12 , wherein the composition comprises:
(1) an antibody or antigen-binding antibody fragment comprising a VH of SEQ ID NO: 39 and a VL of SEQ ID NO: 55; or
(2) an antibody or antigen-binding antibody fragment comprising a VH of SEQ ID NO: 42 and a VL of SEQ ID NO: 58.
15. The composition of claim 12 , wherein the antibody is selected from the group consisting of a monoclonal antibody, and a recombinantly produced antibody.
16. The composition of claim 12 , wherein the antibody comprises a human monoclonal antibody.
17. The composition of claim 12 , wherein the antigen-binding antibody fragment is selected from the group consisting of a Fab, a Fab′, and a F(ab′)2 fragment.
18. A nucleic acid having a sequence that encodes for a VH of the antibody or the antibody fragment of the composition of claim 12 .
19. A nucleic acid having a sequence that encodes for a VL of the antibody or the antibody fragment of the composition of claim 12 .
20. A vaccine for preventing or treating infection of a patient by Lassa virus comprising the antibody or antibody fragment of the composition of claim 1 .
21. The vaccine of claim 22 , which is cross-protective against infection by a lymphocytic choriomeningitis virus.
22. A pharmaceutical composition for treating or preventing infection by a Lassa virus or a lymphocytic choriomeningitis virus comprising the composition of claim 1 and a pharmaceutically acceptable carrier.
23. A diagnostic kit for detecting infection of a subject by Lassa virus or other arenaviridae comprising at least one antibody or antibody fragment of the composition of claim 1 bound to a detectable labelling group.
24. An antibody or antibody fragment of the composition of claim 1 bound to a detectable labelling group.
25. A method of detecting infection by a Lassa virus or a lymphocytic choriomeningitis virus comprising contacting a biological sample from a subject with at least one antibody or antibody fragment of the composition of claim 1 bound to a detectable labelling group; and detecting a complex between the antibody or antibody fragment and a Lassa virus or other arenaviridae present in the sample.
26. A method of treating a Lassa virus infection in a subject comprising administering the antibody or antibody fragment of the composition of claim 1 to the subject.
27. A method of treating a lymphocytic choriomeningitis virus infection in a subject comprising administering the antibody or antibody fragment of the composition of claim 1 to the subject.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/520,338 US20220089696A1 (en) | 2016-12-05 | 2021-11-05 | Arenavirus monoclonal antibodies and uses |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662430225P | 2016-12-05 | 2016-12-05 | |
PCT/US2017/064744 WO2018106712A1 (en) | 2016-12-05 | 2017-12-05 | Arenavirus monoclonal antibodies and uses |
US201916466544A | 2019-06-04 | 2019-06-04 | |
US17/520,338 US20220089696A1 (en) | 2016-12-05 | 2021-11-05 | Arenavirus monoclonal antibodies and uses |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2017/064744 Division WO2018106712A1 (en) | 2016-12-05 | 2017-12-05 | Arenavirus monoclonal antibodies and uses |
US16/466,544 Division US11198723B2 (en) | 2016-12-05 | 2017-12-05 | Arenavirus monoclonal antibodies and uses |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220089696A1 true US20220089696A1 (en) | 2022-03-24 |
Family
ID=62491419
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/466,544 Active US11198723B2 (en) | 2016-12-05 | 2017-12-05 | Arenavirus monoclonal antibodies and uses |
US17/520,338 Abandoned US20220089696A1 (en) | 2016-12-05 | 2021-11-05 | Arenavirus monoclonal antibodies and uses |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/466,544 Active US11198723B2 (en) | 2016-12-05 | 2017-12-05 | Arenavirus monoclonal antibodies and uses |
Country Status (4)
Country | Link |
---|---|
US (2) | US11198723B2 (en) |
EP (1) | EP3548075A4 (en) |
CN (1) | CN110913891A (en) |
WO (1) | WO2018106712A1 (en) |
Family Cites Families (19)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
US6673776B1 (en) | 1989-03-21 | 2004-01-06 | Vical Incorporated | Expression of exogenous polynucleotide sequences in a vertebrate, mammal, fish, bird or human |
US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
AU669124B2 (en) | 1991-09-18 | 1996-05-30 | Kyowa Hakko Kirin Co., Ltd. | Process for producing humanized chimera antibody |
US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
US6376471B1 (en) | 1997-10-10 | 2002-04-23 | Johns Hopkins University | Gene delivery compositions and methods |
AP2009005028A0 (en) * | 2007-04-10 | 2009-12-31 | Univ Tulane | Soluble and membrane-anchored forms of lassa virussubunit proteins |
US9101597B2 (en) * | 2013-03-14 | 2015-08-11 | The Administration Of The Tulane Educational Fund | Immunoprotective primary mesenchymal stem cells and methods |
CN105296507B (en) * | 2015-10-12 | 2019-12-31 | 山东大学 | Lassa fever virus-like particle, preparation method and application thereof |
CN105548539B (en) * | 2015-12-28 | 2018-02-09 | 中华人民共和国上海出入境检验检疫局 | A kind of indirect immunofluorescene assay method of Lassa virus IgG antibody |
-
2017
- 2017-12-05 WO PCT/US2017/064744 patent/WO2018106712A1/en active Application Filing
- 2017-12-05 EP EP17877970.8A patent/EP3548075A4/en active Pending
- 2017-12-05 CN CN201780085558.6A patent/CN110913891A/en active Pending
- 2017-12-05 US US16/466,544 patent/US11198723B2/en active Active
-
2021
- 2021-11-05 US US17/520,338 patent/US20220089696A1/en not_active Abandoned
Non-Patent Citations (4)
Title |
---|
Robinson, J. E., et al., May 2016, Most Neutralizing Human Monoclonal Antibodies Target Novel Epitopes Requiring Both Lassa Virus Glycoprotein Subunits, Nat. Comm. 7:11544, pp. 1-14. * |
Sela-Culang, I., et al., October 2013, The Structural Basis of Antibody-Antigen Recognition, Front. Immunol. 4(Article 302):1-13. * |
Xiang, J, et al., 1995, Framework Residues 71 and 93 of the Chimeric B72.3 Antibody are Major Determinants of the Conformation of Heavy-chain Hypervariable Loops, J. Mol. Biol. 253:385-390. * |
Xiang, J., et al., 1991, Modification in Framework Region I Results in a Decreased Affinity of Chimeric Anti-TAG72 antibody, Mol. Immunol. 28(1/2):141-148. * |
Also Published As
Publication number | Publication date |
---|---|
US11198723B2 (en) | 2021-12-14 |
CN110913891A (en) | 2020-03-24 |
EP3548075A4 (en) | 2020-11-25 |
WO2018106712A1 (en) | 2018-06-14 |
US20200002405A1 (en) | 2020-01-02 |
EP3548075A1 (en) | 2019-10-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR20230002261A (en) | Anti-SARS-COV-2 Neutralizing Antibodies and Methods of Using The Same | |
CN102388068B (en) | Alpha-4-beta-7 heterodimer specific antagonist antibody | |
US11440954B2 (en) | Optimized anti-TL1A antibodies | |
KR20100087283A (en) | Methods for recombinant manufacturing of anti-rsv antibodies | |
EP2956171B1 (en) | Methods to protect against and treat multiple sclerosis | |
KR20070038556A (en) | Anti-rhesus d recombinant polyclonal antibody and methods of manufacture | |
KR20090127341A (en) | Recombinant antibodies for treatment of respiratory syncytial virus infections | |
DK2582721T3 (en) | USEFUL ANTIBODIES FOR PASSIVE INFLUENZA IMMUNIZATION | |
KR20080113223A (en) | Recombinant polyclonal antibody for treatment of respiratory syncytial virus infections | |
HUE034203T2 (en) | Silent fc variants of anti-cd40 antibodies | |
TW201206954A (en) | Hepcidin, hepcidin antagonists and methods of use | |
TW201032823A (en) | Human CGRP receptor binding proteins | |
WO2012172495A1 (en) | Compositions and methods for antibodies targeting tem8 | |
KR20220158053A (en) | Human monoclonal antibody to severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) | |
KR101900435B1 (en) | High affinity human antibodies to human cytomegalovirus (cmv) gb protein | |
JP2020188765A (en) | Binding proteins specific for lox1 and uses thereof | |
TW201143789A (en) | Antigen binding proteins | |
AU2011349124A1 (en) | Anti-P-selectin antibodies and methods of their use and identification | |
KR20230042598A (en) | SARS-CoV-2 neutralizing antibody or fragment thereof | |
CN111518208B (en) | anti-CD 47 antibodies and uses thereof | |
US20220089696A1 (en) | Arenavirus monoclonal antibodies and uses | |
MXPA06003886A (en) | Native immunoglobulin binding reagents and methods for making and using same. | |
JP2020533953A (en) | Antibodies to MAdCAM | |
CN117836322A (en) | Human neutralizing monoclonal antibodies against SARS-CoV-2 and uses thereof | |
CN116406375A (en) | Trimeric antibodies against SARS-CoV-2 spike protein |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |