US20220024929A9 - Inhibitors of cyclin-dependent kinase 7 (cdk7) - Google Patents
Inhibitors of cyclin-dependent kinase 7 (cdk7) Download PDFInfo
- Publication number
- US20220024929A9 US20220024929A9 US17/034,822 US202017034822A US2022024929A9 US 20220024929 A9 US20220024929 A9 US 20220024929A9 US 202017034822 A US202017034822 A US 202017034822A US 2022024929 A9 US2022024929 A9 US 2022024929A9
- Authority
- US
- United States
- Prior art keywords
- optionally substituted
- alkyl
- certain embodiments
- ring
- hydrogen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 102100026810 Cyclin-dependent kinase 7 Human genes 0.000 title claims abstract description 67
- 101710106276 Cyclin-dependent kinase 7 Proteins 0.000 title claims abstract description 63
- 239000003112 inhibitor Substances 0.000 title description 6
- 101150059448 cdk7 gene Proteins 0.000 title 1
- 150000001875 compounds Chemical class 0.000 claims abstract description 203
- 150000003839 salts Chemical class 0.000 claims abstract description 103
- 239000012453 solvate Substances 0.000 claims abstract description 92
- 229940002612 prodrug Drugs 0.000 claims abstract description 85
- 239000000651 prodrug Substances 0.000 claims abstract description 85
- 238000000034 method Methods 0.000 claims abstract description 55
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 49
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 48
- 201000010099 disease Diseases 0.000 claims abstract description 46
- 102000003903 Cyclin-dependent kinases Human genes 0.000 claims abstract description 43
- 108090000266 Cyclin-dependent kinases Proteins 0.000 claims abstract description 43
- 230000002062 proliferating effect Effects 0.000 claims abstract description 27
- 238000013518 transcription Methods 0.000 claims abstract description 13
- 230000035897 transcription Effects 0.000 claims abstract description 13
- 208000023275 Autoimmune disease Diseases 0.000 claims abstract description 11
- 208000027866 inflammatory disease Diseases 0.000 claims abstract description 11
- 206010060999 Benign neoplasm Diseases 0.000 claims abstract description 10
- 206010035226 Plasma cell myeloma Diseases 0.000 claims abstract description 10
- 208000034578 Multiple myelomas Diseases 0.000 claims abstract description 8
- 208000032839 leukemia Diseases 0.000 claims abstract description 8
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 claims abstract description 7
- 206010006187 Breast cancer Diseases 0.000 claims abstract description 7
- 208000026310 Breast neoplasm Diseases 0.000 claims abstract description 7
- 206010009944 Colon cancer Diseases 0.000 claims abstract description 7
- 201000001441 melanoma Diseases 0.000 claims abstract description 7
- 208000011594 Autoinflammatory disease Diseases 0.000 claims abstract description 6
- 208000003174 Brain Neoplasms Diseases 0.000 claims abstract description 6
- 208000011691 Burkitt lymphomas Diseases 0.000 claims abstract description 6
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims abstract description 6
- 208000006168 Ewing Sarcoma Diseases 0.000 claims abstract description 6
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims abstract description 6
- 206010029260 Neuroblastoma Diseases 0.000 claims abstract description 6
- 230000001594 aberrant effect Effects 0.000 claims abstract description 6
- 201000005202 lung cancer Diseases 0.000 claims abstract description 6
- 208000020816 lung neoplasm Diseases 0.000 claims abstract description 6
- 201000008968 osteosarcoma Diseases 0.000 claims abstract description 6
- 239000001257 hydrogen Substances 0.000 claims description 240
- 229910052739 hydrogen Inorganic materials 0.000 claims description 240
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 202
- 125000000623 heterocyclic group Chemical group 0.000 claims description 176
- 125000003107 substituted aryl group Chemical group 0.000 claims description 158
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 claims description 136
- 125000001072 heteroaryl group Chemical group 0.000 claims description 133
- 125000004452 carbocyclyl group Chemical group 0.000 claims description 110
- 125000002837 carbocyclic group Chemical group 0.000 claims description 58
- 230000000694 effects Effects 0.000 claims description 36
- 125000000547 substituted alkyl group Chemical group 0.000 claims description 36
- 229910052736 halogen Inorganic materials 0.000 claims description 35
- 150000002367 halogens Chemical group 0.000 claims description 35
- 125000005017 substituted alkenyl group Chemical group 0.000 claims description 35
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 34
- 125000004426 substituted alkynyl group Chemical group 0.000 claims description 34
- 229910052757 nitrogen Inorganic materials 0.000 claims description 33
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical group [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims description 30
- 239000008194 pharmaceutical composition Substances 0.000 claims description 29
- 229910052717 sulfur Inorganic materials 0.000 claims description 21
- 125000004433 nitrogen atom Chemical group N* 0.000 claims description 20
- 229910052760 oxygen Inorganic materials 0.000 claims description 20
- 229910003827 NRaRb Inorganic materials 0.000 claims description 18
- 230000002401 inhibitory effect Effects 0.000 claims description 18
- 239000012472 biological sample Substances 0.000 claims description 16
- 201000011510 cancer Diseases 0.000 claims description 16
- 125000006413 ring segment Chemical group 0.000 claims description 16
- 125000004430 oxygen atom Chemical group O* 0.000 claims description 14
- 229910052705 radium Inorganic materials 0.000 claims description 14
- 229910052701 rubidium Inorganic materials 0.000 claims description 14
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 12
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 11
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 claims description 7
- 125000005415 substituted alkoxy group Chemical group 0.000 claims description 6
- 230000002018 overexpression Effects 0.000 claims description 5
- 206010041067 Small cell lung cancer Diseases 0.000 claims description 4
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 claims description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 claims description 4
- 208000000587 small cell lung carcinoma Diseases 0.000 claims description 4
- 208000022679 triple-negative breast carcinoma Diseases 0.000 claims description 4
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 claims description 4
- 241000124008 Mammalia Species 0.000 claims description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 3
- 206010005949 Bone cancer Diseases 0.000 claims description 2
- 208000018084 Bone neoplasm Diseases 0.000 claims description 2
- 230000010261 cell growth Effects 0.000 claims description 2
- 150000002431 hydrogen Chemical group 0.000 claims 44
- 125000001183 hydrocarbyl group Chemical group 0.000 claims 12
- 101710150912 Myc protein Proteins 0.000 claims 1
- 239000013078 crystal Substances 0.000 abstract description 82
- 239000000203 mixture Substances 0.000 abstract description 39
- 102000001253 Protein Kinase Human genes 0.000 abstract description 31
- 108060006633 protein kinase Proteins 0.000 abstract description 30
- 238000011282 treatment Methods 0.000 abstract description 19
- 150000004677 hydrates Chemical class 0.000 abstract description 16
- 206010025323 Lymphomas Diseases 0.000 abstract description 13
- 230000033115 angiogenesis Effects 0.000 abstract description 13
- 230000006907 apoptotic process Effects 0.000 abstract description 9
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 abstract description 5
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 abstract description 5
- -1 polycyclic aliphatic hydrocarbons Chemical class 0.000 description 214
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 169
- 235000002639 sodium chloride Nutrition 0.000 description 117
- 125000005647 linker group Chemical group 0.000 description 112
- 125000004432 carbon atom Chemical group C* 0.000 description 63
- 125000000217 alkyl group Chemical group 0.000 description 59
- 125000005842 heteroatom Chemical group 0.000 description 53
- 125000000304 alkynyl group Chemical group 0.000 description 51
- 125000003118 aryl group Chemical group 0.000 description 51
- 125000003342 alkenyl group Chemical group 0.000 description 43
- 150000002430 hydrocarbons Chemical group 0.000 description 41
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 38
- 210000004027 cell Anatomy 0.000 description 35
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 34
- 125000001424 substituent group Chemical group 0.000 description 29
- 108091000080 Phosphotransferase Proteins 0.000 description 28
- 102000020233 phosphotransferase Human genes 0.000 description 28
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 26
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 24
- 101000823316 Homo sapiens Tyrosine-protein kinase ABL1 Proteins 0.000 description 22
- 102100022596 Tyrosine-protein kinase ABL1 Human genes 0.000 description 22
- 125000001309 chloro group Chemical group Cl* 0.000 description 20
- IJGRMHOSHXDMSA-UHFFFAOYSA-N nitrogen Substances N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 20
- 238000005160 1H NMR spectroscopy Methods 0.000 description 19
- 125000001246 bromo group Chemical group Br* 0.000 description 19
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 18
- 241000196324 Embryophyta Species 0.000 description 17
- 125000004429 atom Chemical group 0.000 description 17
- 210000001519 tissue Anatomy 0.000 description 17
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical group [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 16
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 239000003755 preservative agent Substances 0.000 description 15
- 239000001301 oxygen Chemical group 0.000 description 14
- 239000011593 sulfur Chemical group 0.000 description 14
- 125000006708 (C5-C14) heteroaryl group Chemical group 0.000 description 13
- 125000004122 cyclic group Chemical group 0.000 description 13
- 108091007914 CDKs Proteins 0.000 description 12
- 108090000623 proteins and genes Proteins 0.000 description 12
- 150000003254 radicals Chemical class 0.000 description 11
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 11
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 10
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 10
- 235000019441 ethanol Nutrition 0.000 description 10
- 230000005764 inhibitory process Effects 0.000 description 10
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 10
- 125000000008 (C1-C10) alkyl group Chemical group 0.000 description 9
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 9
- 125000006374 C2-C10 alkenyl group Chemical group 0.000 description 9
- 125000005915 C6-C14 aryl group Chemical group 0.000 description 9
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 9
- 125000000753 cycloalkyl group Chemical group 0.000 description 9
- 230000012010 growth Effects 0.000 description 9
- WFOVEDJTASPCIR-UHFFFAOYSA-N 3-[(4-methyl-5-pyridin-4-yl-1,2,4-triazol-3-yl)methylamino]-n-[[2-(trifluoromethyl)phenyl]methyl]benzamide Chemical compound N=1N=C(C=2C=CN=CC=2)N(C)C=1CNC(C=1)=CC=CC=1C(=O)NCC1=CC=CC=C1C(F)(F)F WFOVEDJTASPCIR-UHFFFAOYSA-N 0.000 description 8
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 8
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 8
- 102100038114 Cyclin-dependent kinase 13 Human genes 0.000 description 8
- 101000884348 Homo sapiens Cyclin-dependent kinase 13 Proteins 0.000 description 8
- 229920002472 Starch Polymers 0.000 description 8
- 239000002253 acid Substances 0.000 description 8
- 239000003814 drug Substances 0.000 description 8
- 230000026731 phosphorylation Effects 0.000 description 8
- 238000006366 phosphorylation reaction Methods 0.000 description 8
- 235000018102 proteins Nutrition 0.000 description 8
- 102000004169 proteins and genes Human genes 0.000 description 8
- 235000019698 starch Nutrition 0.000 description 8
- 229940032147 starch Drugs 0.000 description 8
- 239000008107 starch Substances 0.000 description 8
- 208000024891 symptom Diseases 0.000 description 8
- 125000006714 (C3-C10) heterocyclyl group Chemical group 0.000 description 7
- 125000000882 C2-C6 alkenyl group Chemical group 0.000 description 7
- 102100038111 Cyclin-dependent kinase 12 Human genes 0.000 description 7
- 101000884345 Homo sapiens Cyclin-dependent kinase 12 Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 102100026150 Tyrosine-protein kinase Fgr Human genes 0.000 description 7
- 230000002159 abnormal effect Effects 0.000 description 7
- 125000003710 aryl alkyl group Chemical group 0.000 description 7
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 6
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 6
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 6
- 102100032857 Cyclin-dependent kinase 1 Human genes 0.000 description 6
- 101710106279 Cyclin-dependent kinase 1 Proteins 0.000 description 6
- 101000912503 Homo sapiens Tyrosine-protein kinase Fgr Proteins 0.000 description 6
- 101001022129 Homo sapiens Tyrosine-protein kinase Fyn Proteins 0.000 description 6
- 101001047681 Homo sapiens Tyrosine-protein kinase Lck Proteins 0.000 description 6
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 6
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 6
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 6
- 102000001332 SRC Human genes 0.000 description 6
- 108060006706 SRC Proteins 0.000 description 6
- 102100027053 Tyrosine-protein kinase Blk Human genes 0.000 description 6
- 102100040959 Tyrosine-protein kinase FRK Human genes 0.000 description 6
- 101710089880 Tyrosine-protein kinase FRK Proteins 0.000 description 6
- 102100035221 Tyrosine-protein kinase Fyn Human genes 0.000 description 6
- 102100024036 Tyrosine-protein kinase Lck Human genes 0.000 description 6
- 102100026857 Tyrosine-protein kinase Lyn Human genes 0.000 description 6
- 239000004480 active ingredient Substances 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 229910052799 carbon Inorganic materials 0.000 description 6
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 6
- GTCAXTIRRLKXRU-UHFFFAOYSA-N methyl carbamate Chemical compound COC(N)=O GTCAXTIRRLKXRU-UHFFFAOYSA-N 0.000 description 6
- 239000002904 solvent Substances 0.000 description 6
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 6
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 5
- 102000001805 Bromodomains Human genes 0.000 description 5
- 125000003601 C2-C6 alkynyl group Chemical group 0.000 description 5
- 125000001313 C5-C10 heteroaryl group Chemical group 0.000 description 5
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 5
- 102100033145 Cyclin-dependent kinase 19 Human genes 0.000 description 5
- 102100036239 Cyclin-dependent kinase 2 Human genes 0.000 description 5
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 5
- 101000944345 Homo sapiens Cyclin-dependent kinase 19 Proteins 0.000 description 5
- 101000984551 Homo sapiens Tyrosine-protein kinase Blk Proteins 0.000 description 5
- 101001054878 Homo sapiens Tyrosine-protein kinase Lyn Proteins 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 235000010443 alginic acid Nutrition 0.000 description 5
- 229920000615 alginic acid Polymers 0.000 description 5
- 229950010817 alvocidib Drugs 0.000 description 5
- BIIVYFLTOXDAOV-YVEFUNNKSA-N alvocidib Chemical compound O[C@@H]1CN(C)CC[C@@H]1C1=C(O)C=C(O)C2=C1OC(C=1C(=CC=CC=1)Cl)=CC2=O BIIVYFLTOXDAOV-YVEFUNNKSA-N 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 125000002619 bicyclic group Chemical group 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 230000001939 inductive effect Effects 0.000 description 5
- 125000002950 monocyclic group Chemical group 0.000 description 5
- 125000006574 non-aromatic ring group Chemical group 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 125000006239 protecting group Chemical group 0.000 description 5
- 229920006395 saturated elastomer Polymers 0.000 description 5
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 5
- 239000000758 substrate Substances 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 125000006706 (C3-C6) carbocyclyl group Chemical group 0.000 description 4
- 125000006570 (C5-C6) heteroaryl group Chemical group 0.000 description 4
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 4
- 125000006163 5-membered heteroaryl group Chemical group 0.000 description 4
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical class CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 4
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 4
- KXDAEFPNCMNJSK-UHFFFAOYSA-N Benzamide Chemical compound NC(=O)C1=CC=CC=C1 KXDAEFPNCMNJSK-UHFFFAOYSA-N 0.000 description 4
- 108091005575 Bromodomain-containing proteins Proteins 0.000 description 4
- 125000000041 C6-C10 aryl group Chemical group 0.000 description 4
- 108010077544 Chromatin Proteins 0.000 description 4
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 4
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 4
- 102100023272 Dual specificity mitogen-activated protein kinase kinase 5 Human genes 0.000 description 4
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 102100030779 Ephrin type-B receptor 1 Human genes 0.000 description 4
- 102100031968 Ephrin type-B receptor 2 Human genes 0.000 description 4
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 4
- 208000017604 Hodgkin disease Diseases 0.000 description 4
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 4
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 4
- 101000911952 Homo sapiens Cyclin-dependent kinase 7 Proteins 0.000 description 4
- 101001064150 Homo sapiens Ephrin type-B receptor 1 Proteins 0.000 description 4
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 4
- 206010027476 Metastases Diseases 0.000 description 4
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 4
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 4
- 229910002651 NO3 Inorganic materials 0.000 description 4
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 4
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical compound CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 4
- 206010060862 Prostate cancer Diseases 0.000 description 4
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 4
- 102000009572 RNA Polymerase II Human genes 0.000 description 4
- 108010009460 RNA Polymerase II Proteins 0.000 description 4
- 102100032771 Serine/threonine-protein kinase SIK1 Human genes 0.000 description 4
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 4
- 229920002125 Sokalan® Polymers 0.000 description 4
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 4
- 210000001744 T-lymphocyte Anatomy 0.000 description 4
- 102100031167 Tyrosine-protein kinase CSK Human genes 0.000 description 4
- 102100027389 Tyrosine-protein kinase HCK Human genes 0.000 description 4
- 125000001931 aliphatic group Chemical group 0.000 description 4
- 150000001412 amines Chemical class 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 229940050390 benzoate Drugs 0.000 description 4
- PUJDIJCNWFYVJX-UHFFFAOYSA-N benzyl carbamate Chemical compound NC(=O)OCC1=CC=CC=C1 PUJDIJCNWFYVJX-UHFFFAOYSA-N 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 150000001721 carbon Chemical group 0.000 description 4
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 210000003483 chromatin Anatomy 0.000 description 4
- 229940043378 cyclin-dependent kinase inhibitor Drugs 0.000 description 4
- 108010072268 cyclin-dependent kinase-activating kinase Proteins 0.000 description 4
- 150000002148 esters Chemical class 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 230000009401 metastasis Effects 0.000 description 4
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 4
- 201000005962 mycosis fungoides Diseases 0.000 description 4
- 206010028537 myelofibrosis Diseases 0.000 description 4
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 4
- XSXHWVKGUXMUQE-UHFFFAOYSA-N osmium dioxide Inorganic materials O=[Os]=O XSXHWVKGUXMUQE-UHFFFAOYSA-N 0.000 description 4
- 230000001575 pathological effect Effects 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 125000004434 sulfur atom Chemical group 0.000 description 4
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 4
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 4
- 125000006656 (C2-C4) alkenyl group Chemical group 0.000 description 3
- 125000006650 (C2-C4) alkynyl group Chemical group 0.000 description 3
- 125000006376 (C3-C10) cycloalkyl group Chemical group 0.000 description 3
- 125000005913 (C3-C6) cycloalkyl group Chemical group 0.000 description 3
- 125000006704 (C5-C6) cycloalkyl group Chemical group 0.000 description 3
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 3
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 3
- 125000001494 2-propynyl group Chemical group [H]C#CC([H])([H])* 0.000 description 3
- 125000006164 6-membered heteroaryl group Chemical group 0.000 description 3
- 102000051485 Bcl-2 family Human genes 0.000 description 3
- 108700038897 Bcl-2 family Proteins 0.000 description 3
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 3
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 3
- 229920002261 Corn starch Polymers 0.000 description 3
- 108050006400 Cyclin Proteins 0.000 description 3
- 102000016736 Cyclin Human genes 0.000 description 3
- 108010068237 Cyclin H Proteins 0.000 description 3
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 3
- 108010025454 Cyclin-Dependent Kinase 5 Proteins 0.000 description 3
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 description 3
- 102100036883 Cyclin-H Human genes 0.000 description 3
- 102100023263 Cyclin-dependent kinase 10 Human genes 0.000 description 3
- 102100038113 Cyclin-dependent kinase 14 Human genes 0.000 description 3
- 102100033250 Cyclin-dependent kinase 15 Human genes 0.000 description 3
- 102100033245 Cyclin-dependent kinase 16 Human genes 0.000 description 3
- 102100033234 Cyclin-dependent kinase 17 Human genes 0.000 description 3
- 102100033144 Cyclin-dependent kinase 18 Human genes 0.000 description 3
- 102100034741 Cyclin-dependent kinase 20 Human genes 0.000 description 3
- 102100036329 Cyclin-dependent kinase 3 Human genes 0.000 description 3
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 3
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 description 3
- 102100024456 Cyclin-dependent kinase 8 Human genes 0.000 description 3
- 102100024457 Cyclin-dependent kinase 9 Human genes 0.000 description 3
- 102100026805 Cyclin-dependent-like kinase 5 Human genes 0.000 description 3
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 3
- 102100030322 Ephrin type-A receptor 1 Human genes 0.000 description 3
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 3
- 102100021616 Ephrin type-A receptor 4 Human genes 0.000 description 3
- 102100021605 Ephrin type-A receptor 5 Human genes 0.000 description 3
- 102100021601 Ephrin type-A receptor 8 Human genes 0.000 description 3
- 102100031982 Ephrin type-B receptor 3 Human genes 0.000 description 3
- 102100031983 Ephrin type-B receptor 4 Human genes 0.000 description 3
- 102100036725 Epithelial discoidin domain-containing receptor 1 Human genes 0.000 description 3
- 101710131668 Epithelial discoidin domain-containing receptor 1 Proteins 0.000 description 3
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 3
- 208000007465 Giant cell arteritis Diseases 0.000 description 3
- 208000024869 Goodpasture syndrome Diseases 0.000 description 3
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 3
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 3
- 101000908138 Homo sapiens Cyclin-dependent kinase 10 Proteins 0.000 description 3
- 101000884374 Homo sapiens Cyclin-dependent kinase 14 Proteins 0.000 description 3
- 101000944355 Homo sapiens Cyclin-dependent kinase 15 Proteins 0.000 description 3
- 101000944357 Homo sapiens Cyclin-dependent kinase 16 Proteins 0.000 description 3
- 101000944358 Homo sapiens Cyclin-dependent kinase 17 Proteins 0.000 description 3
- 101000945708 Homo sapiens Cyclin-dependent kinase 20 Proteins 0.000 description 3
- 101000715946 Homo sapiens Cyclin-dependent kinase 3 Proteins 0.000 description 3
- 101000980937 Homo sapiens Cyclin-dependent kinase 8 Proteins 0.000 description 3
- 101000980930 Homo sapiens Cyclin-dependent kinase 9 Proteins 0.000 description 3
- 101001064458 Homo sapiens Ephrin type-B receptor 3 Proteins 0.000 description 3
- 101000984753 Homo sapiens Serine/threonine-protein kinase B-raf Proteins 0.000 description 3
- 101000922131 Homo sapiens Tyrosine-protein kinase CSK Proteins 0.000 description 3
- 101000934996 Homo sapiens Tyrosine-protein kinase JAK3 Proteins 0.000 description 3
- 208000029523 Interstitial Lung disease Diseases 0.000 description 3
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 101100354317 Mus musculus Ptk6 gene Proteins 0.000 description 3
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 3
- 108010051742 Platelet-Derived Growth Factor beta Receptor Proteins 0.000 description 3
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 3
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 3
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 3
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 3
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 3
- 101150083487 SIK1 gene Proteins 0.000 description 3
- 229910006069 SO3H Inorganic materials 0.000 description 3
- 229940124639 Selective inhibitor Drugs 0.000 description 3
- 102100027103 Serine/threonine-protein kinase B-raf Human genes 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- 101001045447 Synechocystis sp. (strain PCC 6803 / Kazusa) Sensor histidine kinase Hik2 Proteins 0.000 description 3
- 239000007983 Tris buffer Substances 0.000 description 3
- 102100025387 Tyrosine-protein kinase JAK3 Human genes 0.000 description 3
- 102100039079 Tyrosine-protein kinase TXK Human genes 0.000 description 3
- 229960000583 acetic acid Drugs 0.000 description 3
- 235000011054 acetic acid Nutrition 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 239000000783 alginic acid Substances 0.000 description 3
- 229960001126 alginic acid Drugs 0.000 description 3
- 150000004781 alginic acids Chemical class 0.000 description 3
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 3
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 3
- SNAAJJQQZSMGQD-UHFFFAOYSA-N aluminum magnesium Chemical compound [Mg].[Al] SNAAJJQQZSMGQD-UHFFFAOYSA-N 0.000 description 3
- 125000000129 anionic group Chemical group 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 235000010323 ascorbic acid Nutrition 0.000 description 3
- 239000011668 ascorbic acid Substances 0.000 description 3
- 239000002585 base Substances 0.000 description 3
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 3
- 125000001584 benzyloxycarbonyl group Chemical group C(=O)(OCC1=CC=CC=C1)* 0.000 description 3
- 229910052794 bromium Inorganic materials 0.000 description 3
- 229910000019 calcium carbonate Inorganic materials 0.000 description 3
- 229960003563 calcium carbonate Drugs 0.000 description 3
- 235000010216 calcium carbonate Nutrition 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 239000001768 carboxy methyl cellulose Substances 0.000 description 3
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 3
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 3
- 229940105329 carboxymethylcellulose Drugs 0.000 description 3
- 230000022131 cell cycle Effects 0.000 description 3
- 239000002738 chelating agent Substances 0.000 description 3
- 239000000460 chlorine Substances 0.000 description 3
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 3
- 229960004106 citric acid Drugs 0.000 description 3
- 235000015165 citric acid Nutrition 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 229940099112 cornstarch Drugs 0.000 description 3
- 238000002425 crystallisation Methods 0.000 description 3
- 230000008025 crystallization Effects 0.000 description 3
- 239000002875 cyclin dependent kinase inhibitor Substances 0.000 description 3
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 3
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 3
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 description 3
- 201000001981 dermatomyositis Diseases 0.000 description 3
- 235000014113 dietary fatty acids Nutrition 0.000 description 3
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 3
- 239000003995 emulsifying agent Substances 0.000 description 3
- 239000000194 fatty acid Substances 0.000 description 3
- 229930195729 fatty acid Natural products 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 125000000524 functional group Chemical group 0.000 description 3
- 229940050410 gluconate Drugs 0.000 description 3
- 208000025750 heavy chain disease Diseases 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- 230000002757 inflammatory effect Effects 0.000 description 3
- 208000014018 liver neoplasm Diseases 0.000 description 3
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 3
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 3
- 229920000609 methyl cellulose Polymers 0.000 description 3
- 239000001923 methylcellulose Substances 0.000 description 3
- 235000010981 methylcellulose Nutrition 0.000 description 3
- 230000005012 migration Effects 0.000 description 3
- 238000013508 migration Methods 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 125000003386 piperidinyl group Chemical group 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 208000003476 primary myelofibrosis Diseases 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 125000004076 pyridyl group Chemical group 0.000 description 3
- 125000000714 pyrimidinyl group Chemical group 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 3
- 229940095064 tartrate Drugs 0.000 description 3
- 238000003419 tautomerization reaction Methods 0.000 description 3
- 206010043207 temporal arteritis Diseases 0.000 description 3
- 125000001412 tetrahydropyranyl group Chemical group 0.000 description 3
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 description 3
- 230000002103 transcriptional effect Effects 0.000 description 3
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 3
- 125000002221 trityl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C([*])(C1=C(C(=C(C(=C1[H])[H])[H])[H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 3
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 3
- 239000001993 wax Substances 0.000 description 3
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 3
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 description 2
- 125000004209 (C1-C8) alkyl group Chemical group 0.000 description 2
- 125000006552 (C3-C8) cycloalkyl group Chemical group 0.000 description 2
- 125000004973 1-butenyl group Chemical group C(=CCC)* 0.000 description 2
- 125000004972 1-butynyl group Chemical group [H]C([H])([H])C([H])([H])C#C* 0.000 description 2
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- 125000000530 1-propynyl group Chemical group [H]C([H])([H])C#C* 0.000 description 2
- LJCZNYWLQZZIOS-UHFFFAOYSA-N 2,2,2-trichlorethoxycarbonyl chloride Chemical compound ClC(=O)OCC(Cl)(Cl)Cl LJCZNYWLQZZIOS-UHFFFAOYSA-N 0.000 description 2
- 125000004974 2-butenyl group Chemical group C(C=CC)* 0.000 description 2
- 125000000069 2-butynyl group Chemical group [H]C([H])([H])C#CC([H])([H])* 0.000 description 2
- LSBDFXRDZJMBSC-UHFFFAOYSA-N 2-phenylacetamide Chemical class NC(=O)CC1=CC=CC=C1 LSBDFXRDZJMBSC-UHFFFAOYSA-N 0.000 description 2
- 125000000094 2-phenylethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])* 0.000 description 2
- XMIIGOLPHOKFCH-UHFFFAOYSA-M 3-phenylpropionate Chemical compound [O-]C(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-M 0.000 description 2
- PXACTUVBBMDKRW-UHFFFAOYSA-M 4-bromobenzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=C(Br)C=C1 PXACTUVBBMDKRW-UHFFFAOYSA-M 0.000 description 2
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 2
- JOOXCMJARBKPKM-UHFFFAOYSA-M 4-oxopentanoate Chemical compound CC(=O)CCC([O-])=O JOOXCMJARBKPKM-UHFFFAOYSA-M 0.000 description 2
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 2
- GDXXYJRQFQZYNL-UHFFFAOYSA-N 9h-fluoren-1-ylmethyl carbamate Chemical compound C1C2=CC=CC=C2C2=C1C(COC(=O)N)=CC=C2 GDXXYJRQFQZYNL-UHFFFAOYSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 2
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- 201000003076 Angiosarcoma Diseases 0.000 description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 2
- 206010073360 Appendix cancer Diseases 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 2
- ZOXJGFHDIHLPTG-UHFFFAOYSA-N Boron Chemical group [B] ZOXJGFHDIHLPTG-UHFFFAOYSA-N 0.000 description 2
- QFOHBWFCKVYLES-UHFFFAOYSA-N Butylparaben Chemical compound CCCCOC(=O)C1=CC=C(O)C=C1 QFOHBWFCKVYLES-UHFFFAOYSA-N 0.000 description 2
- 125000004648 C2-C8 alkenyl group Chemical group 0.000 description 2
- 125000004649 C2-C8 alkynyl group Chemical group 0.000 description 2
- 229940126074 CDK kinase inhibitor Drugs 0.000 description 2
- 229940125888 CDK7 inhibitor Drugs 0.000 description 2
- 201000004085 CLL/SLL Diseases 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 206010007275 Carcinoid tumour Diseases 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- 102100040428 Chitobiosyldiphosphodolichol beta-mannosyltransferase Human genes 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 229920002785 Croscarmellose sodium Polymers 0.000 description 2
- 102100034770 Cyclin-dependent kinase inhibitor 3 Human genes 0.000 description 2
- 102100027907 Cytoplasmic tyrosine-protein kinase BMX Human genes 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- 101100291385 Drosophila melanogaster p38a gene Proteins 0.000 description 2
- 101150076616 EPHA2 gene Proteins 0.000 description 2
- 101150097734 EPHB2 gene Proteins 0.000 description 2
- 108010055211 EphA1 Receptor Proteins 0.000 description 2
- 108010055334 EphB2 Receptor Proteins 0.000 description 2
- 108010055323 EphB4 Receptor Proteins 0.000 description 2
- 101150078651 Epha4 gene Proteins 0.000 description 2
- 101150025643 Epha5 gene Proteins 0.000 description 2
- 208000032027 Essential Thrombocythemia Diseases 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical class NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 206010018364 Glomerulonephritis Diseases 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 102100031132 Glucose-6-phosphate isomerase Human genes 0.000 description 2
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 2
- 208000001258 Hemangiosarcoma Diseases 0.000 description 2
- 102100022603 Homeodomain-interacting protein kinase 4 Human genes 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000891557 Homo sapiens Chitobiosyldiphosphodolichol beta-mannosyltransferase Proteins 0.000 description 2
- 101000945639 Homo sapiens Cyclin-dependent kinase inhibitor 3 Proteins 0.000 description 2
- 101000935548 Homo sapiens Cytoplasmic tyrosine-protein kinase BMX Proteins 0.000 description 2
- 101001115390 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 5 Proteins 0.000 description 2
- 101000898676 Homo sapiens Ephrin type-A receptor 8 Proteins 0.000 description 2
- 101001045363 Homo sapiens Homeodomain-interacting protein kinase 4 Proteins 0.000 description 2
- 101000852483 Homo sapiens Interleukin-1 receptor-associated kinase 1 Proteins 0.000 description 2
- 101000977771 Homo sapiens Interleukin-1 receptor-associated kinase 4 Proteins 0.000 description 2
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 2
- 101000794228 Homo sapiens Mitotic checkpoint serine/threonine-protein kinase BUB1 beta Proteins 0.000 description 2
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 2
- 101000606502 Homo sapiens Protein-tyrosine kinase 6 Proteins 0.000 description 2
- 101000579425 Homo sapiens Proto-oncogene tyrosine-protein kinase receptor Ret Proteins 0.000 description 2
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 2
- 101000932478 Homo sapiens Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 2
- 101000617778 Homo sapiens SNF-related serine/threonine-protein kinase Proteins 0.000 description 2
- 101000777277 Homo sapiens Serine/threonine-protein kinase Chk2 Proteins 0.000 description 2
- 101000588553 Homo sapiens Serine/threonine-protein kinase Nek9 Proteins 0.000 description 2
- 101000983111 Homo sapiens Serine/threonine-protein kinase PAK 6 Proteins 0.000 description 2
- 101000709250 Homo sapiens Serine/threonine-protein kinase SIK2 Proteins 0.000 description 2
- 101000864831 Homo sapiens Serine/threonine-protein kinase Sgk3 Proteins 0.000 description 2
- 101000838578 Homo sapiens Serine/threonine-protein kinase TAO2 Proteins 0.000 description 2
- 101000823271 Homo sapiens Tyrosine-protein kinase ABL2 Proteins 0.000 description 2
- 101000606067 Homo sapiens Tyrosine-protein kinase TXK Proteins 0.000 description 2
- 101000889732 Homo sapiens Tyrosine-protein kinase Tec Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 2
- 206010048643 Hypereosinophilic syndrome Diseases 0.000 description 2
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102100036342 Interleukin-1 receptor-associated kinase 1 Human genes 0.000 description 2
- 102100023533 Interleukin-1 receptor-associated kinase 4 Human genes 0.000 description 2
- 206010070999 Intraductal papillary mucinous neoplasm Diseases 0.000 description 2
- 208000007766 Kaposi sarcoma Diseases 0.000 description 2
- 206010023347 Keratoacanthoma Diseases 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 208000018142 Leiomyosarcoma Diseases 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 108010068305 MAP Kinase Kinase 5 Proteins 0.000 description 2
- 102100033610 MAP kinase-interacting serine/threonine-protein kinase 2 Human genes 0.000 description 2
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 2
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical group [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 2
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 2
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 2
- 102100024299 Maternal embryonic leucine zipper kinase Human genes 0.000 description 2
- 101710154611 Maternal embryonic leucine zipper kinase Proteins 0.000 description 2
- BAVYZALUXZFZLV-UHFFFAOYSA-N Methylamine Chemical compound NC BAVYZALUXZFZLV-UHFFFAOYSA-N 0.000 description 2
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 2
- 102100026888 Mitogen-activated protein kinase kinase kinase 7 Human genes 0.000 description 2
- 102100026907 Mitogen-activated protein kinase kinase kinase 8 Human genes 0.000 description 2
- 102100030144 Mitotic checkpoint serine/threonine-protein kinase BUB1 beta Human genes 0.000 description 2
- 208000014767 Myeloproliferative disease Diseases 0.000 description 2
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 2
- XUYPXLNMDZIRQH-LURJTMIESA-N N-acetyl-L-methionine Chemical class CSCC[C@@H](C(O)=O)NC(C)=O XUYPXLNMDZIRQH-LURJTMIESA-N 0.000 description 2
- 208000009905 Neurofibromatoses Diseases 0.000 description 2
- 208000033755 Neutrophilic Chronic Leukemia Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 102100022673 Nuclear receptor subfamily 4 group A member 3 Human genes 0.000 description 2
- 108010039798 PCTAIRE-3 protein kinase Proteins 0.000 description 2
- 206010033701 Papillary thyroid cancer Diseases 0.000 description 2
- 208000034038 Pathologic Neovascularization Diseases 0.000 description 2
- 208000027190 Peripheral T-cell lymphomas Diseases 0.000 description 2
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical group [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 2
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 2
- 206010035664 Pneumonia Diseases 0.000 description 2
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 206010057846 Primitive neuroectodermal tumour Diseases 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- 102100039810 Protein-tyrosine kinase 6 Human genes 0.000 description 2
- 102100028286 Proto-oncogene tyrosine-protein kinase receptor Ret Human genes 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 2
- 102100022010 SNF-related serine/threonine-protein kinase Human genes 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- 102100031075 Serine/threonine-protein kinase Chk2 Human genes 0.000 description 2
- 102100031206 Serine/threonine-protein kinase N1 Human genes 0.000 description 2
- 102100031398 Serine/threonine-protein kinase Nek9 Human genes 0.000 description 2
- 102100026840 Serine/threonine-protein kinase PAK 6 Human genes 0.000 description 2
- 102100034377 Serine/threonine-protein kinase SIK2 Human genes 0.000 description 2
- 102100030071 Serine/threonine-protein kinase Sgk3 Human genes 0.000 description 2
- 102100028949 Serine/threonine-protein kinase TAO2 Human genes 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical group [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 2
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 201000009594 Systemic Scleroderma Diseases 0.000 description 2
- 206010042953 Systemic sclerosis Diseases 0.000 description 2
- 208000031673 T-Cell Cutaneous Lymphoma Diseases 0.000 description 2
- 208000031672 T-Cell Peripheral Lymphoma Diseases 0.000 description 2
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 2
- 102000006288 Transcription Factor TFIIH Human genes 0.000 description 2
- 108010083256 Transcription Factor TFIIH Proteins 0.000 description 2
- 102100022651 Tyrosine-protein kinase ABL2 Human genes 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- 208000008383 Wilms tumor Diseases 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 2
- 208000017733 acquired polycythemia vera Diseases 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 125000002015 acyclic group Chemical group 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 2
- 208000011341 adult acute respiratory distress syndrome Diseases 0.000 description 2
- 201000000028 adult respiratory distress syndrome Diseases 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 229940023476 agar Drugs 0.000 description 2
- 235000010419 agar Nutrition 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 235000001014 amino acid Nutrition 0.000 description 2
- 229940024606 amino acid Drugs 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 150000008064 anhydrides Chemical class 0.000 description 2
- 230000000843 anti-fungal effect Effects 0.000 description 2
- 230000000845 anti-microbial effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 208000021780 appendiceal neoplasm Diseases 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 239000000440 bentonite Substances 0.000 description 2
- 229910000278 bentonite Inorganic materials 0.000 description 2
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 2
- 229960000686 benzalkonium chloride Drugs 0.000 description 2
- 229940077388 benzenesulfonate Drugs 0.000 description 2
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 2
- 125000004604 benzisothiazolyl group Chemical group S1N=C(C2=C1C=CC=C2)* 0.000 description 2
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 2
- WGQKYBSKWIADBV-UHFFFAOYSA-N benzylamine Chemical compound NCC1=CC=CC=C1 WGQKYBSKWIADBV-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- XMIIGOLPHOKFCH-UHFFFAOYSA-N beta-phenylpropanoic acid Natural products OC(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 229910052796 boron Inorganic materials 0.000 description 2
- 206010006451 bronchitis Diseases 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229960005069 calcium Drugs 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 2
- 208000035269 cancer or benign tumor Diseases 0.000 description 2
- 208000002458 carcinoid tumor Diseases 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 229960002798 cetrimide Drugs 0.000 description 2
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 2
- NFCRBQADEGXVDL-UHFFFAOYSA-M cetylpyridinium chloride monohydrate Chemical compound O.[Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 NFCRBQADEGXVDL-UHFFFAOYSA-M 0.000 description 2
- 239000013522 chelant Substances 0.000 description 2
- 229910052801 chlorine Inorganic materials 0.000 description 2
- 229960004926 chlorobutanol Drugs 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 208000023738 chronic lymphocytic leukemia/small lymphocytic lymphoma Diseases 0.000 description 2
- 201000010903 chronic neutrophilic leukemia Diseases 0.000 description 2
- 239000001767 crosslinked sodium carboxy methyl cellulose Substances 0.000 description 2
- 201000007241 cutaneous T cell lymphoma Diseases 0.000 description 2
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 2
- 150000001934 cyclohexanes Chemical class 0.000 description 2
- 125000000640 cyclooctyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 2
- 150000001942 cyclopropanes Chemical class 0.000 description 2
- PGRHXDWITVMQBC-UHFFFAOYSA-N dehydroacetic acid Chemical compound CC(=O)C1C(=O)OC(C)=CC1=O PGRHXDWITVMQBC-UHFFFAOYSA-N 0.000 description 2
- 235000019700 dicalcium phosphate Nutrition 0.000 description 2
- 208000017055 digestive system neuroendocrine neoplasm Diseases 0.000 description 2
- 125000005982 diphenylmethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])(*)C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 2
- SMVRDGHCVNAOIN-UHFFFAOYSA-L disodium;1-dodecoxydodecane;sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O.CCCCCCCCCCCCOCCCCCCCCCCCC SMVRDGHCVNAOIN-UHFFFAOYSA-L 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 239000002270 dispersing agent Substances 0.000 description 2
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 description 2
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 2
- 229940043264 dodecyl sulfate Drugs 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 2
- MMXKVMNBHPAILY-UHFFFAOYSA-N ethyl laurate Chemical compound CCCCCCCCCCCC(=O)OCC MMXKVMNBHPAILY-UHFFFAOYSA-N 0.000 description 2
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 2
- 229910052731 fluorine Inorganic materials 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 102000034356 gene-regulatory proteins Human genes 0.000 description 2
- 108091006104 gene-regulatory proteins Proteins 0.000 description 2
- 239000003979 granulating agent Substances 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 125000004475 heteroaralkyl group Chemical group 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 2
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000001965 increasing effect Effects 0.000 description 2
- 125000001041 indolyl group Chemical group 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 208000036971 interstitial lung disease 2 Diseases 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 239000011630 iodine Substances 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 229940001447 lactate Drugs 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 229940049920 malate Drugs 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 208000020968 mature T-cell and NK-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 230000001394 metastastic effect Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 2
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 2
- 229960002216 methylparaben Drugs 0.000 description 2
- 125000004092 methylthiomethyl group Chemical group [H]C([H])([H])SC([H])([H])* 0.000 description 2
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 2
- 229940016286 microcrystalline cellulose Drugs 0.000 description 2
- 239000008108 microcrystalline cellulose Substances 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- OBJNFLYHUXWUPF-IZZDOVSWSA-N n-[3-[[5-chloro-4-(1h-indol-3-yl)pyrimidin-2-yl]amino]phenyl]-4-[[(e)-4-(dimethylamino)but-2-enoyl]amino]benzamide Chemical compound C1=CC(NC(=O)/C=C/CN(C)C)=CC=C1C(=O)NC1=CC=CC(NC=2N=C(C(Cl)=CN=2)C=2C3=CC=CC=C3NC=2)=C1 OBJNFLYHUXWUPF-IZZDOVSWSA-N 0.000 description 2
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 2
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- 238000013188 needle biopsy Methods 0.000 description 2
- 210000005170 neoplastic cell Anatomy 0.000 description 2
- 201000004931 neurofibromatosis Diseases 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- VLTRZXGMWDSKGL-UHFFFAOYSA-N perchloric acid Chemical compound OCl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-N 0.000 description 2
- 239000008177 pharmaceutical agent Substances 0.000 description 2
- 229960003742 phenol Drugs 0.000 description 2
- 229940067107 phenylethyl alcohol Drugs 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- 239000011574 phosphorus Chemical group 0.000 description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 description 2
- 208000037244 polycythemia vera Diseases 0.000 description 2
- 239000008389 polyethoxylated castor oil Substances 0.000 description 2
- 208000005987 polymyositis Diseases 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 229960003975 potassium Drugs 0.000 description 2
- 235000007686 potassium Nutrition 0.000 description 2
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 2
- RWPGFSMJFRPDDP-UHFFFAOYSA-L potassium metabisulfite Chemical compound [K+].[K+].[O-]S(=O)S([O-])(=O)=O RWPGFSMJFRPDDP-UHFFFAOYSA-L 0.000 description 2
- 229940043349 potassium metabisulfite Drugs 0.000 description 2
- 235000010263 potassium metabisulphite Nutrition 0.000 description 2
- 201000007271 pre-malignant neoplasm Diseases 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- 208000025638 primary cutaneous T-cell non-Hodgkin lymphoma Diseases 0.000 description 2
- 208000029340 primitive neuroectodermal tumor Diseases 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 102000004196 processed proteins & peptides Human genes 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 235000019260 propionic acid Nutrition 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 125000003226 pyrazolyl group Chemical group 0.000 description 2
- 125000002943 quinolinyl group Chemical group N1=C(C=CC2=CC=CC=C12)* 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 2
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 2
- 229910052710 silicon Chemical group 0.000 description 2
- 239000010703 silicon Chemical group 0.000 description 2
- 208000017520 skin disease Diseases 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 229940083542 sodium Drugs 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 235000010413 sodium alginate Nutrition 0.000 description 2
- 239000000661 sodium alginate Substances 0.000 description 2
- 229940005550 sodium alginate Drugs 0.000 description 2
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 2
- 235000010234 sodium benzoate Nutrition 0.000 description 2
- 239000004299 sodium benzoate Substances 0.000 description 2
- 229940001607 sodium bisulfite Drugs 0.000 description 2
- 229910000029 sodium carbonate Inorganic materials 0.000 description 2
- 235000017550 sodium carbonate Nutrition 0.000 description 2
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 2
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 2
- 229940001584 sodium metabisulfite Drugs 0.000 description 2
- 235000010262 sodium metabisulphite Nutrition 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 235000011008 sodium phosphates Nutrition 0.000 description 2
- 229920003109 sodium starch glycolate Polymers 0.000 description 2
- 229940079832 sodium starch glycolate Drugs 0.000 description 2
- 239000008109 sodium starch glycolate Substances 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 238000003797 solvolysis reaction Methods 0.000 description 2
- 235000010199 sorbic acid Nutrition 0.000 description 2
- 239000004334 sorbic acid Substances 0.000 description 2
- 229940075582 sorbic acid Drugs 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 108010087686 src-Family Kinases Proteins 0.000 description 2
- 102000009076 src-Family Kinases Human genes 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 239000011975 tartaric acid Substances 0.000 description 2
- 235000002906 tartaric acid Nutrition 0.000 description 2
- ILMRJRBKQSSXGY-UHFFFAOYSA-N tert-butyl(dimethyl)silicon Chemical group C[Si](C)C(C)(C)C ILMRJRBKQSSXGY-UHFFFAOYSA-N 0.000 description 2
- 125000003718 tetrahydrofuranyl group Chemical group 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 235000008521 threonine Nutrition 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- URAYPUMNDPQOKB-UHFFFAOYSA-N triacetin Chemical compound CC(=O)OCC(OC(C)=O)COC(C)=O URAYPUMNDPQOKB-UHFFFAOYSA-N 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 125000004044 trifluoroacetyl group Chemical group FC(C(=O)*)(F)F 0.000 description 2
- 125000002023 trifluoromethyl group Chemical group FC(F)(F)* 0.000 description 2
- 125000000025 triisopropylsilyl group Chemical group C(C)(C)[Si](C(C)C)(C(C)C)* 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 230000002792 vascular Effects 0.000 description 2
- 230000004862 vasculogenesis Effects 0.000 description 2
- 229910052725 zinc Inorganic materials 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- LSPHULWDVZXLIL-UHFFFAOYSA-N (+/-)-Camphoric acid Chemical compound CC1(C)C(C(O)=O)CCC1(C)C(O)=O LSPHULWDVZXLIL-UHFFFAOYSA-N 0.000 description 1
- DFNJPPOAVCXQQQ-UHFFFAOYSA-N (1,1,1-trichloro-2-methylpropan-2-yl) carbamate Chemical compound ClC(Cl)(Cl)C(C)(C)OC(N)=O DFNJPPOAVCXQQQ-UHFFFAOYSA-N 0.000 description 1
- AXTXAVIVKGDCLE-UHFFFAOYSA-N (1,1-dibromo-2-methylpropan-2-yl) carbamate Chemical compound BrC(Br)C(C)(C)OC(N)=O AXTXAVIVKGDCLE-UHFFFAOYSA-N 0.000 description 1
- AFCTUKSQTSHXEZ-UHFFFAOYSA-N (1-cyano-2-methylpropan-2-yl) carbamate Chemical compound N#CCC(C)(C)OC(N)=O AFCTUKSQTSHXEZ-UHFFFAOYSA-N 0.000 description 1
- FTVXFBJENACRRL-UHFFFAOYSA-N (1-hydroxypiperidin-2-yl) carbamate Chemical compound NC(=O)OC1CCCCN1O FTVXFBJENACRRL-UHFFFAOYSA-N 0.000 description 1
- KLWCNEYVHPBUNM-UHFFFAOYSA-N (1-methylcyclobutyl) carbamate Chemical compound NC(=O)OC1(C)CCC1 KLWCNEYVHPBUNM-UHFFFAOYSA-N 0.000 description 1
- AKIHTGIGOHBKGE-UHFFFAOYSA-N (1-methylcyclohexyl) carbamate Chemical compound NC(=O)OC1(C)CCCCC1 AKIHTGIGOHBKGE-UHFFFAOYSA-N 0.000 description 1
- ZLIHDHDAJVINAN-UHFFFAOYSA-N (2,4,6-trimethyl-3-pyridin-2-ylphenyl)methanimine Chemical compound CC1=C(C=N)C(C)=CC(C)=C1C1=CC=CC=N1 ZLIHDHDAJVINAN-UHFFFAOYSA-N 0.000 description 1
- KJOPTLWVYZCJBX-UHFFFAOYSA-N (2,4,6-trimethylphenyl)methyl carbamate Chemical compound CC1=CC(C)=C(COC(N)=O)C(C)=C1 KJOPTLWVYZCJBX-UHFFFAOYSA-N 0.000 description 1
- IUZVXNNZBSTDJT-UHFFFAOYSA-N (2,4,6-tritert-butylphenyl) carbamate Chemical compound CC(C)(C)C1=CC(C(C)(C)C)=C(OC(N)=O)C(C(C)(C)C)=C1 IUZVXNNZBSTDJT-UHFFFAOYSA-N 0.000 description 1
- LZZRHUUMSXNYBI-UHFFFAOYSA-N (2,4-dichlorophenyl)methyl carbamate Chemical compound NC(=O)OCC1=CC=C(Cl)C=C1Cl LZZRHUUMSXNYBI-UHFFFAOYSA-N 0.000 description 1
- LEDMDNAHWYVAPC-UHFFFAOYSA-N (2-carbamoylphenyl)methyl benzoate Chemical compound NC(=O)C1=CC=CC=C1COC(=O)C1=CC=CC=C1 LEDMDNAHWYVAPC-UHFFFAOYSA-N 0.000 description 1
- SWHAGWLVMRLFKO-UHFFFAOYSA-N (2-nitrophenyl)methyl carbamate Chemical compound NC(=O)OCC1=CC=CC=C1[N+]([O-])=O SWHAGWLVMRLFKO-UHFFFAOYSA-N 0.000 description 1
- HIPYHINICCKLGX-UHFFFAOYSA-N (3,5-dimethoxyphenyl)methyl carbamate Chemical compound COC1=CC(COC(N)=O)=CC(OC)=C1 HIPYHINICCKLGX-UHFFFAOYSA-N 0.000 description 1
- YVOBGLMMNWZYCL-UHFFFAOYSA-N (3-nitrophenyl) carbamate Chemical compound NC(=O)OC1=CC=CC([N+]([O-])=O)=C1 YVOBGLMMNWZYCL-UHFFFAOYSA-N 0.000 description 1
- WTKQMHWYSBWUBE-UHFFFAOYSA-N (3-nitropyridin-2-yl) thiohypochlorite Chemical compound [O-][N+](=O)C1=CC=CN=C1SCl WTKQMHWYSBWUBE-UHFFFAOYSA-N 0.000 description 1
- AWOKSNNHYRGYIA-UHFFFAOYSA-N (4,5-dimethoxy-2-nitrophenyl)methyl carbamate Chemical compound COC1=CC(COC(N)=O)=C([N+]([O-])=O)C=C1OC AWOKSNNHYRGYIA-UHFFFAOYSA-N 0.000 description 1
- XHTUZBFAOYRMHI-UHFFFAOYSA-N (4-bromophenyl)methyl carbamate Chemical compound NC(=O)OCC1=CC=C(Br)C=C1 XHTUZBFAOYRMHI-UHFFFAOYSA-N 0.000 description 1
- SODPIMGUZLOIPE-UHFFFAOYSA-N (4-chlorophenoxy)acetic acid Chemical compound OC(=O)COC1=CC=C(Cl)C=C1 SODPIMGUZLOIPE-UHFFFAOYSA-N 0.000 description 1
- HIIOEWGKFCWTJU-UHFFFAOYSA-N (4-chlorophenyl)methyl carbamate Chemical compound NC(=O)OCC1=CC=C(Cl)C=C1 HIIOEWGKFCWTJU-UHFFFAOYSA-N 0.000 description 1
- NULWVEYYQSYAHP-UHFFFAOYSA-N (4-cyanophenyl)methyl carbamate Chemical compound NC(=O)OCC1=CC=C(C#N)C=C1 NULWVEYYQSYAHP-UHFFFAOYSA-N 0.000 description 1
- IERCGNSLWQVTPC-UHFFFAOYSA-N (4-decoxyphenyl)methyl carbamate Chemical compound CCCCCCCCCCOC1=CC=C(COC(N)=O)C=C1 IERCGNSLWQVTPC-UHFFFAOYSA-N 0.000 description 1
- QXENIPSNYCZWNY-UHFFFAOYSA-N (4-methoxyphenyl)-diphenylmethanamine Chemical compound C1=CC(OC)=CC=C1C(N)(C=1C=CC=CC=1)C1=CC=CC=C1 QXENIPSNYCZWNY-UHFFFAOYSA-N 0.000 description 1
- OKLFHGKWEQKSDZ-UHFFFAOYSA-N (4-methoxyphenyl)methanimine Chemical compound COC1=CC=C(C=N)C=C1 OKLFHGKWEQKSDZ-UHFFFAOYSA-N 0.000 description 1
- SDEOSHAQCMPJIJ-UHFFFAOYSA-N (4-methoxyphenyl)methyl carbamate Chemical compound COC1=CC=C(COC(N)=O)C=C1 SDEOSHAQCMPJIJ-UHFFFAOYSA-N 0.000 description 1
- WNNZAHBBDIVWBB-UHFFFAOYSA-N (4-methylsulfanylphenyl) carbamate Chemical compound CSC1=CC=C(OC(N)=O)C=C1 WNNZAHBBDIVWBB-UHFFFAOYSA-N 0.000 description 1
- RZTAQRMRWPYVRR-UHFFFAOYSA-N (4-methylsulfinylphenyl)methyl carbamate Chemical compound CS(=O)C1=CC=C(COC(N)=O)C=C1 RZTAQRMRWPYVRR-UHFFFAOYSA-N 0.000 description 1
- LRJOVUGHUMSKFA-UHFFFAOYSA-N (4-nitrophenyl)methanimine Chemical compound [O-][N+](=O)C1=CC=C(C=N)C=C1 LRJOVUGHUMSKFA-UHFFFAOYSA-N 0.000 description 1
- HQNKOEZESXBYJA-UHFFFAOYSA-N (4-phenyldiazenylphenyl)methyl carbamate Chemical compound C1=CC(COC(=O)N)=CC=C1N=NC1=CC=CC=C1 HQNKOEZESXBYJA-UHFFFAOYSA-N 0.000 description 1
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 1
- 125000006273 (C1-C3) alkyl group Chemical group 0.000 description 1
- 125000006545 (C1-C9) alkyl group Chemical group 0.000 description 1
- 125000006649 (C2-C20) alkynyl group Chemical group 0.000 description 1
- 125000006592 (C2-C3) alkenyl group Chemical group 0.000 description 1
- 125000006593 (C2-C3) alkynyl group Chemical group 0.000 description 1
- 125000006713 (C5-C10) cycloalkyl group Chemical group 0.000 description 1
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 1
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 1
- RASLWNGTMHFPIQ-AATRIKPKSA-N (e)-3-(2-nitrophenyl)prop-2-enamide Chemical compound NC(=O)\C=C\C1=CC=CC=C1[N+]([O-])=O RASLWNGTMHFPIQ-AATRIKPKSA-N 0.000 description 1
- ZOJKRWXDNYZASL-NSCUHMNNSA-N (e)-4-methoxybut-2-enoic acid Chemical compound COC\C=C\C(O)=O ZOJKRWXDNYZASL-NSCUHMNNSA-N 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 1
- TTXKLVVJWALEOY-UHFFFAOYSA-N 1,2-benzoxazol-5-ylmethyl carbamate Chemical compound NC(=O)OCC1=CC=C2ON=CC2=C1 TTXKLVVJWALEOY-UHFFFAOYSA-N 0.000 description 1
- DTOUUUZOYKYHEP-UHFFFAOYSA-N 1,3-bis(2-ethylhexyl)-5-methyl-1,3-diazinan-5-amine Chemical compound CCCCC(CC)CN1CN(CC(CC)CCCC)CC(C)(N)C1 DTOUUUZOYKYHEP-UHFFFAOYSA-N 0.000 description 1
- VAYTZRYEBVHVLE-UHFFFAOYSA-N 1,3-dioxol-2-one Chemical compound O=C1OC=CO1 VAYTZRYEBVHVLE-UHFFFAOYSA-N 0.000 description 1
- FJANNOJSTOGZHK-UHFFFAOYSA-N 1-adamantyl carbamate Chemical compound C1C(C2)CC3CC2CC1(OC(=O)N)C3 FJANNOJSTOGZHK-UHFFFAOYSA-N 0.000 description 1
- MNCMBBIFTVWHIP-UHFFFAOYSA-N 1-anthracen-9-yl-2,2,2-trifluoroethanone Chemical group C1=CC=C2C(C(=O)C(F)(F)F)=C(C=CC=C3)C3=CC2=C1 MNCMBBIFTVWHIP-UHFFFAOYSA-N 0.000 description 1
- XIUQHVQLGXTGGN-UHFFFAOYSA-N 1-cyclopropylethyl carbamate Chemical compound NC(=O)OC(C)C1CC1 XIUQHVQLGXTGGN-UHFFFAOYSA-N 0.000 description 1
- 125000001637 1-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C(*)=C([H])C([H])=C([H])C2=C1[H] 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- 125000006017 1-propenyl group Chemical group 0.000 description 1
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 1
- UPQQXPKAYZYUKO-UHFFFAOYSA-N 2,2,2-trichloroacetamide Chemical class OC(=N)C(Cl)(Cl)Cl UPQQXPKAYZYUKO-UHFFFAOYSA-N 0.000 description 1
- QPLJYAKLSCXZSF-UHFFFAOYSA-N 2,2,2-trichloroethyl carbamate Chemical compound NC(=O)OCC(Cl)(Cl)Cl QPLJYAKLSCXZSF-UHFFFAOYSA-N 0.000 description 1
- 125000000453 2,2,2-trichloroethyl group Chemical group [H]C([H])(*)C(Cl)(Cl)Cl 0.000 description 1
- NRKYWOKHZRQRJR-UHFFFAOYSA-N 2,2,2-trifluoroacetamide Chemical class NC(=O)C(F)(F)F NRKYWOKHZRQRJR-UHFFFAOYSA-N 0.000 description 1
- XNMOEWPBTNQAQB-UHFFFAOYSA-N 2,2,5,7,8-pentamethyl-3,4-dihydrochromene-6-sulfonamide Chemical compound C1CC(C)(C)OC2=C1C(C)=C(S(N)(=O)=O)C(C)=C2C XNMOEWPBTNQAQB-UHFFFAOYSA-N 0.000 description 1
- 239000000263 2,3-dihydroxypropyl (Z)-octadec-9-enoate Substances 0.000 description 1
- PXVUDLXXKGSXHH-UHFFFAOYSA-N 2,4,6-trimethoxybenzenesulfonamide Chemical compound COC1=CC(OC)=C(S(N)(=O)=O)C(OC)=C1 PXVUDLXXKGSXHH-UHFFFAOYSA-N 0.000 description 1
- YECJUZIGFPJWGQ-UHFFFAOYSA-N 2,4,6-trimethylbenzenesulfonamide Chemical compound CC1=CC(C)=C(S(N)(=O)=O)C(C)=C1 YECJUZIGFPJWGQ-UHFFFAOYSA-N 0.000 description 1
- FFFIRKXTFQCCKJ-UHFFFAOYSA-M 2,4,6-trimethylbenzoate Chemical compound CC1=CC(C)=C(C([O-])=O)C(C)=C1 FFFIRKXTFQCCKJ-UHFFFAOYSA-M 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- 125000001917 2,4-dinitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C(=C1*)[N+]([O-])=O)[N+]([O-])=O 0.000 description 1
- YJRISODHEYGPEL-UHFFFAOYSA-N 2,6-dimethoxy-4-methylbenzenesulfonamide Chemical compound COC1=CC(C)=CC(OC)=C1S(N)(=O)=O YJRISODHEYGPEL-UHFFFAOYSA-N 0.000 description 1
- DWKLSWPFGOTZII-UHFFFAOYSA-N 2-(1-adamantyl)propan-2-yl carbamate Chemical compound C1C(C2)CC3CC2CC1(C(C)(OC(N)=O)C)C3 DWKLSWPFGOTZII-UHFFFAOYSA-N 0.000 description 1
- YURLCYGZYWDCHL-UHFFFAOYSA-N 2-(2,6-dichloro-4-methylphenoxy)acetic acid Chemical compound CC1=CC(Cl)=C(OCC(O)=O)C(Cl)=C1 YURLCYGZYWDCHL-UHFFFAOYSA-N 0.000 description 1
- WGIMXKDCVCTHGW-UHFFFAOYSA-N 2-(2-hydroxyethoxy)ethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCOCCO WGIMXKDCVCTHGW-UHFFFAOYSA-N 0.000 description 1
- DVCVYHFEWYAJCP-UHFFFAOYSA-N 2-(2-nitrophenoxy)acetamide Chemical compound NC(=O)COC1=CC=CC=C1[N+]([O-])=O DVCVYHFEWYAJCP-UHFFFAOYSA-N 0.000 description 1
- MLJSAZNRAKTZKO-UHFFFAOYSA-N 2-(2-nitrophenyl)acetamide Chemical compound NC(=O)CC1=CC=CC=C1[N+]([O-])=O MLJSAZNRAKTZKO-UHFFFAOYSA-N 0.000 description 1
- XHNQIEUUMIBVBX-UHFFFAOYSA-N 2-(3,5-dimethoxyphenyl)propan-2-yl carbamate Chemical compound COC1=CC(OC)=CC(C(C)(C)OC(N)=O)=C1 XHNQIEUUMIBVBX-UHFFFAOYSA-N 0.000 description 1
- KPJXVLVCTUUFBA-UHFFFAOYSA-N 2-(3,5-ditert-butylphenyl)propan-2-yl carbamate Chemical compound CC(C)(C)C1=CC(C(C)(C)C)=CC(C(C)(C)OC(N)=O)=C1 KPJXVLVCTUUFBA-UHFFFAOYSA-N 0.000 description 1
- JTQUNAJHSFYGSN-UHFFFAOYSA-N 2-(4-methylphenyl)sulfonylethyl carbamate Chemical compound CC1=CC=C(S(=O)(=O)CCOC(N)=O)C=C1 JTQUNAJHSFYGSN-UHFFFAOYSA-N 0.000 description 1
- RHTMIQNZSGHFCN-UHFFFAOYSA-N 2-(4-phenyldiazenylphenyl)propan-2-yl carbamate Chemical compound C1=CC(C(C)(OC(N)=O)C)=CC=C1N=NC1=CC=CC=C1 RHTMIQNZSGHFCN-UHFFFAOYSA-N 0.000 description 1
- KXKIBGGGFMXVBJ-UHFFFAOYSA-N 2-(4-phenylphenyl)propan-2-yl carbamate Chemical compound C1=CC(C(C)(OC(N)=O)C)=CC=C1C1=CC=CC=C1 KXKIBGGGFMXVBJ-UHFFFAOYSA-N 0.000 description 1
- FGJAPOYTPXTLPY-UHFFFAOYSA-N 2-(benzylideneamino)-4-chlorophenol Chemical compound OC1=CC=C(Cl)C=C1N=CC1=CC=CC=C1 FGJAPOYTPXTLPY-UHFFFAOYSA-N 0.000 description 1
- TYYAMZMDZWXHHA-UHFFFAOYSA-N 2-(dibromomethyl)benzoic acid Chemical compound OC(=O)C1=CC=CC=C1C(Br)Br TYYAMZMDZWXHHA-UHFFFAOYSA-N 0.000 description 1
- JGYNXZIYXGSEJH-UHFFFAOYSA-N 2-(methylsulfanylmethoxymethyl)benzoic acid Chemical compound CSCOCC1=CC=CC=C1C(O)=O JGYNXZIYXGSEJH-UHFFFAOYSA-N 0.000 description 1
- 125000003821 2-(trimethylsilyl)ethoxymethyl group Chemical group [H]C([H])([H])[Si](C([H])([H])[H])(C([H])([H])[H])C([H])([H])C(OC([H])([H])[*])([H])[H] 0.000 description 1
- FKOKUHFZNIUSLW-UHFFFAOYSA-N 2-Hydroxypropyl stearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(C)O FKOKUHFZNIUSLW-UHFFFAOYSA-N 0.000 description 1
- IZXIZTKNFFYFOF-UHFFFAOYSA-N 2-Oxazolidone Chemical compound O=C1NCCO1 IZXIZTKNFFYFOF-UHFFFAOYSA-N 0.000 description 1
- KRQUFUKTQHISJB-YYADALCUSA-N 2-[(E)-N-[2-(4-chlorophenoxy)propoxy]-C-propylcarbonimidoyl]-3-hydroxy-5-(thian-3-yl)cyclohex-2-en-1-one Chemical compound CCC\C(=N/OCC(C)OC1=CC=C(Cl)C=C1)C1=C(O)CC(CC1=O)C1CCCSC1 KRQUFUKTQHISJB-YYADALCUSA-N 0.000 description 1
- QXQMENSTZKYZCE-UHFFFAOYSA-N 2-[2,4-bis(2-methylbutan-2-yl)phenoxy]acetic acid Chemical compound CCC(C)(C)C1=CC=C(OCC(O)=O)C(C(C)(C)CC)=C1 QXQMENSTZKYZCE-UHFFFAOYSA-N 0.000 description 1
- XTRFZKJEMAVUIK-UHFFFAOYSA-N 2-[2,6-dichloro-4-(2,4,4-trimethylpentan-2-yl)phenoxy]acetic acid Chemical compound CC(C)(C)CC(C)(C)C1=CC(Cl)=C(OCC(O)=O)C(Cl)=C1 XTRFZKJEMAVUIK-UHFFFAOYSA-N 0.000 description 1
- UJRMHFPTLFNSTA-UHFFFAOYSA-N 2-chloro-2,2-diphenylacetic acid Chemical compound C=1C=CC=CC=1C(Cl)(C(=O)O)C1=CC=CC=C1 UJRMHFPTLFNSTA-UHFFFAOYSA-N 0.000 description 1
- SHHKMWMIKILKQW-UHFFFAOYSA-N 2-formylbenzenesulfonic acid Chemical compound OS(=O)(=O)C1=CC=CC=C1C=O SHHKMWMIKILKQW-UHFFFAOYSA-N 0.000 description 1
- RFVNOJDQRGSOEL-UHFFFAOYSA-N 2-hydroxyethyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCO RFVNOJDQRGSOEL-UHFFFAOYSA-N 0.000 description 1
- CJNZAXGUTKBIHP-UHFFFAOYSA-M 2-iodobenzoate Chemical compound [O-]C(=O)C1=CC=CC=C1I CJNZAXGUTKBIHP-UHFFFAOYSA-M 0.000 description 1
- UYCIUCIKUGYNBR-UHFFFAOYSA-N 2-iodoethyl carbamate Chemical compound NC(=O)OCCI UYCIUCIKUGYNBR-UHFFFAOYSA-N 0.000 description 1
- LPUAWADEOBHDIP-UHFFFAOYSA-N 2-methyl-2-(2-nitrophenoxy)propanamide Chemical compound NC(=O)C(C)(C)OC1=CC=CC=C1[N+]([O-])=O LPUAWADEOBHDIP-UHFFFAOYSA-N 0.000 description 1
- OBEJXZIQPCOKSK-UHFFFAOYSA-N 2-methyl-2-(2-phenyldiazenylphenoxy)propanamide Chemical compound NC(=O)C(C)(C)OC1=CC=CC=C1N=NC1=CC=CC=C1 OBEJXZIQPCOKSK-UHFFFAOYSA-N 0.000 description 1
- LBLYYCQCTBFVLH-UHFFFAOYSA-M 2-methylbenzenesulfonate Chemical compound CC1=CC=CC=C1S([O-])(=O)=O LBLYYCQCTBFVLH-UHFFFAOYSA-M 0.000 description 1
- SDJNOBUNFYNROE-UHFFFAOYSA-N 2-methylbut-3-yn-2-yl carbamate Chemical compound C#CC(C)(C)OC(N)=O SDJNOBUNFYNROE-UHFFFAOYSA-N 0.000 description 1
- AUQKXXDHDKEBEY-UHFFFAOYSA-N 2-methylbutan-2-yl carbamate Chemical compound CCC(C)(C)OC(N)=O AUQKXXDHDKEBEY-UHFFFAOYSA-N 0.000 description 1
- QTWJRLJHJPIABL-UHFFFAOYSA-N 2-methylphenol;3-methylphenol;4-methylphenol Chemical compound CC1=CC=C(O)C=C1.CC1=CC=CC(O)=C1.CC1=CC=CC=C1O QTWJRLJHJPIABL-UHFFFAOYSA-N 0.000 description 1
- BRUZQRBVNRKLJG-UHFFFAOYSA-N 2-methylpropyl carbamate Chemical compound CC(C)COC(N)=O BRUZQRBVNRKLJG-UHFFFAOYSA-N 0.000 description 1
- OWXVECVXBTWHPP-UHFFFAOYSA-N 2-methylsulfanylethyl carbamate Chemical compound CSCCOC(N)=O OWXVECVXBTWHPP-UHFFFAOYSA-N 0.000 description 1
- IXTODZAWAAKENF-UHFFFAOYSA-N 2-methylsulfonylethyl carbamate Chemical compound CS(=O)(=O)CCOC(N)=O IXTODZAWAAKENF-UHFFFAOYSA-N 0.000 description 1
- 229940080296 2-naphthalenesulfonate Drugs 0.000 description 1
- 125000001622 2-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C(*)C([H])=C([H])C2=C1[H] 0.000 description 1
- KLGQWSOYKYFBTR-UHFFFAOYSA-N 2-nitrobenzamide Chemical compound NC(=O)C1=CC=CC=C1[N+]([O-])=O KLGQWSOYKYFBTR-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- MUAUTBNKPSNTFM-UHFFFAOYSA-N 2-phenylethyl carbamate Chemical compound NC(=O)OCCC1=CC=CC=C1 MUAUTBNKPSNTFM-UHFFFAOYSA-N 0.000 description 1
- UCZSGRLQZLKLCQ-UHFFFAOYSA-N 2-phenylpropan-2-yl carbamate Chemical compound NC(=O)OC(C)(C)C1=CC=CC=C1 UCZSGRLQZLKLCQ-UHFFFAOYSA-N 0.000 description 1
- FCOXSVSQGYUZTB-UHFFFAOYSA-N 2-phosphanylethyl carbamate Chemical compound NC(=O)OCCP FCOXSVSQGYUZTB-UHFFFAOYSA-N 0.000 description 1
- WYECGUSLBPACPT-UHFFFAOYSA-N 2-pyridin-4-ylpropan-2-yl carbamate Chemical compound NC(=O)OC(C)(C)C1=CC=NC=C1 WYECGUSLBPACPT-UHFFFAOYSA-N 0.000 description 1
- MZASHBBAFBWNFL-UHFFFAOYSA-N 2-trimethylsilylethanesulfonamide Chemical compound C[Si](C)(C)CCS(N)(=O)=O MZASHBBAFBWNFL-UHFFFAOYSA-N 0.000 description 1
- XSXPJNJLDYOPTF-UHFFFAOYSA-N 2-trimethylsilylethoxymethanamine Chemical compound C[Si](C)(C)CCOCN XSXPJNJLDYOPTF-UHFFFAOYSA-N 0.000 description 1
- QWYTUBPAXJYCTH-UHFFFAOYSA-N 2-trimethylsilylethyl carbamate Chemical compound C[Si](C)(C)CCOC(N)=O QWYTUBPAXJYCTH-UHFFFAOYSA-N 0.000 description 1
- LDZNCSVWVMBVST-UHFFFAOYSA-N 2-trimethylsilylethyl hydrogen carbonate Chemical compound C[Si](C)(C)CCOC(O)=O LDZNCSVWVMBVST-UHFFFAOYSA-N 0.000 description 1
- GPVOTFQILZVCFP-UHFFFAOYSA-N 2-trityloxyacetic acid Chemical compound C=1C=CC=CC=1C(C=1C=CC=CC=1)(OCC(=O)O)C1=CC=CC=C1 GPVOTFQILZVCFP-UHFFFAOYSA-N 0.000 description 1
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 1
- 125000002774 3,4-dimethoxybenzyl group Chemical group [H]C1=C([H])C(=C([H])C(OC([H])([H])[H])=C1OC([H])([H])[H])C([H])([H])* 0.000 description 1
- KADQHJDUFKAUEB-UHFFFAOYSA-N 3-(2-nitrophenyl)propanamide Chemical compound NC(=O)CCC1=CC=CC=C1[N+]([O-])=O KADQHJDUFKAUEB-UHFFFAOYSA-N 0.000 description 1
- OEHZEBOCZWCVMK-UHFFFAOYSA-N 3-(4-hydroxyphenyl)propanamide Chemical compound NC(=O)CCC1=CC=C(O)C=C1 OEHZEBOCZWCVMK-UHFFFAOYSA-N 0.000 description 1
- NRZLJLXOGSCRAO-UHFFFAOYSA-N 3-(4-nitrophenyl)prop-2-enyl carbamate Chemical compound NC(=O)OCC=CC1=CC=C([N+]([O-])=O)C=C1 NRZLJLXOGSCRAO-UHFFFAOYSA-N 0.000 description 1
- UBLAMKHIFZBBSS-UHFFFAOYSA-N 3-Methylbutyl pentanoate Chemical compound CCCCC(=O)OCCC(C)C UBLAMKHIFZBBSS-UHFFFAOYSA-N 0.000 description 1
- YRXUVAAXSAGWPU-XWIHLEKXSA-N 3-[3-[[4-[[(E)-4-(dimethylamino)but-2-enoyl]amino]benzoyl]amino]anilino]-N-[(1S)-2-hydroxy-1-phenylethyl]-6,6-dimethyl-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C\C=C\C(=O)Nc1ccc(cc1)C(=O)Nc1cccc(Nc2n[nH]c3c2CN(C(=O)N[C@H](CO)c2ccccc2)C3(C)C)c1 YRXUVAAXSAGWPU-XWIHLEKXSA-N 0.000 description 1
- VNEOHNUYPRAJMX-UHFFFAOYSA-N 3-[[2-[[2-amino-3-(1h-indol-3-yl)propanoyl]amino]-4-methylpentanoyl]amino]-4-[[1-(butoxycarbonylamino)-1-oxo-3-phenylpropan-2-yl]amino]-4-oxobutanoic acid Chemical compound C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(CC(C)C)C(=O)NC(CC(O)=O)C(=O)NC(C(=O)NC(=O)OCCCC)CC1=CC=CC=C1 VNEOHNUYPRAJMX-UHFFFAOYSA-N 0.000 description 1
- MTZNODTZOSBYJW-UHFFFAOYSA-N 3-amino-5,5-dimethylcyclohex-2-en-1-one Chemical compound CC1(C)CC(N)=CC(=O)C1 MTZNODTZOSBYJW-UHFFFAOYSA-N 0.000 description 1
- SCLGGNBFBLJQFU-UHFFFAOYSA-N 3-aminopropyl acetate Chemical compound CC(=O)OCCCN SCLGGNBFBLJQFU-UHFFFAOYSA-N 0.000 description 1
- BMYNFMYTOJXKLE-UHFFFAOYSA-N 3-azaniumyl-2-hydroxypropanoate Chemical compound NCC(O)C(O)=O BMYNFMYTOJXKLE-UHFFFAOYSA-N 0.000 description 1
- ZRPLANDPDWYOMZ-UHFFFAOYSA-N 3-cyclopentylpropionic acid Chemical compound OC(=O)CCC1CCCC1 ZRPLANDPDWYOMZ-UHFFFAOYSA-N 0.000 description 1
- UVODFYVXDPJZFJ-UHFFFAOYSA-N 3-methyl-3-nitrobutanamide Chemical compound [O-][N+](=O)C(C)(C)CC(N)=O UVODFYVXDPJZFJ-UHFFFAOYSA-N 0.000 description 1
- 101710082567 3-methylorcinaldehyde synthase Proteins 0.000 description 1
- RZRNAYUHWVFMIP-GDCKJWNLSA-N 3-oleoyl-sn-glycerol Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](O)CO RZRNAYUHWVFMIP-GDCKJWNLSA-N 0.000 description 1
- VYIBCOSBNVFEIW-UHFFFAOYSA-N 3-phenylpropanamide Chemical class NC(=O)CCC1=CC=CC=C1 VYIBCOSBNVFEIW-UHFFFAOYSA-N 0.000 description 1
- 102100037263 3-phosphoinositide-dependent protein kinase 1 Human genes 0.000 description 1
- UBARRNXCKBFUEN-UHFFFAOYSA-N 4,5-diphenyl-5h-1,3-oxazol-2-one Chemical compound N=1C(=O)OC(C=2C=CC=CC=2)C=1C1=CC=CC=C1 UBARRNXCKBFUEN-UHFFFAOYSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- NDRAHSMAGKWWFZ-UHFFFAOYSA-N 4-(methylsulfanylmethoxy)butanoic acid Chemical compound CSCOCCCC(O)=O NDRAHSMAGKWWFZ-UHFFFAOYSA-N 0.000 description 1
- BLEFBWAGWNSEGB-UHFFFAOYSA-N 4-[(4,8-dimethoxynaphthalen-1-yl)methyl]benzenesulfonamide Chemical compound C12=C(OC)C=CC=C2C(OC)=CC=C1CC1=CC=C(S(N)(=O)=O)C=C1 BLEFBWAGWNSEGB-UHFFFAOYSA-N 0.000 description 1
- WAGMYTXJRVPMGW-UHFFFAOYSA-N 4-azidobutanoic acid Chemical compound OC(=O)CCCN=[N+]=[N-] WAGMYTXJRVPMGW-UHFFFAOYSA-N 0.000 description 1
- QPSBONMVNZJUMM-UHFFFAOYSA-N 4-chloro-2-methanimidoylphenol Chemical compound OC1=CC=C(Cl)C=C1C=N QPSBONMVNZJUMM-UHFFFAOYSA-N 0.000 description 1
- OSDLLIBGSJNGJE-UHFFFAOYSA-N 4-chloro-3,5-dimethylphenol Chemical compound CC1=CC(O)=CC(C)=C1Cl OSDLLIBGSJNGJE-UHFFFAOYSA-N 0.000 description 1
- XYOXIERJKILWCG-UHFFFAOYSA-N 4-chlorobutanamide Chemical compound NC(=O)CCCCl XYOXIERJKILWCG-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-M 4-hydroxybenzoate Chemical compound OC1=CC=C(C([O-])=O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-M 0.000 description 1
- UHAAUDAFKLCPEA-UHFFFAOYSA-N 4-methoxy-2,3,5,6-tetramethylbenzenesulfonamide Chemical compound COC1=C(C)C(C)=C(S(N)(=O)=O)C(C)=C1C UHAAUDAFKLCPEA-UHFFFAOYSA-N 0.000 description 1
- ZJJLGMUSGUYZQP-UHFFFAOYSA-N 4-methoxy-2,6-dimethylbenzenesulfonamide Chemical compound COC1=CC(C)=C(S(N)(=O)=O)C(C)=C1 ZJJLGMUSGUYZQP-UHFFFAOYSA-N 0.000 description 1
- MSFQEZBRFPAFEX-UHFFFAOYSA-N 4-methoxybenzenesulfonamide Chemical compound COC1=CC=C(S(N)(=O)=O)C=C1 MSFQEZBRFPAFEX-UHFFFAOYSA-N 0.000 description 1
- 125000004172 4-methoxyphenyl group Chemical group [H]C1=C([H])C(OC([H])([H])[H])=C([H])C([H])=C1* 0.000 description 1
- KHKJLJHJTQRHSA-UHFFFAOYSA-N 4-methyl-4-nitropentanoic acid Chemical compound [O-][N+](=O)C(C)(C)CCC(O)=O KHKJLJHJTQRHSA-UHFFFAOYSA-N 0.000 description 1
- SPXOTSHWBDUUMT-UHFFFAOYSA-M 4-nitrobenzenesulfonate Chemical compound [O-][N+](=O)C1=CC=C(S([O-])(=O)=O)C=C1 SPXOTSHWBDUUMT-UHFFFAOYSA-M 0.000 description 1
- LUQVCHRDAGWYMG-UHFFFAOYSA-N 4-phenylbenzamide Chemical compound C1=CC(C(=O)N)=CC=C1C1=CC=CC=C1 LUQVCHRDAGWYMG-UHFFFAOYSA-N 0.000 description 1
- NNJMFJSKMRYHSR-UHFFFAOYSA-M 4-phenylbenzoate Chemical compound C1=CC(C(=O)[O-])=CC=C1C1=CC=CC=C1 NNJMFJSKMRYHSR-UHFFFAOYSA-M 0.000 description 1
- 102100022528 5'-AMP-activated protein kinase catalytic subunit alpha-1 Human genes 0.000 description 1
- 102100036009 5'-AMP-activated protein kinase catalytic subunit alpha-2 Human genes 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- IRBAWVGZNJIROV-SFHVURJKSA-N 9-(2-cyclopropylethynyl)-2-[[(2s)-1,4-dioxan-2-yl]methoxy]-6,7-dihydropyrimido[6,1-a]isoquinolin-4-one Chemical compound C1=C2C3=CC=C(C#CC4CC4)C=C3CCN2C(=O)N=C1OC[C@@H]1COCCO1 IRBAWVGZNJIROV-SFHVURJKSA-N 0.000 description 1
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 1
- QXPJDKVEHRKBOE-UHFFFAOYSA-N 9-phenyl-9h-fluoren-1-amine Chemical compound C1=2C(N)=CC=CC=2C2=CC=CC=C2C1C1=CC=CC=C1 QXPJDKVEHRKBOE-UHFFFAOYSA-N 0.000 description 1
- GJCOSYZMQJWQCA-UHFFFAOYSA-N 9H-xanthene Chemical compound C1=CC=C2CC3=CC=CC=C3OC2=C1 GJCOSYZMQJWQCA-UHFFFAOYSA-N 0.000 description 1
- ZZOKVYOCRSMTSS-UHFFFAOYSA-N 9h-fluoren-9-ylmethyl carbamate Chemical compound C1=CC=C2C(COC(=O)N)C3=CC=CC=C3C2=C1 ZZOKVYOCRSMTSS-UHFFFAOYSA-N 0.000 description 1
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 1
- 102100038079 AP2-associated protein kinase 1 Human genes 0.000 description 1
- 206010000591 Acrochordon Diseases 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N Acrylic acid Chemical group OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 102100023989 Actin-related protein 2 Human genes 0.000 description 1
- 108090000963 Actin-related protein 2 Proteins 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 102100036409 Activated CDC42 kinase 1 Human genes 0.000 description 1
- 102100034111 Activin receptor type-1 Human genes 0.000 description 1
- 102100034134 Activin receptor type-1B Human genes 0.000 description 1
- 102100034135 Activin receptor type-1C Human genes 0.000 description 1
- 102100031260 Acyl-coenzyme A thioesterase THEM4 Human genes 0.000 description 1
- 208000036832 Adenocarcinoma of ovary Diseases 0.000 description 1
- 206010001197 Adenocarcinoma of the cervix Diseases 0.000 description 1
- 208000034246 Adenocarcinoma of the cervix uteri Diseases 0.000 description 1
- 208000036764 Adenocarcinoma of the esophagus Diseases 0.000 description 1
- 208000003200 Adenoma Diseases 0.000 description 1
- 101000783817 Agaricus bisporus lectin Proteins 0.000 description 1
- 208000035285 Allergic Seasonal Rhinitis Diseases 0.000 description 1
- VVJKKWFAADXIJK-UHFFFAOYSA-N Allylamine Chemical compound NCC=C VVJKKWFAADXIJK-UHFFFAOYSA-N 0.000 description 1
- 208000012791 Alpha-heavy chain disease Diseases 0.000 description 1
- 239000005995 Aluminium silicate Substances 0.000 description 1
- 208000035939 Alveolitis allergic Diseases 0.000 description 1
- 206010060937 Amniotic cavity infection Diseases 0.000 description 1
- 244000144725 Amygdalus communis Species 0.000 description 1
- 235000011437 Amygdalus communis Nutrition 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 206010002198 Anaphylactic reaction Diseases 0.000 description 1
- 208000000058 Anaplasia Diseases 0.000 description 1
- 206010073478 Anaplastic large-cell lymphoma Diseases 0.000 description 1
- 241000272525 Anas platyrhynchos Species 0.000 description 1
- 102000008076 Angiogenic Proteins Human genes 0.000 description 1
- 108010074415 Angiogenic Proteins Proteins 0.000 description 1
- 102100022014 Angiopoietin-1 receptor Human genes 0.000 description 1
- 102100039182 Ankyrin repeat and protein kinase domain-containing protein 1 Human genes 0.000 description 1
- 241000272814 Anser sp. Species 0.000 description 1
- 102100025511 Anti-Muellerian hormone type-2 receptor Human genes 0.000 description 1
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 1
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 206010003011 Appendicitis Diseases 0.000 description 1
- 101000995861 Arabidopsis thaliana Regulatory protein NPR1 Proteins 0.000 description 1
- 101100132433 Arabidopsis thaliana VIII-1 gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 229910017048 AsF6 Inorganic materials 0.000 description 1
- 208000033116 Asbestos intoxication Diseases 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 206010003571 Astrocytoma Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 102100039339 Atrial natriuretic peptide receptor 1 Human genes 0.000 description 1
- 102100039341 Atrial natriuretic peptide receptor 2 Human genes 0.000 description 1
- 102100032306 Aurora kinase B Human genes 0.000 description 1
- 102100026630 Aurora kinase C Human genes 0.000 description 1
- 108010014380 Autophagy-Related Protein-1 Homolog Proteins 0.000 description 1
- 235000007319 Avena orientalis Nutrition 0.000 description 1
- 241000209763 Avena sativa Species 0.000 description 1
- 235000007558 Avena sp Nutrition 0.000 description 1
- 208000036170 B-Cell Marginal Zone Lymphoma Diseases 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100035080 BDNF/NT-3 growth factors receptor Human genes 0.000 description 1
- IYHHRZBKXXKDDY-UHFFFAOYSA-N BI-605906 Chemical compound N=1C=2SC(C(N)=O)=C(N)C=2C(C(F)(F)CC)=CC=1N1CCC(S(C)(=O)=O)CC1 IYHHRZBKXXKDDY-UHFFFAOYSA-N 0.000 description 1
- 102100024507 BMP-2-inducible protein kinase Human genes 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 208000029862 Barrett adenocarcinoma Diseases 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- KHBQMWCZKVMBLN-UHFFFAOYSA-N Benzenesulfonamide Chemical compound NS(=O)(=O)C1=CC=CC=C1 KHBQMWCZKVMBLN-UHFFFAOYSA-N 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- 206010004485 Berylliosis Diseases 0.000 description 1
- 102100021738 Beta-adrenergic receptor kinase 1 Human genes 0.000 description 1
- 102100037281 Beta-adrenergic receptor kinase 2 Human genes 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 206010004593 Bile duct cancer Diseases 0.000 description 1
- 229930185605 Bisphenol Natural products 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 102100025423 Bone morphogenetic protein receptor type-1A Human genes 0.000 description 1
- 102100027052 Bone morphogenetic protein receptor type-1B Human genes 0.000 description 1
- 102100025422 Bone morphogenetic protein receptor type-2 Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- 108050009021 Bromodomains Proteins 0.000 description 1
- 206010006448 Bronchiolitis Diseases 0.000 description 1
- 206010006458 Bronchitis chronic Diseases 0.000 description 1
- LVDKZNITIUWNER-UHFFFAOYSA-N Bronopol Chemical compound OCC(Br)(CO)[N+]([O-])=O LVDKZNITIUWNER-UHFFFAOYSA-N 0.000 description 1
- 206010006811 Bursitis Diseases 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 125000003358 C2-C20 alkenyl group Chemical group 0.000 description 1
- UHNRLQRZRNKOKU-UHFFFAOYSA-N CCN(CC1=NC2=C(N1)C1=CC=C(C=C1N=C2N)C1=NNC=C1)C(C)=O Chemical compound CCN(CC1=NC2=C(N1)C1=CC=C(C=C1N=C2N)C1=NNC=C1)C(C)=O UHNRLQRZRNKOKU-UHFFFAOYSA-N 0.000 description 1
- 102100030933 CDK-activating kinase assembly factor MAT1 Human genes 0.000 description 1
- DCERHCFNWRGHLK-UHFFFAOYSA-N C[Si](C)C Chemical compound C[Si](C)C DCERHCFNWRGHLK-UHFFFAOYSA-N 0.000 description 1
- 102100025589 CaM kinase-like vesicle-associated protein Human genes 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 239000001736 Calcium glycerylphosphate Substances 0.000 description 1
- 102000004646 Calcium-Calmodulin-Dependent Protein Kinase Type 4 Human genes 0.000 description 1
- 108010003613 Calcium-Calmodulin-Dependent Protein Kinase Type 4 Proteins 0.000 description 1
- 102100033087 Calcium/calmodulin-dependent protein kinase type 1B Human genes 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-N Carbamic acid Chemical group NC(O)=O KXDHJXZQYSOELW-UHFFFAOYSA-N 0.000 description 1
- 239000004215 Carbon black (E152) Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 208000009458 Carcinoma in Situ Diseases 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 102100023060 Casein kinase I isoform gamma-2 Human genes 0.000 description 1
- 102000011632 Caseins Human genes 0.000 description 1
- 108010076119 Caseins Proteins 0.000 description 1
- ZEOWTGPWHLSLOG-UHFFFAOYSA-N Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F Chemical compound Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F ZEOWTGPWHLSLOG-UHFFFAOYSA-N 0.000 description 1
- 206010007882 Cellulitis Diseases 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 206010008617 Cholecystitis chronic Diseases 0.000 description 1
- 201000005262 Chondroma Diseases 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 241000206575 Chondrus crispus Species 0.000 description 1
- 201000009047 Chordoma Diseases 0.000 description 1
- 208000008158 Chorioamnionitis Diseases 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 208000023355 Chronic beryllium disease Diseases 0.000 description 1
- YASYEJJMZJALEJ-UHFFFAOYSA-N Citric acid monohydrate Chemical compound O.OC(=O)CC(O)(C(O)=O)CC(O)=O YASYEJJMZJALEJ-UHFFFAOYSA-N 0.000 description 1
- 102100025567 Citron Rho-interacting kinase Human genes 0.000 description 1
- 101710087170 Citron rho-interacting kinase Proteins 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 108060005980 Collagenase Proteins 0.000 description 1
- 206010052360 Colorectal adenocarcinoma Diseases 0.000 description 1
- 206010010741 Conjunctivitis Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical group [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 208000009798 Craniopharyngioma Diseases 0.000 description 1
- 108010068150 Cyclin B Proteins 0.000 description 1
- 102000002427 Cyclin B Human genes 0.000 description 1
- 102100039683 Cyclin-G-associated kinase Human genes 0.000 description 1
- 102100037912 Cyclin-dependent kinase 11A Human genes 0.000 description 1
- 102100031679 Cyclin-dependent kinase-like 1 Human genes 0.000 description 1
- 102100031685 Cyclin-dependent kinase-like 2 Human genes 0.000 description 1
- 102100031684 Cyclin-dependent kinase-like 3 Human genes 0.000 description 1
- 102100031683 Cyclin-dependent kinase-like 4 Human genes 0.000 description 1
- 102100034746 Cyclin-dependent kinase-like 5 Human genes 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- ZAKOWWREFLAJOT-CEFNRUSXSA-N D-alpha-tocopherylacetate Chemical compound CC(=O)OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C ZAKOWWREFLAJOT-CEFNRUSXSA-N 0.000 description 1
- ZZZCUOFIHGPKAK-UHFFFAOYSA-N D-erythro-ascorbic acid Natural products OCC1OC(=O)C(O)=C1O ZZZCUOFIHGPKAK-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- RBNPOMFGQQGHHO-UWTATZPHSA-M D-glycerate Chemical compound OC[C@@H](O)C([O-])=O RBNPOMFGQQGHHO-UWTATZPHSA-M 0.000 description 1
- 206010011841 Dacryoadenitis acquired Diseases 0.000 description 1
- 101100380234 Danio rerio actr2b gene Proteins 0.000 description 1
- 108010031042 Death-Associated Protein Kinases Proteins 0.000 description 1
- 102100038587 Death-associated protein kinase 1 Human genes 0.000 description 1
- 102100038605 Death-associated protein kinase 2 Human genes 0.000 description 1
- 102100038606 Death-associated protein kinase 3 Human genes 0.000 description 1
- 239000004287 Dehydroacetic acid Substances 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 201000003066 Diffuse Scleroderma Diseases 0.000 description 1
- 101100226059 Drosophila melanogaster Erk7 gene Proteins 0.000 description 1
- 102100029638 Dual serine/threonine and tyrosine protein kinase Human genes 0.000 description 1
- 102100031480 Dual specificity mitogen-activated protein kinase kinase 1 Human genes 0.000 description 1
- 102100023266 Dual specificity mitogen-activated protein kinase kinase 2 Human genes 0.000 description 1
- 102100023275 Dual specificity mitogen-activated protein kinase kinase 3 Human genes 0.000 description 1
- 102100023274 Dual specificity mitogen-activated protein kinase kinase 4 Human genes 0.000 description 1
- 102100023401 Dual specificity mitogen-activated protein kinase kinase 6 Human genes 0.000 description 1
- 102100023332 Dual specificity mitogen-activated protein kinase kinase 7 Human genes 0.000 description 1
- 102100040862 Dual specificity protein kinase CLK1 Human genes 0.000 description 1
- 102100040844 Dual specificity protein kinase CLK2 Human genes 0.000 description 1
- 102100040856 Dual specificity protein kinase CLK3 Human genes 0.000 description 1
- 102100040858 Dual specificity protein kinase CLK4 Human genes 0.000 description 1
- 102100036109 Dual specificity protein kinase TTK Human genes 0.000 description 1
- 102100036492 Dual specificity testis-specific protein kinase 1 Human genes 0.000 description 1
- 102100036498 Dual specificity testis-specific protein kinase 2 Human genes 0.000 description 1
- 102100023115 Dual specificity tyrosine-phosphorylation-regulated kinase 2 Human genes 0.000 description 1
- 102100023114 Dual specificity tyrosine-phosphorylation-regulated kinase 3 Human genes 0.000 description 1
- 102100023112 Dual specificity tyrosine-phosphorylation-regulated kinase 4 Human genes 0.000 description 1
- OVBJJZOQPCKUOR-UHFFFAOYSA-L EDTA disodium salt dihydrate Chemical compound O.O.[Na+].[Na+].[O-]C(=O)C[NH+](CC([O-])=O)CC[NH+](CC([O-])=O)CC([O-])=O OVBJJZOQPCKUOR-UHFFFAOYSA-L 0.000 description 1
- QZKRHPLGUJDVAR-UHFFFAOYSA-K EDTA trisodium salt Chemical compound [Na+].[Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O QZKRHPLGUJDVAR-UHFFFAOYSA-K 0.000 description 1
- 102100029493 EKC/KEOPS complex subunit TP53RK Human genes 0.000 description 1
- 101150099213 ERN2 gene Proteins 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 208000004145 Endometritis Diseases 0.000 description 1
- 102100030011 Endoribonuclease Human genes 0.000 description 1
- 102100030013 Endoribonuclease Human genes 0.000 description 1
- 208000004232 Enteritis Diseases 0.000 description 1
- 208000002460 Enteropathy-Associated T-Cell Lymphoma Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 206010014950 Eosinophilia Diseases 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 108010055196 EphA2 Receptor Proteins 0.000 description 1
- 108010055191 EphA3 Receptor Proteins 0.000 description 1
- 108010055179 EphA4 Receptor Proteins 0.000 description 1
- 108010055182 EphA5 Receptor Proteins 0.000 description 1
- 108010055207 EphA6 Receptor Proteins 0.000 description 1
- 108010055153 EphA7 Receptor Proteins 0.000 description 1
- 108010055155 EphA8 Receptor Proteins 0.000 description 1
- 102100030324 Ephrin type-A receptor 3 Human genes 0.000 description 1
- 102100021606 Ephrin type-A receptor 7 Human genes 0.000 description 1
- 102100031984 Ephrin type-B receptor 6 Human genes 0.000 description 1
- 201000011275 Epicondylitis Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000402754 Erythranthe moschata Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- FPVVYTCTZKCSOJ-UHFFFAOYSA-N Ethylene glycol distearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCOC(=O)CCCCCCCCCCCCCCCCC FPVVYTCTZKCSOJ-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 102100034169 Eukaryotic translation initiation factor 2-alpha kinase 1 Human genes 0.000 description 1
- 206010063560 Excessive granulation tissue Diseases 0.000 description 1
- 102100026130 Extracellular tyrosine-protein kinase PKDCC Human genes 0.000 description 1
- 108700010812 FYN Proteins 0.000 description 1
- 206010016228 Fasciitis Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 1
- 101710182386 Fibroblast growth factor receptor 1 Proteins 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 1
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 1
- 102100027844 Fibroblast growth factor receptor 4 Human genes 0.000 description 1
- 208000001640 Fibromyalgia Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 102100023734 G protein-coupled receptor kinase 4 Human genes 0.000 description 1
- 102100023685 G protein-coupled receptor kinase 5 Human genes 0.000 description 1
- 102100023686 G protein-coupled receptor kinase 6 Human genes 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 208000007882 Gastritis Diseases 0.000 description 1
- 208000005577 Gastroenteritis Diseases 0.000 description 1
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 description 1
- 102000013382 Gelatinases Human genes 0.000 description 1
- 108010026132 Gelatinases Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 108010051975 Glycogen Synthase Kinase 3 beta Proteins 0.000 description 1
- 102100022975 Glycogen synthase kinase-3 alpha Human genes 0.000 description 1
- 102100038104 Glycogen synthase kinase-3 beta Human genes 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-M Glycolate Chemical compound OCC([O-])=O AEMRFAOFKBGASW-UHFFFAOYSA-M 0.000 description 1
- 201000005569 Gout Diseases 0.000 description 1
- 206010018634 Gouty Arthritis Diseases 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 229920002907 Guar gum Polymers 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 206010066476 Haematological malignancy Diseases 0.000 description 1
- 101150017137 Haspin gene Proteins 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 102100035108 High affinity nerve growth factor receptor Human genes 0.000 description 1
- 102100032822 Homeodomain-interacting protein kinase 1 Human genes 0.000 description 1
- 102100032827 Homeodomain-interacting protein kinase 2 Human genes 0.000 description 1
- 102100032826 Homeodomain-interacting protein kinase 3 Human genes 0.000 description 1
- 101000600756 Homo sapiens 3-phosphoinositide-dependent protein kinase 1 Proteins 0.000 description 1
- 101000677993 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-1 Proteins 0.000 description 1
- 101000783681 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-2 Proteins 0.000 description 1
- 101000779641 Homo sapiens ALK tyrosine kinase receptor Proteins 0.000 description 1
- 101000742699 Homo sapiens AP2-associated protein kinase 1 Proteins 0.000 description 1
- 101000928956 Homo sapiens Activated CDC42 kinase 1 Proteins 0.000 description 1
- 101000799140 Homo sapiens Activin receptor type-1 Proteins 0.000 description 1
- 101000799189 Homo sapiens Activin receptor type-1B Proteins 0.000 description 1
- 101000799193 Homo sapiens Activin receptor type-1C Proteins 0.000 description 1
- 101000638510 Homo sapiens Acyl-coenzyme A thioesterase THEM4 Proteins 0.000 description 1
- 101000753291 Homo sapiens Angiopoietin-1 receptor Proteins 0.000 description 1
- 101000889403 Homo sapiens Ankyrin repeat and protein kinase domain-containing protein 1 Proteins 0.000 description 1
- 101000693801 Homo sapiens Anti-Muellerian hormone type-2 receptor Proteins 0.000 description 1
- 101000961044 Homo sapiens Atrial natriuretic peptide receptor 1 Proteins 0.000 description 1
- 101000961040 Homo sapiens Atrial natriuretic peptide receptor 2 Proteins 0.000 description 1
- 101000798306 Homo sapiens Aurora kinase B Proteins 0.000 description 1
- 101000765862 Homo sapiens Aurora kinase C Proteins 0.000 description 1
- 101000596896 Homo sapiens BDNF/NT-3 growth factors receptor Proteins 0.000 description 1
- 101100218937 Homo sapiens BMP2K gene Proteins 0.000 description 1
- 101000751445 Homo sapiens Beta-adrenergic receptor kinase 1 Proteins 0.000 description 1
- 101000806653 Homo sapiens Beta-adrenergic receptor kinase 2 Proteins 0.000 description 1
- 101000934638 Homo sapiens Bone morphogenetic protein receptor type-1A Proteins 0.000 description 1
- 101000984546 Homo sapiens Bone morphogenetic protein receptor type-1B Proteins 0.000 description 1
- 101000934635 Homo sapiens Bone morphogenetic protein receptor type-2 Proteins 0.000 description 1
- 101000978379 Homo sapiens C-C motif chemokine 13 Proteins 0.000 description 1
- 101000978381 Homo sapiens C-C motif chemokine 14 Proteins 0.000 description 1
- 101000978376 Homo sapiens C-C motif chemokine 15 Proteins 0.000 description 1
- 101000583935 Homo sapiens CDK-activating kinase assembly factor MAT1 Proteins 0.000 description 1
- 101000990005 Homo sapiens CLIP-associating protein 1 Proteins 0.000 description 1
- 101000932896 Homo sapiens CaM kinase-like vesicle-associated protein Proteins 0.000 description 1
- 101000944254 Homo sapiens Calcium/calmodulin-dependent protein kinase type 1B Proteins 0.000 description 1
- 101001049881 Homo sapiens Casein kinase I isoform gamma-2 Proteins 0.000 description 1
- 101000749824 Homo sapiens Connector enhancer of kinase suppressor of ras 2 Proteins 0.000 description 1
- 101000738403 Homo sapiens Cyclin-dependent kinase 11A Proteins 0.000 description 1
- 101000944341 Homo sapiens Cyclin-dependent kinase 18 Proteins 0.000 description 1
- 101000777728 Homo sapiens Cyclin-dependent kinase-like 1 Proteins 0.000 description 1
- 101000777764 Homo sapiens Cyclin-dependent kinase-like 2 Proteins 0.000 description 1
- 101000777768 Homo sapiens Cyclin-dependent kinase-like 3 Proteins 0.000 description 1
- 101000777775 Homo sapiens Cyclin-dependent kinase-like 4 Proteins 0.000 description 1
- 101000945692 Homo sapiens Cyclin-dependent kinase-like 5 Proteins 0.000 description 1
- 101000956145 Homo sapiens Death-associated protein kinase 1 Proteins 0.000 description 1
- 101000956149 Homo sapiens Death-associated protein kinase 3 Proteins 0.000 description 1
- 101000865739 Homo sapiens Dual serine/threonine and tyrosine protein kinase Proteins 0.000 description 1
- 101001115394 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 3 Proteins 0.000 description 1
- 101001115395 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 4 Proteins 0.000 description 1
- 101000624426 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 6 Proteins 0.000 description 1
- 101000624594 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 7 Proteins 0.000 description 1
- 101000749294 Homo sapiens Dual specificity protein kinase CLK1 Proteins 0.000 description 1
- 101000749291 Homo sapiens Dual specificity protein kinase CLK2 Proteins 0.000 description 1
- 101000749304 Homo sapiens Dual specificity protein kinase CLK3 Proteins 0.000 description 1
- 101000749298 Homo sapiens Dual specificity protein kinase CLK4 Proteins 0.000 description 1
- 101000659223 Homo sapiens Dual specificity protein kinase TTK Proteins 0.000 description 1
- 101000714159 Homo sapiens Dual specificity testis-specific protein kinase 1 Proteins 0.000 description 1
- 101000714156 Homo sapiens Dual specificity testis-specific protein kinase 2 Proteins 0.000 description 1
- 101001049990 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 2 Proteins 0.000 description 1
- 101001049991 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 3 Proteins 0.000 description 1
- 101001049983 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 4 Proteins 0.000 description 1
- 101001010783 Homo sapiens Endoribonuclease Proteins 0.000 description 1
- 101000967216 Homo sapiens Eosinophil cationic protein Proteins 0.000 description 1
- 101000938354 Homo sapiens Ephrin type-A receptor 1 Proteins 0.000 description 1
- 101001064451 Homo sapiens Ephrin type-B receptor 6 Proteins 0.000 description 1
- 101000926530 Homo sapiens Eukaryotic translation initiation factor 2-alpha kinase 1 Proteins 0.000 description 1
- 101000691796 Homo sapiens Extracellular tyrosine-protein kinase PKDCC Proteins 0.000 description 1
- 101000917134 Homo sapiens Fibroblast growth factor receptor 4 Proteins 0.000 description 1
- 101000878536 Homo sapiens Focal adhesion kinase 1 Proteins 0.000 description 1
- 101000829481 Homo sapiens G protein-coupled receptor kinase 4 Proteins 0.000 description 1
- 101000829476 Homo sapiens G protein-coupled receptor kinase 5 Proteins 0.000 description 1
- 101000829473 Homo sapiens G protein-coupled receptor kinase 6 Proteins 0.000 description 1
- 101000903717 Homo sapiens Glycogen synthase kinase-3 alpha Proteins 0.000 description 1
- 101001066435 Homo sapiens Hepatocyte growth factor-like protein Proteins 0.000 description 1
- 101000596894 Homo sapiens High affinity nerve growth factor receptor Proteins 0.000 description 1
- 101001066404 Homo sapiens Homeodomain-interacting protein kinase 1 Proteins 0.000 description 1
- 101001066401 Homo sapiens Homeodomain-interacting protein kinase 2 Proteins 0.000 description 1
- 101001066389 Homo sapiens Homeodomain-interacting protein kinase 3 Proteins 0.000 description 1
- 101000867103 Homo sapiens Hormonally up-regulated neu tumor-associated kinase Proteins 0.000 description 1
- 101000582922 Homo sapiens Inactive serine/threonine-protein kinase PLK5 Proteins 0.000 description 1
- 101000649963 Homo sapiens Inactive serine/threonine-protein kinase VRK3 Proteins 0.000 description 1
- 101000606465 Homo sapiens Inactive tyrosine-protein kinase 7 Proteins 0.000 description 1
- 101000741965 Homo sapiens Inactive tyrosine-protein kinase PRAG1 Proteins 0.000 description 1
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 1
- 101001056180 Homo sapiens Induced myeloid leukemia cell differentiation protein Mcl-1 Proteins 0.000 description 1
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 1
- 101001034652 Homo sapiens Insulin-like growth factor 1 receptor Proteins 0.000 description 1
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 1
- 101001002695 Homo sapiens Integrin-linked protein kinase Proteins 0.000 description 1
- 101000977768 Homo sapiens Interleukin-1 receptor-associated kinase 3 Proteins 0.000 description 1
- 101000852255 Homo sapiens Interleukin-1 receptor-associated kinase-like 2 Proteins 0.000 description 1
- 101001137642 Homo sapiens Kinase suppressor of Ras 1 Proteins 0.000 description 1
- 101001137640 Homo sapiens Kinase suppressor of Ras 2 Proteins 0.000 description 1
- 101001005128 Homo sapiens LIM domain kinase 1 Proteins 0.000 description 1
- 101001042360 Homo sapiens LIM domain kinase 2 Proteins 0.000 description 1
- 101000941877 Homo sapiens Leucine-rich repeat serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 101001064870 Homo sapiens Lon protease homolog, mitochondrial Proteins 0.000 description 1
- 101000762967 Homo sapiens Lymphokine-activated killer T-cell-originated protein kinase Proteins 0.000 description 1
- 101001018978 Homo sapiens MAP kinase-interacting serine/threonine-protein kinase 2 Proteins 0.000 description 1
- 101001059429 Homo sapiens MAP/microtubule affinity-regulating kinase 3 Proteins 0.000 description 1
- 101001059427 Homo sapiens MAP/microtubule affinity-regulating kinase 4 Proteins 0.000 description 1
- 101001014223 Homo sapiens MAPK/MAK/MRK overlapping kinase Proteins 0.000 description 1
- 101001106413 Homo sapiens Macrophage-stimulating protein receptor Proteins 0.000 description 1
- 101001059535 Homo sapiens Megakaryocyte-associated tyrosine-protein kinase Proteins 0.000 description 1
- 101000687968 Homo sapiens Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase Proteins 0.000 description 1
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 description 1
- 101000588130 Homo sapiens Microsomal triglyceride transfer protein large subunit Proteins 0.000 description 1
- 101001018259 Homo sapiens Microtubule-associated serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 101001018300 Homo sapiens Microtubule-associated serine/threonine-protein kinase 2 Proteins 0.000 description 1
- 101001018294 Homo sapiens Microtubule-associated serine/threonine-protein kinase 3 Proteins 0.000 description 1
- 101001018298 Homo sapiens Microtubule-associated serine/threonine-protein kinase 4 Proteins 0.000 description 1
- 101000628949 Homo sapiens Mitogen-activated protein kinase 10 Proteins 0.000 description 1
- 101000628967 Homo sapiens Mitogen-activated protein kinase 11 Proteins 0.000 description 1
- 101001052477 Homo sapiens Mitogen-activated protein kinase 4 Proteins 0.000 description 1
- 101000950695 Homo sapiens Mitogen-activated protein kinase 8 Proteins 0.000 description 1
- 101000950669 Homo sapiens Mitogen-activated protein kinase 9 Proteins 0.000 description 1
- 101000958409 Homo sapiens Mitogen-activated protein kinase kinase kinase 10 Proteins 0.000 description 1
- 101001005602 Homo sapiens Mitogen-activated protein kinase kinase kinase 11 Proteins 0.000 description 1
- 101001018141 Homo sapiens Mitogen-activated protein kinase kinase kinase 2 Proteins 0.000 description 1
- 101001018157 Homo sapiens Mitogen-activated protein kinase kinase kinase 20 Proteins 0.000 description 1
- 101001018149 Homo sapiens Mitogen-activated protein kinase kinase kinase 21 Proteins 0.000 description 1
- 101001018145 Homo sapiens Mitogen-activated protein kinase kinase kinase 3 Proteins 0.000 description 1
- 101001018147 Homo sapiens Mitogen-activated protein kinase kinase kinase 4 Proteins 0.000 description 1
- 101001018196 Homo sapiens Mitogen-activated protein kinase kinase kinase 5 Proteins 0.000 description 1
- 101001055097 Homo sapiens Mitogen-activated protein kinase kinase kinase 6 Proteins 0.000 description 1
- 101001055092 Homo sapiens Mitogen-activated protein kinase kinase kinase 7 Proteins 0.000 description 1
- 101001055091 Homo sapiens Mitogen-activated protein kinase kinase kinase 8 Proteins 0.000 description 1
- 101001055085 Homo sapiens Mitogen-activated protein kinase kinase kinase 9 Proteins 0.000 description 1
- 101001059991 Homo sapiens Mitogen-activated protein kinase kinase kinase kinase 1 Proteins 0.000 description 1
- 101001059982 Homo sapiens Mitogen-activated protein kinase kinase kinase kinase 5 Proteins 0.000 description 1
- 101000896657 Homo sapiens Mitotic checkpoint serine/threonine-protein kinase BUB1 Proteins 0.000 description 1
- 101001011663 Homo sapiens Mixed lineage kinase domain-like protein Proteins 0.000 description 1
- 101001030211 Homo sapiens Myc proto-oncogene protein Proteins 0.000 description 1
- 101000584208 Homo sapiens Myosin light chain kinase 2, skeletal/cardiac muscle Proteins 0.000 description 1
- 101000584177 Homo sapiens Myosin light chain kinase 3 Proteins 0.000 description 1
- 101000635935 Homo sapiens Myosin-IIIa Proteins 0.000 description 1
- 101000583016 Homo sapiens Myosin-IIIb Proteins 0.000 description 1
- 101000654298 Homo sapiens N-terminal kinase-like protein Proteins 0.000 description 1
- 101000663003 Homo sapiens Non-receptor tyrosine-protein kinase TNK1 Proteins 0.000 description 1
- 101000844245 Homo sapiens Non-receptor tyrosine-protein kinase TYK2 Proteins 0.000 description 1
- 101001108314 Homo sapiens Nuclear receptor-binding protein Proteins 0.000 description 1
- 101000577339 Homo sapiens Nuclear receptor-binding protein 2 Proteins 0.000 description 1
- 101000598781 Homo sapiens Oxidative stress-responsive serine-rich protein 1 Proteins 0.000 description 1
- 101000613563 Homo sapiens PAS domain-containing serine/threonine-protein kinase Proteins 0.000 description 1
- 101100244966 Homo sapiens PRKX gene Proteins 0.000 description 1
- 101001131972 Homo sapiens PX domain-containing protein kinase-like protein Proteins 0.000 description 1
- 101000922137 Homo sapiens Peripheral plasma membrane protein CASK Proteins 0.000 description 1
- 101000692672 Homo sapiens Phosphoinositide 3-kinase regulatory subunit 4 Proteins 0.000 description 1
- 101001072338 Homo sapiens Proliferating cell nuclear antigen Proteins 0.000 description 1
- 101000979748 Homo sapiens Protein NDRG1 Proteins 0.000 description 1
- 101000836974 Homo sapiens Protein O-mannose kinase Proteins 0.000 description 1
- 101000613717 Homo sapiens Protein odd-skipped-related 1 Proteins 0.000 description 1
- 101000983155 Homo sapiens Protein-associating with the carboxyl-terminal domain of ezrin Proteins 0.000 description 1
- 101000878540 Homo sapiens Protein-tyrosine kinase 2-beta Proteins 0.000 description 1
- 101000686031 Homo sapiens Proto-oncogene tyrosine-protein kinase ROS Proteins 0.000 description 1
- 101001125116 Homo sapiens Putative serine/threonine-protein kinase PRKY Proteins 0.000 description 1
- 101000779418 Homo sapiens RAC-alpha serine/threonine-protein kinase Proteins 0.000 description 1
- 101000798015 Homo sapiens RAC-beta serine/threonine-protein kinase Proteins 0.000 description 1
- 101000798007 Homo sapiens RAC-gamma serine/threonine-protein kinase Proteins 0.000 description 1
- 101000712530 Homo sapiens RAF proto-oncogene serine/threonine-protein kinase Proteins 0.000 description 1
- 101001109145 Homo sapiens Receptor-interacting serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 101001089266 Homo sapiens Receptor-interacting serine/threonine-protein kinase 3 Proteins 0.000 description 1
- 101001089248 Homo sapiens Receptor-interacting serine/threonine-protein kinase 4 Proteins 0.000 description 1
- 101000899806 Homo sapiens Retinal guanylyl cyclase 1 Proteins 0.000 description 1
- 101001009847 Homo sapiens Retinal guanylyl cyclase 2 Proteins 0.000 description 1
- 101000927796 Homo sapiens Rho guanine nucleotide exchange factor 7 Proteins 0.000 description 1
- 101000669917 Homo sapiens Rho-associated protein kinase 1 Proteins 0.000 description 1
- 101000669921 Homo sapiens Rho-associated protein kinase 2 Proteins 0.000 description 1
- 101000829506 Homo sapiens Rhodopsin kinase GRK1 Proteins 0.000 description 1
- 101000871032 Homo sapiens Rhodopsin kinase GRK7 Proteins 0.000 description 1
- 101000944909 Homo sapiens Ribosomal protein S6 kinase alpha-1 Proteins 0.000 description 1
- 101000944921 Homo sapiens Ribosomal protein S6 kinase alpha-2 Proteins 0.000 description 1
- 101000945090 Homo sapiens Ribosomal protein S6 kinase alpha-3 Proteins 0.000 description 1
- 101000945093 Homo sapiens Ribosomal protein S6 kinase alpha-4 Proteins 0.000 description 1
- 101000945096 Homo sapiens Ribosomal protein S6 kinase alpha-5 Proteins 0.000 description 1
- 101001051723 Homo sapiens Ribosomal protein S6 kinase alpha-6 Proteins 0.000 description 1
- 101001051714 Homo sapiens Ribosomal protein S6 kinase beta-2 Proteins 0.000 description 1
- 101001051707 Homo sapiens Ribosomal protein S6 kinase delta-1 Proteins 0.000 description 1
- 101000726974 Homo sapiens Ribosomal protein S6 kinase-like 1 Proteins 0.000 description 1
- 101001051709 Homo sapiens Ribosomal protein S6 kinase-related protein Proteins 0.000 description 1
- 101000654257 Homo sapiens SCY1-like protein 2 Proteins 0.000 description 1
- 101000826081 Homo sapiens SRSF protein kinase 1 Proteins 0.000 description 1
- 101000826077 Homo sapiens SRSF protein kinase 2 Proteins 0.000 description 1
- 101000826079 Homo sapiens SRSF protein kinase 3 Proteins 0.000 description 1
- 101000652133 Homo sapiens STE20-like serine/threonine-protein kinase Proteins 0.000 description 1
- 101000648174 Homo sapiens Serine/threonine-protein kinase 10 Proteins 0.000 description 1
- 101000661821 Homo sapiens Serine/threonine-protein kinase 17A Proteins 0.000 description 1
- 101000661819 Homo sapiens Serine/threonine-protein kinase 17B Proteins 0.000 description 1
- 101000628647 Homo sapiens Serine/threonine-protein kinase 24 Proteins 0.000 description 1
- 101000628693 Homo sapiens Serine/threonine-protein kinase 25 Proteins 0.000 description 1
- 101000701393 Homo sapiens Serine/threonine-protein kinase 26 Proteins 0.000 description 1
- 101000880439 Homo sapiens Serine/threonine-protein kinase 3 Proteins 0.000 description 1
- 101000701391 Homo sapiens Serine/threonine-protein kinase 31 Proteins 0.000 description 1
- 101000697591 Homo sapiens Serine/threonine-protein kinase 32A Proteins 0.000 description 1
- 101000697600 Homo sapiens Serine/threonine-protein kinase 32B Proteins 0.000 description 1
- 101000697610 Homo sapiens Serine/threonine-protein kinase 32C Proteins 0.000 description 1
- 101000701396 Homo sapiens Serine/threonine-protein kinase 33 Proteins 0.000 description 1
- 101000701395 Homo sapiens Serine/threonine-protein kinase 35 Proteins 0.000 description 1
- 101000701401 Homo sapiens Serine/threonine-protein kinase 38 Proteins 0.000 description 1
- 101000697608 Homo sapiens Serine/threonine-protein kinase 38-like Proteins 0.000 description 1
- 101000880431 Homo sapiens Serine/threonine-protein kinase 4 Proteins 0.000 description 1
- 101000880461 Homo sapiens Serine/threonine-protein kinase 40 Proteins 0.000 description 1
- 101000771237 Homo sapiens Serine/threonine-protein kinase A-Raf Proteins 0.000 description 1
- 101000695043 Homo sapiens Serine/threonine-protein kinase BRSK1 Proteins 0.000 description 1
- 101000794043 Homo sapiens Serine/threonine-protein kinase BRSK2 Proteins 0.000 description 1
- 101000777293 Homo sapiens Serine/threonine-protein kinase Chk1 Proteins 0.000 description 1
- 101000885321 Homo sapiens Serine/threonine-protein kinase DCLK1 Proteins 0.000 description 1
- 101000885387 Homo sapiens Serine/threonine-protein kinase DCLK2 Proteins 0.000 description 1
- 101000885383 Homo sapiens Serine/threonine-protein kinase DCLK3 Proteins 0.000 description 1
- 101001006996 Homo sapiens Serine/threonine-protein kinase H1 Proteins 0.000 description 1
- 101001006988 Homo sapiens Serine/threonine-protein kinase H2 Proteins 0.000 description 1
- 101000913761 Homo sapiens Serine/threonine-protein kinase ICK Proteins 0.000 description 1
- 101001047642 Homo sapiens Serine/threonine-protein kinase LATS1 Proteins 0.000 description 1
- 101001047637 Homo sapiens Serine/threonine-protein kinase LATS2 Proteins 0.000 description 1
- 101001038337 Homo sapiens Serine/threonine-protein kinase LMTK1 Proteins 0.000 description 1
- 101001038335 Homo sapiens Serine/threonine-protein kinase LMTK2 Proteins 0.000 description 1
- 101001038341 Homo sapiens Serine/threonine-protein kinase LMTK3 Proteins 0.000 description 1
- 101001059443 Homo sapiens Serine/threonine-protein kinase MARK1 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000576907 Homo sapiens Serine/threonine-protein kinase MRCK gamma Proteins 0.000 description 1
- 101001129076 Homo sapiens Serine/threonine-protein kinase N1 Proteins 0.000 description 1
- 101000691459 Homo sapiens Serine/threonine-protein kinase N2 Proteins 0.000 description 1
- 101000691455 Homo sapiens Serine/threonine-protein kinase N3 Proteins 0.000 description 1
- 101000600885 Homo sapiens Serine/threonine-protein kinase NIM1 Proteins 0.000 description 1
- 101001123846 Homo sapiens Serine/threonine-protein kinase Nek1 Proteins 0.000 description 1
- 101001123814 Homo sapiens Serine/threonine-protein kinase Nek10 Proteins 0.000 description 1
- 101001123812 Homo sapiens Serine/threonine-protein kinase Nek11 Proteins 0.000 description 1
- 101000601441 Homo sapiens Serine/threonine-protein kinase Nek2 Proteins 0.000 description 1
- 101000601456 Homo sapiens Serine/threonine-protein kinase Nek3 Proteins 0.000 description 1
- 101000601460 Homo sapiens Serine/threonine-protein kinase Nek4 Proteins 0.000 description 1
- 101000601467 Homo sapiens Serine/threonine-protein kinase Nek5 Proteins 0.000 description 1
- 101000588540 Homo sapiens Serine/threonine-protein kinase Nek6 Proteins 0.000 description 1
- 101000588545 Homo sapiens Serine/threonine-protein kinase Nek7 Proteins 0.000 description 1
- 101000588548 Homo sapiens Serine/threonine-protein kinase Nek8 Proteins 0.000 description 1
- 101001098464 Homo sapiens Serine/threonine-protein kinase OSR1 Proteins 0.000 description 1
- 101000987310 Homo sapiens Serine/threonine-protein kinase PAK 2 Proteins 0.000 description 1
- 101000987315 Homo sapiens Serine/threonine-protein kinase PAK 3 Proteins 0.000 description 1
- 101000987297 Homo sapiens Serine/threonine-protein kinase PAK 4 Proteins 0.000 description 1
- 101000987295 Homo sapiens Serine/threonine-protein kinase PAK 5 Proteins 0.000 description 1
- 101000605835 Homo sapiens Serine/threonine-protein kinase PINK1, mitochondrial Proteins 0.000 description 1
- 101000729945 Homo sapiens Serine/threonine-protein kinase PLK2 Proteins 0.000 description 1
- 101000691614 Homo sapiens Serine/threonine-protein kinase PLK3 Proteins 0.000 description 1
- 101000582914 Homo sapiens Serine/threonine-protein kinase PLK4 Proteins 0.000 description 1
- 101000577652 Homo sapiens Serine/threonine-protein kinase PRP4 homolog Proteins 0.000 description 1
- 101000693598 Homo sapiens Serine/threonine-protein kinase SBK1 Proteins 0.000 description 1
- 101000709238 Homo sapiens Serine/threonine-protein kinase SIK1 Proteins 0.000 description 1
- 101000654491 Homo sapiens Serine/threonine-protein kinase SIK3 Proteins 0.000 description 1
- 101000864806 Homo sapiens Serine/threonine-protein kinase Sgk2 Proteins 0.000 description 1
- 101000838579 Homo sapiens Serine/threonine-protein kinase TAO1 Proteins 0.000 description 1
- 101000665442 Homo sapiens Serine/threonine-protein kinase TBK1 Proteins 0.000 description 1
- 101000607332 Homo sapiens Serine/threonine-protein kinase ULK2 Proteins 0.000 description 1
- 101000607339 Homo sapiens Serine/threonine-protein kinase ULK3 Proteins 0.000 description 1
- 101000809308 Homo sapiens Serine/threonine-protein kinase ULK4 Proteins 0.000 description 1
- 101000649929 Homo sapiens Serine/threonine-protein kinase VRK1 Proteins 0.000 description 1
- 101000649931 Homo sapiens Serine/threonine-protein kinase VRK2 Proteins 0.000 description 1
- 101001036145 Homo sapiens Serine/threonine-protein kinase greatwall Proteins 0.000 description 1
- 101000595531 Homo sapiens Serine/threonine-protein kinase pim-1 Proteins 0.000 description 1
- 101001001648 Homo sapiens Serine/threonine-protein kinase pim-2 Proteins 0.000 description 1
- 101001001645 Homo sapiens Serine/threonine-protein kinase pim-3 Proteins 0.000 description 1
- 101000637839 Homo sapiens Serine/threonine-protein kinase tousled-like 1 Proteins 0.000 description 1
- 101000637847 Homo sapiens Serine/threonine-protein kinase tousled-like 2 Proteins 0.000 description 1
- 101000701815 Homo sapiens Spermidine synthase Proteins 0.000 description 1
- 101000651178 Homo sapiens Striated muscle preferentially expressed protein kinase Proteins 0.000 description 1
- 101000625846 Homo sapiens TBC domain-containing protein kinase-like protein Proteins 0.000 description 1
- 101100245176 Homo sapiens TP53RK gene Proteins 0.000 description 1
- 101000662997 Homo sapiens TRAF2 and NCK-interacting protein kinase Proteins 0.000 description 1
- 101000759314 Homo sapiens Tau-tubulin kinase 1 Proteins 0.000 description 1
- 101000759318 Homo sapiens Tau-tubulin kinase 2 Proteins 0.000 description 1
- 101000772231 Homo sapiens Testis-specific serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 101000772239 Homo sapiens Testis-specific serine/threonine-protein kinase 2 Proteins 0.000 description 1
- 101000794197 Homo sapiens Testis-specific serine/threonine-protein kinase 3 Proteins 0.000 description 1
- 101000794199 Homo sapiens Testis-specific serine/threonine-protein kinase 4 Proteins 0.000 description 1
- 101000794200 Homo sapiens Testis-specific serine/threonine-protein kinase 6 Proteins 0.000 description 1
- 101000645320 Homo sapiens Titin Proteins 0.000 description 1
- 101001121409 Homo sapiens Transcription factor Ovo-like 2 Proteins 0.000 description 1
- 101000864342 Homo sapiens Tyrosine-protein kinase BTK Proteins 0.000 description 1
- 101001026790 Homo sapiens Tyrosine-protein kinase Fes/Fps Proteins 0.000 description 1
- 101001050476 Homo sapiens Tyrosine-protein kinase ITK/TSK Proteins 0.000 description 1
- 101000997835 Homo sapiens Tyrosine-protein kinase JAK1 Proteins 0.000 description 1
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 1
- 101000727826 Homo sapiens Tyrosine-protein kinase RYK Proteins 0.000 description 1
- 101000661459 Homo sapiens Tyrosine-protein kinase STYK1 Proteins 0.000 description 1
- 101000604583 Homo sapiens Tyrosine-protein kinase SYK Proteins 0.000 description 1
- 101000587313 Homo sapiens Tyrosine-protein kinase Srms Proteins 0.000 description 1
- 101000818543 Homo sapiens Tyrosine-protein kinase ZAP-70 Proteins 0.000 description 1
- 101000606129 Homo sapiens Tyrosine-protein kinase receptor TYRO3 Proteins 0.000 description 1
- 101000753253 Homo sapiens Tyrosine-protein kinase receptor Tie-1 Proteins 0.000 description 1
- 101000807561 Homo sapiens Tyrosine-protein kinase receptor UFO Proteins 0.000 description 1
- 101001103033 Homo sapiens Tyrosine-protein kinase transmembrane receptor ROR2 Proteins 0.000 description 1
- 101000577737 Homo sapiens U4/U6 small nuclear ribonucleoprotein Prp4 Proteins 0.000 description 1
- 101000693630 Homo sapiens Uncharacterized serine/threonine-protein kinase SBK3 Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 101001117146 Homo sapiens [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Proteins 0.000 description 1
- 101000994496 Homo sapiens cAMP-dependent protein kinase catalytic subunit alpha Proteins 0.000 description 1
- 101000944219 Homo sapiens cAMP-dependent protein kinase catalytic subunit beta Proteins 0.000 description 1
- 101000944207 Homo sapiens cAMP-dependent protein kinase catalytic subunit gamma Proteins 0.000 description 1
- 101001046426 Homo sapiens cGMP-dependent protein kinase 1 Proteins 0.000 description 1
- 101001046427 Homo sapiens cGMP-dependent protein kinase 2 Proteins 0.000 description 1
- 101000926525 Homo sapiens eIF-2-alpha kinase GCN2 Proteins 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 101150057269 IKBKB gene Proteins 0.000 description 1
- 238000004566 IR spectroscopy Methods 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 208000007866 Immunoproliferative Small Intestinal Disease Diseases 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 102100030266 Inactive serine/threonine-protein kinase PLK5 Human genes 0.000 description 1
- 102100028288 Inactive serine/threonine-protein kinase VRK3 Human genes 0.000 description 1
- 102100039813 Inactive tyrosine-protein kinase 7 Human genes 0.000 description 1
- 102100038659 Inactive tyrosine-protein kinase PRAG1 Human genes 0.000 description 1
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 201000003803 Inflammatory myofibroblastic tumor Diseases 0.000 description 1
- 206010067917 Inflammatory myofibroblastic tumour Diseases 0.000 description 1
- IMQLKJBTEOYOSI-GPIVLXJGSA-N Inositol-hexakisphosphate Chemical compound OP(O)(=O)O[C@H]1[C@H](OP(O)(O)=O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@@H]1OP(O)(O)=O IMQLKJBTEOYOSI-GPIVLXJGSA-N 0.000 description 1
- 102100036721 Insulin receptor Human genes 0.000 description 1
- 102100039137 Insulin receptor-related protein Human genes 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 102100025304 Integrin beta-1 Human genes 0.000 description 1
- 102100020944 Integrin-linked protein kinase Human genes 0.000 description 1
- 102100034170 Interferon-induced, double-stranded RNA-activated protein kinase Human genes 0.000 description 1
- 101710089751 Interferon-induced, double-stranded RNA-activated protein kinase Proteins 0.000 description 1
- 102100023530 Interleukin-1 receptor-associated kinase 3 Human genes 0.000 description 1
- 102100036433 Interleukin-1 receptor-associated kinase-like 2 Human genes 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 208000009164 Islet Cell Adenoma Diseases 0.000 description 1
- 102100029874 Kappa-casein Human genes 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 102100021001 Kinase suppressor of Ras 1 Human genes 0.000 description 1
- 102100021000 Kinase suppressor of Ras 2 Human genes 0.000 description 1
- QAQJMLQRFWZOBN-LAUBAEHRSA-N L-ascorbyl-6-palmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](O)[C@H]1OC(=O)C(O)=C1O QAQJMLQRFWZOBN-LAUBAEHRSA-N 0.000 description 1
- 239000011786 L-ascorbyl-6-palmitate Substances 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 102100026023 LIM domain kinase 1 Human genes 0.000 description 1
- 102100021756 LIM domain kinase 2 Human genes 0.000 description 1
- 208000032004 Large-Cell Anaplastic Lymphoma Diseases 0.000 description 1
- 241000218652 Larix Species 0.000 description 1
- 235000005590 Larix decidua Nutrition 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 201000008197 Laryngitis Diseases 0.000 description 1
- 241000270322 Lepidosauria Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010020246 Leucine-Rich Repeat Serine-Threonine Protein Kinase-2 Proteins 0.000 description 1
- 102100032656 Leucine-rich repeat serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 102100032693 Leucine-rich repeat serine/threonine-protein kinase 2 Human genes 0.000 description 1
- 241000209510 Liliopsida Species 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 102100026753 Lymphokine-activated killer T-cell-originated protein kinase Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 108010068342 MAP Kinase Kinase 1 Proteins 0.000 description 1
- 108010068353 MAP Kinase Kinase 2 Proteins 0.000 description 1
- 108010075654 MAP Kinase Kinase Kinase 1 Proteins 0.000 description 1
- 102100034069 MAP kinase-activated protein kinase 2 Human genes 0.000 description 1
- 102100028397 MAP kinase-activated protein kinase 3 Human genes 0.000 description 1
- 102100028396 MAP kinase-activated protein kinase 5 Human genes 0.000 description 1
- 102100026299 MAP kinase-interacting serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 101710139011 MAP kinase-interacting serine/threonine-protein kinase 1 Proteins 0.000 description 1
- 101710138999 MAP kinase-interacting serine/threonine-protein kinase 2 Proteins 0.000 description 1
- 108010041955 MAP-kinase-activated kinase 2 Proteins 0.000 description 1
- 108010041980 MAP-kinase-activated kinase 3 Proteins 0.000 description 1
- 108010041164 MAP-kinase-activated kinase 5 Proteins 0.000 description 1
- 102100028920 MAP/microtubule affinity-regulating kinase 3 Human genes 0.000 description 1
- 102100028913 MAP/microtubule affinity-regulating kinase 4 Human genes 0.000 description 1
- 102100031520 MAPK/MAK/MRK overlapping kinase Human genes 0.000 description 1
- 101150018665 MAPK3 gene Proteins 0.000 description 1
- 101150098805 MAPK6 gene Proteins 0.000 description 1
- 101150043871 MAPK7 gene Proteins 0.000 description 1
- 101150078127 MUSK gene Proteins 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 description 1
- 241000218922 Magnoliophyta Species 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 240000003183 Manihot esculenta Species 0.000 description 1
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 1
- 101150024075 Mapk1 gene Proteins 0.000 description 1
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 1
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 1
- 208000009018 Medullary thyroid cancer Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 102100028905 Megakaryocyte-associated tyrosine-protein kinase Human genes 0.000 description 1
- 102100024262 Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase Human genes 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 102100033268 Microtubule-associated serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 102100033253 Microtubule-associated serine/threonine-protein kinase 2 Human genes 0.000 description 1
- 102100033251 Microtubule-associated serine/threonine-protein kinase 3 Human genes 0.000 description 1
- 102100033252 Microtubule-associated serine/threonine-protein kinase 4 Human genes 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 102100026931 Mitogen-activated protein kinase 10 Human genes 0.000 description 1
- 102100026929 Mitogen-activated protein kinase 11 Human genes 0.000 description 1
- 102100024189 Mitogen-activated protein kinase 4 Human genes 0.000 description 1
- 102100037808 Mitogen-activated protein kinase 8 Human genes 0.000 description 1
- 102100037809 Mitogen-activated protein kinase 9 Human genes 0.000 description 1
- 102100033115 Mitogen-activated protein kinase kinase kinase 1 Human genes 0.000 description 1
- 102100038243 Mitogen-activated protein kinase kinase kinase 10 Human genes 0.000 description 1
- 102100025207 Mitogen-activated protein kinase kinase kinase 11 Human genes 0.000 description 1
- 102100025184 Mitogen-activated protein kinase kinase kinase 13 Human genes 0.000 description 1
- 102100033058 Mitogen-activated protein kinase kinase kinase 2 Human genes 0.000 description 1
- 102100033116 Mitogen-activated protein kinase kinase kinase 20 Human genes 0.000 description 1
- 102100033054 Mitogen-activated protein kinase kinase kinase 21 Human genes 0.000 description 1
- 102100033059 Mitogen-activated protein kinase kinase kinase 3 Human genes 0.000 description 1
- 102100033060 Mitogen-activated protein kinase kinase kinase 4 Human genes 0.000 description 1
- 102100033127 Mitogen-activated protein kinase kinase kinase 5 Human genes 0.000 description 1
- 102100026889 Mitogen-activated protein kinase kinase kinase 6 Human genes 0.000 description 1
- 102100026909 Mitogen-activated protein kinase kinase kinase 9 Human genes 0.000 description 1
- 102100028199 Mitogen-activated protein kinase kinase kinase kinase 1 Human genes 0.000 description 1
- 102100028192 Mitogen-activated protein kinase kinase kinase kinase 2 Human genes 0.000 description 1
- 102100028195 Mitogen-activated protein kinase kinase kinase kinase 5 Human genes 0.000 description 1
- 102100021691 Mitotic checkpoint serine/threonine-protein kinase BUB1 Human genes 0.000 description 1
- 238000006751 Mitsunobu reaction Methods 0.000 description 1
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 1
- 102100030177 Mixed lineage kinase domain-like protein Human genes 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- 102100027983 Molybdenum cofactor sulfurase Human genes 0.000 description 1
- 101710132461 Molybdenum cofactor sulfurase Proteins 0.000 description 1
- 208000010190 Monoclonal Gammopathy of Undetermined Significance Diseases 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 208000012799 Mu-heavy chain disease Diseases 0.000 description 1
- 229920000715 Mucilage Polymers 0.000 description 1
- 101100490437 Mus musculus Acvrl1 gene Proteins 0.000 description 1
- 101000753280 Mus musculus Angiopoietin-1 receptor Proteins 0.000 description 1
- 101100070645 Mus musculus Hint1 gene Proteins 0.000 description 1
- 101100452374 Mus musculus Ikbke gene Proteins 0.000 description 1
- 101100198353 Mus musculus Rnasel gene Proteins 0.000 description 1
- 208000002231 Muscle Neoplasms Diseases 0.000 description 1
- 102100038168 Muscle, skeletal receptor tyrosine-protein kinase Human genes 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 208000003926 Myelitis Diseases 0.000 description 1
- 208000009525 Myocarditis Diseases 0.000 description 1
- 102100030788 Myosin light chain kinase 2, skeletal/cardiac muscle Human genes 0.000 description 1
- 102100030783 Myosin light chain kinase 3 Human genes 0.000 description 1
- 102100030782 Myosin light chain kinase family member 4 Human genes 0.000 description 1
- 101710087570 Myosin light chain kinase family member 4 Proteins 0.000 description 1
- 102100035044 Myosin light chain kinase, smooth muscle Human genes 0.000 description 1
- 101710198035 Myosin light chain kinase, smooth muscle Proteins 0.000 description 1
- 102100030743 Myosin-IIIa Human genes 0.000 description 1
- 102100030369 Myosin-IIIb Human genes 0.000 description 1
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 1
- VZZSENOIDJBWDM-JOCHJYFZSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[3-(prop-2-enoylamino)anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(Nc3cccc(NC(=O)C=C)c3)n[nH]c2C1(C)C)c1ccccc1 VZZSENOIDJBWDM-JOCHJYFZSA-N 0.000 description 1
- FSHHAFRVNAENTN-MUUNZHRXSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[3-[[3-(prop-2-enoylamino)benzoyl]amino]anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(Nc3cccc(NC(=O)c4cccc(NC(=O)C=C)c4)c3)n[nH]c2C1(C)C)c1ccccc1 FSHHAFRVNAENTN-MUUNZHRXSA-N 0.000 description 1
- XPYNKEOVRWOVNF-MUUNZHRXSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[3-[[4-(propanoylamino)benzoyl]amino]anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CCC(=O)Nc1ccc(cc1)C(=O)Nc1cccc(Nc2n[nH]c3c2CN(C(=O)N[C@H](CN(C)C)c2ccccc2)C3(C)C)c1 XPYNKEOVRWOVNF-MUUNZHRXSA-N 0.000 description 1
- VNLKFJQXFQZSAD-JOCHJYFZSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[4-(prop-2-enoylamino)anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(Nc3ccc(NC(=O)C=C)cc3)n[nH]c2C1(C)C)c1ccccc1 VNLKFJQXFQZSAD-JOCHJYFZSA-N 0.000 description 1
- TULCSUGHXMJZTO-MUUNZHRXSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[4-[[3-(prop-2-enoylamino)benzoyl]amino]anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(Nc3ccc(NC(=O)c4cccc(NC(=O)C=C)c4)cc3)n[nH]c2C1(C)C)c1ccccc1 TULCSUGHXMJZTO-MUUNZHRXSA-N 0.000 description 1
- AVLOXJCCPGBYDS-MUUNZHRXSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[4-[[4-(prop-2-enoylamino)benzoyl]amino]anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(Nc3ccc(NC(=O)c4ccc(NC(=O)C=C)cc4)cc3)n[nH]c2C1(C)C)c1ccccc1 AVLOXJCCPGBYDS-MUUNZHRXSA-N 0.000 description 1
- BMDYRVWBRSFBFF-STROYTFGSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[(1R,3R)-3-[[4-(prop-2-enoylamino)benzoyl]amino]cyclohexyl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(N[C@@H]3CCC[C@H](C3)NC(=O)c3ccc(NC(=O)C=C)cc3)n[nH]c2C1(C)C)c1ccccc1 BMDYRVWBRSFBFF-STROYTFGSA-N 0.000 description 1
- DZLVTBMVZISOAN-TZIWHRDSSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[(3R)-1-prop-2-enoylpiperidine-3-carbonyl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(NC(=O)[C@@H]3CCCN(C3)C(=O)C=C)n[nH]c2C1(C)C)c1ccccc1 DZLVTBMVZISOAN-TZIWHRDSSA-N 0.000 description 1
- DZLVTBMVZISOAN-PZJWPPBQSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[(3S)-1-prop-2-enoylpiperidine-3-carbonyl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(NC(=O)[C@H]3CCCN(C3)C(=O)C=C)n[nH]c2C1(C)C)c1ccccc1 DZLVTBMVZISOAN-PZJWPPBQSA-N 0.000 description 1
- YDZFRUUFFMVGSP-ZCJYOONXSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[1-[4-(prop-2-enoylamino)benzoyl]piperidin-3-yl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound C(C=C)(=O)NC1=CC=C(C(=O)N2CC(CCC2)NC=2C3=C(NN=2)C(N(C3)C(=O)N[C@H](CN(C)C)C2=CC=CC=C2)(C)C)C=C1 YDZFRUUFFMVGSP-ZCJYOONXSA-N 0.000 description 1
- MOOBVPAIRQVMOJ-HHHXNRCGSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[1-[4-(prop-2-enoylamino)benzoyl]piperidin-4-yl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(NC3CCN(CC3)C(=O)c3ccc(NC(=O)C=C)cc3)n[nH]c2C1(C)C)c1ccccc1 MOOBVPAIRQVMOJ-HHHXNRCGSA-N 0.000 description 1
- FFVHPVSNWQRIJK-MUUNZHRXSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[3-[[4-(prop-2-enoylamino)benzoyl]amino]benzoyl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound C(C=C)(=O)NC1=CC=C(C(=O)NC=2C=C(C(=O)NC=3C4=C(NN=3)C(N(C4)C(=O)N[C@H](CN(C)C)C3=CC=CC=C3)(C)C)C=CC=2)C=C1 FFVHPVSNWQRIJK-MUUNZHRXSA-N 0.000 description 1
- PKHUCMCAEGQBAL-XKHVUIRMSA-N N-[(1S)-2-(dimethylamino)-1-phenylethyl]-6,6-dimethyl-3-[[4-[[4-(prop-2-enoylamino)benzoyl]amino]cyclohexyl]amino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)C[C@@H](NC(=O)N1Cc2c(NC3CCC(CC3)NC(=O)c3ccc(NC(=O)C=C)cc3)n[nH]c2C1(C)C)c1ccccc1 PKHUCMCAEGQBAL-XKHVUIRMSA-N 0.000 description 1
- WMCXSDYNICXFAU-UHFFFAOYSA-N N-[1-(dimethylamino)propan-2-yl]-6,6-dimethyl-3-[3-[[4-(prop-2-enoylamino)benzoyl]amino]anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CC(CN(C)C)NC(=O)N1Cc2c(Nc3cccc(NC(=O)c4ccc(NC(=O)C=C)cc4)c3)n[nH]c2C1(C)C WMCXSDYNICXFAU-UHFFFAOYSA-N 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- FYSDPHKGVBRASN-UHFFFAOYSA-N N-[2-(dimethylamino)ethyl]-6,6-dimethyl-3-[3-[[4-(prop-2-enoylamino)benzoyl]amino]anilino]-1,4-dihydropyrrolo[3,4-c]pyrazole-5-carboxamide Chemical compound CN(C)CCNC(=O)N1Cc2c(Nc3cccc(NC(=O)c4ccc(NC(=O)C=C)cc4)c3)n[nH]c2C1(C)C FYSDPHKGVBRASN-UHFFFAOYSA-N 0.000 description 1
- POFVJRKJJBFPII-UHFFFAOYSA-N N-cyclopentyl-5-[2-[[5-[(4-ethylpiperazin-1-yl)methyl]pyridin-2-yl]amino]-5-fluoropyrimidin-4-yl]-4-methyl-1,3-thiazol-2-amine Chemical compound C1(CCCC1)NC=1SC(=C(N=1)C)C1=NC(=NC=C1F)NC1=NC=C(C=C1)CN1CCN(CC1)CC POFVJRKJJBFPII-UHFFFAOYSA-N 0.000 description 1
- 102100031703 N-terminal kinase-like protein Human genes 0.000 description 1
- 102000019148 NF-kappaB-inducing kinase activity proteins Human genes 0.000 description 1
- 108040008091 NF-kappaB-inducing kinase activity proteins Proteins 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 102100029166 NT-3 growth factor receptor Human genes 0.000 description 1
- 101150117329 NTRK3 gene Proteins 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 206010051606 Necrotising colitis Diseases 0.000 description 1
- 206010028885 Necrotising fasciitis Diseases 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 241000772415 Neovison vison Species 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- DFPAKSUCGFBDDF-UHFFFAOYSA-N Nicotinamide Chemical class NC(=O)C1=CC=CN=C1 DFPAKSUCGFBDDF-UHFFFAOYSA-N 0.000 description 1
- 206010029461 Nodal marginal zone B-cell lymphomas Diseases 0.000 description 1
- 102100037669 Non-receptor tyrosine-protein kinase TNK1 Human genes 0.000 description 1
- 102100032028 Non-receptor tyrosine-protein kinase TYK2 Human genes 0.000 description 1
- 102100021858 Nuclear receptor-binding protein Human genes 0.000 description 1
- 102100028790 Nuclear receptor-binding protein 2 Human genes 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 239000005642 Oleic acid Substances 0.000 description 1
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 1
- 201000010133 Oligodendroglioma Diseases 0.000 description 1
- 208000003435 Optic Neuritis Diseases 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 206010031149 Osteitis Diseases 0.000 description 1
- 206010031252 Osteomyelitis Diseases 0.000 description 1
- 208000005141 Otitis Diseases 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 101700056750 PAK1 Proteins 0.000 description 1
- 102100040902 PAS domain-containing serine/threonine-protein kinase Human genes 0.000 description 1
- 101150038994 PDGFRA gene Proteins 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 102000038030 PI3Ks Human genes 0.000 description 1
- 101150020891 PRKCA gene Proteins 0.000 description 1
- 101150075026 PRKCB gene Proteins 0.000 description 1
- 101150073266 PRKCD gene Proteins 0.000 description 1
- 101150010978 PRKCE gene Proteins 0.000 description 1
- 101150001670 PRKCG gene Proteins 0.000 description 1
- 102100034602 PX domain-containing protein kinase-like protein Human genes 0.000 description 1
- 208000017459 Paget disease of the penis Diseases 0.000 description 1
- 208000025610 Paget disease of the vulva Diseases 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 206010033645 Pancreatitis Diseases 0.000 description 1
- 206010034038 Parotitis Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 206010034277 Pemphigoid Diseases 0.000 description 1
- 201000011152 Pemphigus Diseases 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- 101710184482 Peroxisomal carnitine O-octanoyltransferase Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 244000025272 Persea americana Species 0.000 description 1
- 235000008673 Persea americana Nutrition 0.000 description 1
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 1
- 206010034811 Pharyngeal cancer Diseases 0.000 description 1
- 201000007100 Pharyngitis Diseases 0.000 description 1
- 244000046052 Phaseolus vulgaris Species 0.000 description 1
- 102100026481 Phosphoinositide 3-kinase regulatory subunit 4 Human genes 0.000 description 1
- IMQLKJBTEOYOSI-UHFFFAOYSA-N Phytic acid Natural products OP(O)(=O)OC1C(OP(O)(O)=O)C(OP(O)(O)=O)C(OP(O)(O)=O)C(OP(O)(O)=O)C1OP(O)(O)=O IMQLKJBTEOYOSI-UHFFFAOYSA-N 0.000 description 1
- 208000007641 Pinealoma Diseases 0.000 description 1
- 102000018967 Platelet-Derived Growth Factor beta Receptor Human genes 0.000 description 1
- 206010035742 Pneumonitis Diseases 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- HLCFGWHYROZGBI-JJKGCWMISA-M Potassium gluconate Chemical compound [K+].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O HLCFGWHYROZGBI-JJKGCWMISA-M 0.000 description 1
- 206010036524 Precursor B-lymphoblastic lymphomas Diseases 0.000 description 1
- 208000032758 Precursor T-lymphoblastic lymphoma/leukaemia Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101150062385 Prkch gene Proteins 0.000 description 1
- 101150009401 Prkcz gene Proteins 0.000 description 1
- 206010036774 Proctitis Diseases 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 108010015499 Protein Kinase C-theta Proteins 0.000 description 1
- 102100028655 Protein O-mannose kinase Human genes 0.000 description 1
- 102100021566 Protein kinase C theta type Human genes 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102100026829 Protein-associating with the carboxyl-terminal domain of ezrin Human genes 0.000 description 1
- 102100037787 Protein-tyrosine kinase 2-beta Human genes 0.000 description 1
- 108700020978 Proto-Oncogene Proteins 0.000 description 1
- 102000052575 Proto-Oncogene Human genes 0.000 description 1
- 108010046934 Proto-Oncogene Proteins c-hck Proteins 0.000 description 1
- 102100023347 Proto-oncogene tyrosine-protein kinase ROS Human genes 0.000 description 1
- 235000009827 Prunus armeniaca Nutrition 0.000 description 1
- 244000018633 Prunus armeniaca Species 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 102100029403 Putative serine/threonine-protein kinase PRKY Human genes 0.000 description 1
- 206010037596 Pyelonephritis Diseases 0.000 description 1
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 1
- 102100032315 RAC-beta serine/threonine-protein kinase Human genes 0.000 description 1
- 102100032314 RAC-gamma serine/threonine-protein kinase Human genes 0.000 description 1
- 102100033479 RAF proto-oncogene serine/threonine-protein kinase Human genes 0.000 description 1
- 108010079933 Receptor-Interacting Protein Serine-Threonine Kinase 2 Proteins 0.000 description 1
- 102100022501 Receptor-interacting serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 102100022502 Receptor-interacting serine/threonine-protein kinase 2 Human genes 0.000 description 1
- 102100033729 Receptor-interacting serine/threonine-protein kinase 3 Human genes 0.000 description 1
- 102100033734 Receptor-interacting serine/threonine-protein kinase 4 Human genes 0.000 description 1
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 1
- 208000033464 Reiter syndrome Diseases 0.000 description 1
- 206010038389 Renal cancer Diseases 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 206010063837 Reperfusion injury Diseases 0.000 description 1
- 206010068956 Respiratory tract inflammation Diseases 0.000 description 1
- 102100022663 Retinal guanylyl cyclase 1 Human genes 0.000 description 1
- 102100030847 Retinal guanylyl cyclase 2 Human genes 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 206010038934 Retinopathy proliferative Diseases 0.000 description 1
- 102100039313 Rho-associated protein kinase 1 Human genes 0.000 description 1
- 102100039314 Rho-associated protein kinase 2 Human genes 0.000 description 1
- 102100023742 Rhodopsin kinase GRK1 Human genes 0.000 description 1
- 102100033536 Ribosomal protein S6 kinase alpha-1 Human genes 0.000 description 1
- 102100033534 Ribosomal protein S6 kinase alpha-2 Human genes 0.000 description 1
- 102100033643 Ribosomal protein S6 kinase alpha-3 Human genes 0.000 description 1
- 102100033644 Ribosomal protein S6 kinase alpha-4 Human genes 0.000 description 1
- 102100033645 Ribosomal protein S6 kinase alpha-5 Human genes 0.000 description 1
- 102100024897 Ribosomal protein S6 kinase alpha-6 Human genes 0.000 description 1
- 102100024917 Ribosomal protein S6 kinase beta-2 Human genes 0.000 description 1
- 102100024913 Ribosomal protein S6 kinase delta-1 Human genes 0.000 description 1
- 102100030864 Ribosomal protein S6 kinase-like 1 Human genes 0.000 description 1
- 102100024914 Ribosomal protein S6 kinase-related protein Human genes 0.000 description 1
- 102100031698 SCY1-like protein 2 Human genes 0.000 description 1
- 229910006074 SO2NH2 Inorganic materials 0.000 description 1
- 102100023010 SRSF protein kinase 1 Human genes 0.000 description 1
- 102100023015 SRSF protein kinase 2 Human genes 0.000 description 1
- 102100023017 SRSF protein kinase 3 Human genes 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 101100177159 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HAC1 gene Proteins 0.000 description 1
- 101100536359 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) TAO3 gene Proteins 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 208000007893 Salpingitis Diseases 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 208000006938 Schwannomatosis Diseases 0.000 description 1
- 206010048810 Sebaceous hyperplasia Diseases 0.000 description 1
- 241000209056 Secale Species 0.000 description 1
- 235000007238 Secale cereale Nutrition 0.000 description 1
- 201000010208 Seminoma Diseases 0.000 description 1
- 102100028900 Serine/threonine-protein kinase 10 Human genes 0.000 description 1
- 102100026758 Serine/threonine-protein kinase 16 Human genes 0.000 description 1
- 102100037955 Serine/threonine-protein kinase 17A Human genes 0.000 description 1
- 102100037959 Serine/threonine-protein kinase 17B Human genes 0.000 description 1
- 102100026764 Serine/threonine-protein kinase 24 Human genes 0.000 description 1
- 102100026737 Serine/threonine-protein kinase 25 Human genes 0.000 description 1
- 102100030617 Serine/threonine-protein kinase 26 Human genes 0.000 description 1
- 102100037628 Serine/threonine-protein kinase 3 Human genes 0.000 description 1
- 102100030618 Serine/threonine-protein kinase 31 Human genes 0.000 description 1
- 102100028032 Serine/threonine-protein kinase 32A Human genes 0.000 description 1
- 102100028030 Serine/threonine-protein kinase 32B Human genes 0.000 description 1
- 102100027903 Serine/threonine-protein kinase 32C Human genes 0.000 description 1
- 102100030515 Serine/threonine-protein kinase 33 Human genes 0.000 description 1
- 102100030620 Serine/threonine-protein kinase 35 Human genes 0.000 description 1
- 102100030514 Serine/threonine-protein kinase 38 Human genes 0.000 description 1
- 102100027898 Serine/threonine-protein kinase 38-like Human genes 0.000 description 1
- 102100037629 Serine/threonine-protein kinase 4 Human genes 0.000 description 1
- 102100037627 Serine/threonine-protein kinase 40 Human genes 0.000 description 1
- 102100029437 Serine/threonine-protein kinase A-Raf Human genes 0.000 description 1
- 102100028623 Serine/threonine-protein kinase BRSK1 Human genes 0.000 description 1
- 102100029891 Serine/threonine-protein kinase BRSK2 Human genes 0.000 description 1
- 102100031081 Serine/threonine-protein kinase Chk1 Human genes 0.000 description 1
- 102100039758 Serine/threonine-protein kinase DCLK1 Human genes 0.000 description 1
- 102100039775 Serine/threonine-protein kinase DCLK2 Human genes 0.000 description 1
- 102100039774 Serine/threonine-protein kinase DCLK3 Human genes 0.000 description 1
- 102100028474 Serine/threonine-protein kinase H1 Human genes 0.000 description 1
- 102100028475 Serine/threonine-protein kinase H2 Human genes 0.000 description 1
- 102100024031 Serine/threonine-protein kinase LATS1 Human genes 0.000 description 1
- 102100024043 Serine/threonine-protein kinase LATS2 Human genes 0.000 description 1
- 102100040293 Serine/threonine-protein kinase LMTK1 Human genes 0.000 description 1
- 102100040292 Serine/threonine-protein kinase LMTK2 Human genes 0.000 description 1
- 102100040291 Serine/threonine-protein kinase LMTK3 Human genes 0.000 description 1
- 102100023230 Serine/threonine-protein kinase MAK Human genes 0.000 description 1
- 102100028921 Serine/threonine-protein kinase MARK1 Human genes 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 102100025345 Serine/threonine-protein kinase MRCK gamma Human genes 0.000 description 1
- 102100026180 Serine/threonine-protein kinase N2 Human genes 0.000 description 1
- 102100026219 Serine/threonine-protein kinase N3 Human genes 0.000 description 1
- 102100037345 Serine/threonine-protein kinase NIM1 Human genes 0.000 description 1
- 102100028751 Serine/threonine-protein kinase Nek1 Human genes 0.000 description 1
- 102100028774 Serine/threonine-protein kinase Nek10 Human genes 0.000 description 1
- 102100028775 Serine/threonine-protein kinase Nek11 Human genes 0.000 description 1
- 102100037703 Serine/threonine-protein kinase Nek2 Human genes 0.000 description 1
- 102100037706 Serine/threonine-protein kinase Nek3 Human genes 0.000 description 1
- 102100037705 Serine/threonine-protein kinase Nek4 Human genes 0.000 description 1
- 102100037702 Serine/threonine-protein kinase Nek5 Human genes 0.000 description 1
- 102100031401 Serine/threonine-protein kinase Nek6 Human genes 0.000 description 1
- 102100031400 Serine/threonine-protein kinase Nek7 Human genes 0.000 description 1
- 102100037143 Serine/threonine-protein kinase OSR1 Human genes 0.000 description 1
- 102100027939 Serine/threonine-protein kinase PAK 2 Human genes 0.000 description 1
- 102100027911 Serine/threonine-protein kinase PAK 3 Human genes 0.000 description 1
- 102100027940 Serine/threonine-protein kinase PAK 4 Human genes 0.000 description 1
- 102100038376 Serine/threonine-protein kinase PINK1, mitochondrial Human genes 0.000 description 1
- 102100031463 Serine/threonine-protein kinase PLK1 Human genes 0.000 description 1
- 102100031462 Serine/threonine-protein kinase PLK2 Human genes 0.000 description 1
- 102100026209 Serine/threonine-protein kinase PLK3 Human genes 0.000 description 1
- 102100030267 Serine/threonine-protein kinase PLK4 Human genes 0.000 description 1
- 102100028868 Serine/threonine-protein kinase PRP4 homolog Human genes 0.000 description 1
- 102100025554 Serine/threonine-protein kinase SBK1 Human genes 0.000 description 1
- 102100025559 Serine/threonine-protein kinase SBK2 Human genes 0.000 description 1
- 101710152798 Serine/threonine-protein kinase SBK2 Proteins 0.000 description 1
- 102100031445 Serine/threonine-protein kinase SIK3 Human genes 0.000 description 1
- 102100026715 Serine/threonine-protein kinase STK11 Human genes 0.000 description 1
- 101710181599 Serine/threonine-protein kinase STK11 Proteins 0.000 description 1
- 102100038192 Serine/threonine-protein kinase TBK1 Human genes 0.000 description 1
- 102100039988 Serine/threonine-protein kinase ULK1 Human genes 0.000 description 1
- 102100039987 Serine/threonine-protein kinase ULK2 Human genes 0.000 description 1
- 102100039985 Serine/threonine-protein kinase ULK3 Human genes 0.000 description 1
- 102100038455 Serine/threonine-protein kinase ULK4 Human genes 0.000 description 1
- 102100028235 Serine/threonine-protein kinase VRK1 Human genes 0.000 description 1
- 102100028234 Serine/threonine-protein kinase VRK2 Human genes 0.000 description 1
- 102100039278 Serine/threonine-protein kinase greatwall Human genes 0.000 description 1
- 102100036077 Serine/threonine-protein kinase pim-1 Human genes 0.000 description 1
- 102100036120 Serine/threonine-protein kinase pim-2 Human genes 0.000 description 1
- 102100036119 Serine/threonine-protein kinase pim-3 Human genes 0.000 description 1
- 102100032015 Serine/threonine-protein kinase tousled-like 1 Human genes 0.000 description 1
- 102100032014 Serine/threonine-protein kinase tousled-like 2 Human genes 0.000 description 1
- 208000009359 Sezary Syndrome Diseases 0.000 description 1
- 208000021388 Sezary disease Diseases 0.000 description 1
- 201000010001 Silicosis Diseases 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical compound [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 1
- BCKXLBQYZLBQEK-KVVVOXFISA-M Sodium oleate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCC([O-])=O BCKXLBQYZLBQEK-KVVVOXFISA-M 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- 244000062793 Sorghum vulgare Species 0.000 description 1
- 241000592344 Spermatophyta Species 0.000 description 1
- 102000038008 SrcA subfamily Human genes 0.000 description 1
- 108091008119 SrcA subfamily Proteins 0.000 description 1
- 108091008116 SrcB subfamily Proteins 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 101150108263 Stk16 gene Proteins 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 102100027659 Striated muscle preferentially expressed protein kinase Human genes 0.000 description 1
- 208000010502 Subcutaneous panniculitis-like T-cell lymphoma Diseases 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 208000033809 Suppuration Diseases 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 201000008736 Systemic mastocytosis Diseases 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000026651 T-cell prolymphocytic leukemia Diseases 0.000 description 1
- 102100024750 TBC domain-containing protein kinase-like protein Human genes 0.000 description 1
- 102100037671 TRAF2 and NCK-interacting protein kinase Human genes 0.000 description 1
- 102100023277 Tau-tubulin kinase 1 Human genes 0.000 description 1
- 102100023276 Tau-tubulin kinase 2 Human genes 0.000 description 1
- 208000000491 Tendinopathy Diseases 0.000 description 1
- 206010043255 Tendonitis Diseases 0.000 description 1
- 206010043276 Teratoma Diseases 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 102100029350 Testis-specific serine/threonine-protein kinase 1 Human genes 0.000 description 1
- 102100029355 Testis-specific serine/threonine-protein kinase 2 Human genes 0.000 description 1
- 102100030168 Testis-specific serine/threonine-protein kinase 3 Human genes 0.000 description 1
- 102100030167 Testis-specific serine/threonine-protein kinase 4 Human genes 0.000 description 1
- 102100030141 Testis-specific serine/threonine-protein kinase 6 Human genes 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-M Thiocyanate anion Chemical compound [S-]C#N ZMZDMBWJUHKJPS-UHFFFAOYSA-M 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102100026260 Titin Human genes 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- DTQVDTLACAAQTR-UHFFFAOYSA-M Trifluoroacetate Chemical compound [O-]C(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-M 0.000 description 1
- 101150008356 Trio gene Proteins 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- 206010045240 Type I hypersensitivity Diseases 0.000 description 1
- 206010053613 Type IV hypersensitivity reaction Diseases 0.000 description 1
- 102100029823 Tyrosine-protein kinase BTK Human genes 0.000 description 1
- 101710083476 Tyrosine-protein kinase Blk Proteins 0.000 description 1
- 102100037333 Tyrosine-protein kinase Fes/Fps Human genes 0.000 description 1
- 101710090365 Tyrosine-protein kinase HCK Proteins 0.000 description 1
- 102100023345 Tyrosine-protein kinase ITK/TSK Human genes 0.000 description 1
- 102100033438 Tyrosine-protein kinase JAK1 Human genes 0.000 description 1
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 1
- 101710088331 Tyrosine-protein kinase Lyn Proteins 0.000 description 1
- 102100029759 Tyrosine-protein kinase RYK Human genes 0.000 description 1
- 102100037781 Tyrosine-protein kinase STYK1 Human genes 0.000 description 1
- 102100038183 Tyrosine-protein kinase SYK Human genes 0.000 description 1
- 102100029654 Tyrosine-protein kinase Srms Human genes 0.000 description 1
- 102100021788 Tyrosine-protein kinase Yes Human genes 0.000 description 1
- 101710107570 Tyrosine-protein kinase Yes Proteins 0.000 description 1
- 102100021125 Tyrosine-protein kinase ZAP-70 Human genes 0.000 description 1
- 102100039127 Tyrosine-protein kinase receptor TYRO3 Human genes 0.000 description 1
- 102100022007 Tyrosine-protein kinase receptor Tie-1 Human genes 0.000 description 1
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 description 1
- 102100039616 Tyrosine-protein kinase transmembrane receptor ROR2 Human genes 0.000 description 1
- 102100025558 Uncharacterized serine/threonine-protein kinase SBK3 Human genes 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000006374 Uterine Cervicitis Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 206010046914 Vaginal infection Diseases 0.000 description 1
- 201000008100 Vaginitis Diseases 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 108010053100 Vascular Endothelial Growth Factor Receptor-3 Proteins 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 206010047124 Vasculitis necrotising Diseases 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 1
- 229930003268 Vitamin C Natural products 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 101150060655 WNK1 gene Proteins 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 101150007909 Wnk4 gene Proteins 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 1
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 1
- CLPYVPMXLNNKLB-UHFFFAOYSA-N [(2-nitrophenyl)-phenylmethyl] carbamate Chemical compound C=1C=CC=C([N+]([O-])=O)C=1C(OC(=O)N)C1=CC=CC=C1 CLPYVPMXLNNKLB-UHFFFAOYSA-N 0.000 description 1
- IJCWFDPJFXGQBN-RYNSOKOISA-N [(2R)-2-[(2R,3R,4S)-4-hydroxy-3-octadecanoyloxyoxolan-2-yl]-2-octadecanoyloxyethyl] octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCCCCCCCCCCCC IJCWFDPJFXGQBN-RYNSOKOISA-N 0.000 description 1
- LXKLUWFIBVXFGX-QPJJXVBHSA-N [(e)-3-phenylprop-2-enyl] carbamate Chemical compound NC(=O)OC\C=C\C1=CC=CC=C1 LXKLUWFIBVXFGX-QPJJXVBHSA-N 0.000 description 1
- MQLDYIKXBMSDCL-UHFFFAOYSA-N [2,4-bis(methylsulfanyl)phenyl] carbamate Chemical compound CSC1=CC=C(OC(N)=O)C(SC)=C1 MQLDYIKXBMSDCL-UHFFFAOYSA-N 0.000 description 1
- OJUHIDQVEFLXSE-UHFFFAOYSA-N [2-(4-methoxyphenyl)-2-oxoethyl] carbamate Chemical compound COC1=CC=C(C(=O)COC(N)=O)C=C1 OJUHIDQVEFLXSE-UHFFFAOYSA-N 0.000 description 1
- XSXGGUVGOHDUPF-UHFFFAOYSA-N [4-(carbamoyloxymethyl)phenyl]boronic acid Chemical compound NC(=O)OCC1=CC=C(B(O)O)C=C1 XSXGGUVGOHDUPF-UHFFFAOYSA-N 0.000 description 1
- BOGSOFADOWIECK-UHFFFAOYSA-N [N].C=1C=NNC=1 Chemical compound [N].C=1C=NNC=1 BOGSOFADOWIECK-UHFFFAOYSA-N 0.000 description 1
- YKTSYUJCYHOUJP-UHFFFAOYSA-N [O--].[Al+3].[Al+3].[O-][Si]([O-])([O-])[O-] Chemical compound [O--].[Al+3].[Al+3].[O-][Si]([O-])([O-])[O-] YKTSYUJCYHOUJP-UHFFFAOYSA-N 0.000 description 1
- 229940022663 acetate Drugs 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- VJHCJDRQFCCTHL-UHFFFAOYSA-N acetic acid 2,3,4,5,6-pentahydroxyhexanal Chemical compound CC(O)=O.OCC(O)C(O)C(O)C(O)C=O VJHCJDRQFCCTHL-UHFFFAOYSA-N 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- GCPWJFKTWGFEHH-UHFFFAOYSA-N acetoacetamide Chemical compound CC(=O)CC(N)=O GCPWJFKTWGFEHH-UHFFFAOYSA-N 0.000 description 1
- 125000003668 acetyloxy group Chemical group [H]C([H])([H])C(=O)O[*] 0.000 description 1
- 150000008065 acid anhydrides Chemical class 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- 125000004423 acyloxy group Chemical group 0.000 description 1
- 125000005585 adamantoate group Chemical group 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 201000005188 adrenal gland cancer Diseases 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- QBYJBZPUGVGKQQ-SJJAEHHWSA-N aldrin Chemical compound C1[C@H]2C=C[C@@H]1[C@H]1[C@@](C3(Cl)Cl)(Cl)C(Cl)=C(Cl)[C@@]3(Cl)[C@H]12 QBYJBZPUGVGKQQ-SJJAEHHWSA-N 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 150000001340 alkali metals Chemical class 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 125000004450 alkenylene group Chemical group 0.000 description 1
- 125000004453 alkoxycarbonyl group Chemical group 0.000 description 1
- 125000005194 alkoxycarbonyloxy group Chemical group 0.000 description 1
- 150000008055 alkyl aryl sulfonates Chemical class 0.000 description 1
- 125000006177 alkyl benzyl group Chemical group 0.000 description 1
- 125000005196 alkyl carbonyloxy group Chemical group 0.000 description 1
- 125000005907 alkyl ester group Chemical group 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- 125000004419 alkynylene group Chemical group 0.000 description 1
- OENHQHLEOONYIE-UKMVMLAPSA-N all-trans beta-carotene Natural products CC=1CCCC(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C OENHQHLEOONYIE-UKMVMLAPSA-N 0.000 description 1
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 235000020224 almond Nutrition 0.000 description 1
- 208000025751 alpha chain disease Diseases 0.000 description 1
- 229940087168 alpha tocopherol Drugs 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 235000012211 aluminium silicate Nutrition 0.000 description 1
- 229940024545 aluminum hydroxide Drugs 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 229960001040 ammonium chloride Drugs 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 206010002449 angioimmunoblastic T-cell lymphoma Diseases 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 239000000420 anogeissus latifolia wall. gum Substances 0.000 description 1
- DQEFBVRIBYYPLE-UHFFFAOYSA-N anthracen-9-ylmethyl carbamate Chemical compound C1=CC=C2C(COC(=O)N)=C(C=CC=C3)C3=CC2=C1 DQEFBVRIBYYPLE-UHFFFAOYSA-N 0.000 description 1
- FKFZOFZWJNHJDE-UHFFFAOYSA-N anthracene-9-sulfonamide Chemical compound C1=CC=C2C(S(=O)(=O)N)=C(C=CC=C3)C3=CC2=C1 FKFZOFZWJNHJDE-UHFFFAOYSA-N 0.000 description 1
- 125000005428 anthryl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C3C(*)=C([H])C([H])=C([H])C3=C([H])C2=C1[H] 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000001028 anti-proliverative effect Effects 0.000 description 1
- 230000000884 anti-protozoa Effects 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 229940027983 antiseptic and disinfectant quaternary ammonium compound Drugs 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 206010003230 arteritis Diseases 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 125000005199 aryl carbonyloxy group Chemical group 0.000 description 1
- 125000000732 arylene group Chemical group 0.000 description 1
- 125000005200 aryloxy carbonyloxy group Chemical group 0.000 description 1
- 125000004104 aryloxy group Chemical group 0.000 description 1
- 206010003441 asbestosis Diseases 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010385 ascorbyl palmitate Nutrition 0.000 description 1
- 208000006673 asthma Diseases 0.000 description 1
- 229940067597 azelate Drugs 0.000 description 1
- 125000003725 azepanyl group Chemical group 0.000 description 1
- 125000002785 azepinyl group Chemical group 0.000 description 1
- 125000002393 azetidinyl group Chemical group 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- DUXANUSOCMOJSI-UHFFFAOYSA-N benzhydryl carbamate Chemical compound C=1C=CC=CC=1C(OC(=O)N)C1=CC=CC=C1 DUXANUSOCMOJSI-UHFFFAOYSA-N 0.000 description 1
- 125000003785 benzimidazolyl group Chemical group N1=C(NC2=C1C=CC=C2)* 0.000 description 1
- 125000004603 benzisoxazolyl group Chemical group O1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000000499 benzofuranyl group Chemical group O1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 229960004365 benzoic acid Drugs 0.000 description 1
- 125000001164 benzothiazolyl group Chemical group S1C(=NC2=C1C=CC=C2)* 0.000 description 1
- 125000004196 benzothienyl group Chemical group S1C(=CC2=C1C=CC=C2)* 0.000 description 1
- 125000003354 benzotriazolyl group Chemical group N1N=NC2=C1C=CC=C2* 0.000 description 1
- 125000004541 benzoxazolyl group Chemical group O1C(=NC2=C1C=CC=C2)* 0.000 description 1
- 239000011648 beta-carotene Substances 0.000 description 1
- 235000013734 beta-carotene Nutrition 0.000 description 1
- TUPZEYHYWIEDIH-WAIFQNFQSA-N beta-carotene Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)C=CC=C(/C)C=CC2=CCCCC2(C)C TUPZEYHYWIEDIH-WAIFQNFQSA-N 0.000 description 1
- 229960002747 betacarotene Drugs 0.000 description 1
- 125000002618 bicyclic heterocycle group Chemical group 0.000 description 1
- BVCRERJDOOBZOH-UHFFFAOYSA-N bicyclo[2.2.1]heptanyl Chemical group C1C[C+]2CC[C-]1C2 BVCRERJDOOBZOH-UHFFFAOYSA-N 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- HROGQYMZWGPHIB-UHFFFAOYSA-N bis(4-methoxyphenyl)methanamine Chemical compound C1=CC(OC)=CC=C1C(N)C1=CC=C(OC)C=C1 HROGQYMZWGPHIB-UHFFFAOYSA-N 0.000 description 1
- JKJWYKGYGWOAHT-UHFFFAOYSA-N bis(prop-2-enyl) carbonate Chemical compound C=CCOC(=O)OCC=C JKJWYKGYGWOAHT-UHFFFAOYSA-N 0.000 description 1
- IISBACLAFKSPIT-UHFFFAOYSA-N bisphenol A Chemical compound C=1C=C(O)C=CC=1C(C)(C)C1=CC=C(O)C=C1 IISBACLAFKSPIT-UHFFFAOYSA-N 0.000 description 1
- 208000010217 blepharitis Diseases 0.000 description 1
- 208000018339 bone inflammation disease Diseases 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 201000008274 breast adenocarcinoma Diseases 0.000 description 1
- 201000000135 breast papillary carcinoma Diseases 0.000 description 1
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 1
- 201000009267 bronchiectasis Diseases 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- 201000005200 bronchus cancer Diseases 0.000 description 1
- 229960003168 bronopol Drugs 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 125000004369 butenyl group Chemical group C(=CCC)* 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- 229940043253 butylated hydroxyanisole Drugs 0.000 description 1
- CZBZUDVBLSSABA-UHFFFAOYSA-N butylated hydroxyanisole Chemical compound COC1=CC=C(O)C(C(C)(C)C)=C1.COC1=CC=C(O)C=C1C(C)(C)C CZBZUDVBLSSABA-UHFFFAOYSA-N 0.000 description 1
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 1
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 1
- 229940067596 butylparaben Drugs 0.000 description 1
- 102100029402 cAMP-dependent protein kinase catalytic subunit PRKX Human genes 0.000 description 1
- 102100032791 cAMP-dependent protein kinase catalytic subunit alpha Human genes 0.000 description 1
- 102100033065 cAMP-dependent protein kinase catalytic subunit beta Human genes 0.000 description 1
- 102100033064 cAMP-dependent protein kinase catalytic subunit gamma Human genes 0.000 description 1
- 102100022422 cGMP-dependent protein kinase 1 Human genes 0.000 description 1
- 102100022421 cGMP-dependent protein kinase 2 Human genes 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- FNAQSUUGMSOBHW-UHFFFAOYSA-H calcium citrate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O FNAQSUUGMSOBHW-UHFFFAOYSA-H 0.000 description 1
- 239000001354 calcium citrate Substances 0.000 description 1
- 229960004256 calcium citrate Drugs 0.000 description 1
- 229960002283 calcium glubionate Drugs 0.000 description 1
- 229940078512 calcium gluceptate Drugs 0.000 description 1
- FATUQANACHZLRT-KMRXSBRUSA-L calcium glucoheptonate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O FATUQANACHZLRT-KMRXSBRUSA-L 0.000 description 1
- 235000013927 calcium gluconate Nutrition 0.000 description 1
- 239000004227 calcium gluconate Substances 0.000 description 1
- 229960004494 calcium gluconate Drugs 0.000 description 1
- UHHRFSOMMCWGSO-UHFFFAOYSA-L calcium glycerophosphate Chemical compound [Ca+2].OCC(CO)OP([O-])([O-])=O UHHRFSOMMCWGSO-UHFFFAOYSA-L 0.000 description 1
- 229940095618 calcium glycerophosphate Drugs 0.000 description 1
- 235000019299 calcium glycerylphosphate Nutrition 0.000 description 1
- MKJXYGKVIBWPFZ-UHFFFAOYSA-L calcium lactate Chemical compound [Ca+2].CC(O)C([O-])=O.CC(O)C([O-])=O MKJXYGKVIBWPFZ-UHFFFAOYSA-L 0.000 description 1
- 239000001527 calcium lactate Substances 0.000 description 1
- 235000011086 calcium lactate Nutrition 0.000 description 1
- 229960002401 calcium lactate Drugs 0.000 description 1
- 229940078480 calcium levulinate Drugs 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 1
- 235000013539 calcium stearate Nutrition 0.000 description 1
- 239000008116 calcium stearate Substances 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- FATUQANACHZLRT-XBQZYUPDSA-L calcium;(2r,3r,4s,5r,6r)-2,3,4,5,6,7-hexahydroxyheptanoate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C([O-])=O FATUQANACHZLRT-XBQZYUPDSA-L 0.000 description 1
- OKRXSXDSNLJCRS-NLOQLBMISA-L calcium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;(2r,3r,4r,5r)-2,3,5,6-tetrahydroxy-4-[(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanoate;hydrate Chemical compound O.[Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O.[O-]C(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O OKRXSXDSNLJCRS-NLOQLBMISA-L 0.000 description 1
- NEEHYRZPVYRGPP-UHFFFAOYSA-L calcium;2,3,4,5,6-pentahydroxyhexanoate Chemical compound [Ca+2].OCC(O)C(O)C(O)C(O)C([O-])=O.OCC(O)C(O)C(O)C(O)C([O-])=O NEEHYRZPVYRGPP-UHFFFAOYSA-L 0.000 description 1
- JHECKPXUCKQCSH-UHFFFAOYSA-J calcium;disodium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate;hydrate Chemical compound O.[Na+].[Na+].[Ca+2].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O JHECKPXUCKQCSH-UHFFFAOYSA-J 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 125000000609 carbazolyl group Chemical group C1(=CC=CC=2C3=CC=CC=C3NC12)* 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 150000001722 carbon compounds Chemical class 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 108010089576 carboxy-terminal domain kinase Proteins 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 229940096529 carboxypolymethylene Drugs 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 235000010418 carrageenan Nutrition 0.000 description 1
- 229920001525 carrageenan Polymers 0.000 description 1
- 239000000679 carrageenan Substances 0.000 description 1
- 229940113118 carrageenan Drugs 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 239000003729 cation exchange resin Substances 0.000 description 1
- 229940023913 cation exchange resins Drugs 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 201000009636 cerebral lymphoma Diseases 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 201000006662 cervical adenocarcinoma Diseases 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 206010008323 cervicitis Diseases 0.000 description 1
- 229960000800 cetrimonium bromide Drugs 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 229910052729 chemical element Inorganic materials 0.000 description 1
- 208000010575 cherry hemangioma Diseases 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 229910001914 chlorine tetroxide Inorganic materials 0.000 description 1
- VXIVSQZSERGHQP-UHFFFAOYSA-N chloroacetamide Chemical class NC(=O)CCl VXIVSQZSERGHQP-UHFFFAOYSA-N 0.000 description 1
- 229940089960 chloroacetate Drugs 0.000 description 1
- FOCAUTSVDIKZOP-UHFFFAOYSA-M chloroacetate Chemical compound [O-]C(=O)CCl FOCAUTSVDIKZOP-UHFFFAOYSA-M 0.000 description 1
- 229960002242 chlorocresol Drugs 0.000 description 1
- 229960005443 chloroxylenol Drugs 0.000 description 1
- 208000006990 cholangiocarcinoma Diseases 0.000 description 1
- 208000003167 cholangitis Diseases 0.000 description 1
- 201000001352 cholecystitis Diseases 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 208000007451 chronic bronchitis Diseases 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 101150116749 chuk gene Proteins 0.000 description 1
- 125000000259 cinnolinyl group Chemical group N1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 229960002303 citric acid monohydrate Drugs 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 201000010918 connective tissue cancer Diseases 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 235000005822 corn Nutrition 0.000 description 1
- 229930003836 cresol Natural products 0.000 description 1
- 229940013361 cresol Drugs 0.000 description 1
- 229960005168 croscarmellose Drugs 0.000 description 1
- 229960000913 crospovidone Drugs 0.000 description 1
- 235000010947 crosslinked sodium carboxy methyl cellulose Nutrition 0.000 description 1
- LDHQCZJRKDOVOX-NSCUHMNNSA-M crotonate Chemical compound C\C=C\C([O-])=O LDHQCZJRKDOVOX-NSCUHMNNSA-M 0.000 description 1
- 125000006165 cyclic alkyl group Chemical group 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- 125000000392 cycloalkenyl group Chemical group 0.000 description 1
- 125000001047 cyclobutenyl group Chemical group C1(=CCC1)* 0.000 description 1
- LWABFMLTBBNLTA-UHFFFAOYSA-N cyclobutyl carbamate Chemical compound NC(=O)OC1CCC1 LWABFMLTBBNLTA-UHFFFAOYSA-N 0.000 description 1
- 125000002188 cycloheptatrienyl group Chemical group C1(=CC=CC=CC1)* 0.000 description 1
- 125000001162 cycloheptenyl group Chemical group C1(=CCCCCC1)* 0.000 description 1
- 125000003678 cyclohexadienyl group Chemical group C1(=CC=CCC1)* 0.000 description 1
- NNGAQKAUYDTUQR-UHFFFAOYSA-N cyclohexanimine Chemical compound N=C1CCCCC1 NNGAQKAUYDTUQR-UHFFFAOYSA-N 0.000 description 1
- 125000000596 cyclohexenyl group Chemical group C1(=CCCCC1)* 0.000 description 1
- AUELWJRRASQDKI-UHFFFAOYSA-N cyclohexyl carbamate Chemical compound NC(=O)OC1CCCCC1 AUELWJRRASQDKI-UHFFFAOYSA-N 0.000 description 1
- HCAJEUSONLESMK-UHFFFAOYSA-N cyclohexylsulfamic acid Chemical compound OS(=O)(=O)NC1CCCCC1 HCAJEUSONLESMK-UHFFFAOYSA-N 0.000 description 1
- 125000004090 cyclononenyl group Chemical group C1(=CCCCCCCC1)* 0.000 description 1
- 125000006547 cyclononyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000000522 cyclooctenyl group Chemical group C1(=CCCCCCC1)* 0.000 description 1
- 125000002433 cyclopentenyl group Chemical group C1(=CCCC1)* 0.000 description 1
- JMFVWNKPLURQMI-UHFFFAOYSA-N cyclopentyl carbamate Chemical compound NC(=O)OC1CCCC1 JMFVWNKPLURQMI-UHFFFAOYSA-N 0.000 description 1
- 125000000298 cyclopropenyl group Chemical group [H]C1=C([H])C1([H])* 0.000 description 1
- UWYRVVJXSNXVAI-UHFFFAOYSA-N cyclopropylmethyl carbamate Chemical compound NC(=O)OCC1CC1 UWYRVVJXSNXVAI-UHFFFAOYSA-N 0.000 description 1
- 208000002445 cystadenocarcinoma Diseases 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 201000003146 cystitis Diseases 0.000 description 1
- 230000002380 cytological effect Effects 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 201000004400 dacryoadenitis Diseases 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 125000005508 decahydronaphthalenyl group Chemical group 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 235000019258 dehydroacetic acid Nutrition 0.000 description 1
- 229940061632 dehydroacetic acid Drugs 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 201000009803 desquamative interstitial pneumonia Diseases 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 239000012954 diazonium Substances 0.000 description 1
- 150000001989 diazonium salts Chemical class 0.000 description 1
- 229940111685 dibasic potassium phosphate Drugs 0.000 description 1
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 1
- CGMRCMMOCQYHAD-UHFFFAOYSA-J dicalcium hydroxide phosphate Chemical compound [OH-].[Ca++].[Ca++].[O-]P([O-])([O-])=O CGMRCMMOCQYHAD-UHFFFAOYSA-J 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229940095079 dicalcium phosphate anhydrous Drugs 0.000 description 1
- 229940120124 dichloroacetate Drugs 0.000 description 1
- JXTHNDFMNIQAHM-UHFFFAOYSA-N dichloroacetic acid Chemical compound OC(=O)C(Cl)Cl JXTHNDFMNIQAHM-UHFFFAOYSA-N 0.000 description 1
- 150000004683 dihydrates Chemical class 0.000 description 1
- 125000000723 dihydrobenzofuranyl group Chemical group O1C(CC2=C1C=CC=C2)* 0.000 description 1
- 125000004582 dihydrobenzothienyl group Chemical group S1C(CC2=C1C=CC=C2)* 0.000 description 1
- 125000004852 dihydrofuranyl group Chemical group O1C(CC=C1)* 0.000 description 1
- 125000004655 dihydropyridinyl group Chemical group N1(CC=CC=C1)* 0.000 description 1
- 125000005054 dihydropyrrolyl group Chemical group [H]C1=C([H])C([H])([H])C([H])([H])N1* 0.000 description 1
- 125000005057 dihydrothienyl group Chemical group S1C(CC=C1)* 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 235000019329 dioctyl sodium sulphosuccinate Nutrition 0.000 description 1
- 125000000532 dioxanyl group Chemical group 0.000 description 1
- 125000005879 dioxolanyl group Chemical group 0.000 description 1
- SXZIXHOMFPUIRK-UHFFFAOYSA-N diphenylmethanimine Chemical compound C=1C=CC=CC=1C(=N)C1=CC=CC=C1 SXZIXHOMFPUIRK-UHFFFAOYSA-N 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- KCIDZIIHRGYJAE-YGFYJFDDSA-L dipotassium;[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] phosphate Chemical compound [K+].[K+].OC[C@H]1O[C@H](OP([O-])([O-])=O)[C@H](O)[C@@H](O)[C@H]1O KCIDZIIHRGYJAE-YGFYJFDDSA-L 0.000 description 1
- SEBARIVPCNBHKO-UHFFFAOYSA-N dipyridin-2-ylmethyl carbamate Chemical compound C=1C=CC=NC=1C(OC(=O)N)C1=CC=CC=N1 SEBARIVPCNBHKO-UHFFFAOYSA-N 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 125000005883 dithianyl group Chemical group 0.000 description 1
- WSDISUOETYTPRL-UHFFFAOYSA-N dmdm hydantoin Chemical compound CC1(C)N(CO)C(=O)N(CO)C1=O WSDISUOETYTPRL-UHFFFAOYSA-N 0.000 description 1
- 229960000878 docusate sodium Drugs 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 102100034175 eIF-2-alpha kinase GCN2 Human genes 0.000 description 1
- 208000019258 ear infection Diseases 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 229960001484 edetic acid Drugs 0.000 description 1
- 235000013345 egg yolk Nutrition 0.000 description 1
- 210000002969 egg yolk Anatomy 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 201000011025 embryonal testis carcinoma Diseases 0.000 description 1
- 150000002081 enamines Chemical class 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 206010014665 endocarditis Diseases 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 208000010227 enterocolitis Diseases 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 201000010063 epididymitis Diseases 0.000 description 1
- 208000037828 epithelial carcinoma Diseases 0.000 description 1
- 208000028653 esophageal adenocarcinoma Diseases 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 1
- 229960004756 ethanol Drugs 0.000 description 1
- 125000001033 ether group Chemical group 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 229960001617 ethyl hydroxybenzoate Drugs 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 235000010228 ethyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004403 ethyl p-hydroxybenzoate Substances 0.000 description 1
- 125000000219 ethylidene group Chemical group [H]C(=[*])C([H])([H])[H] 0.000 description 1
- NUVBSKCKDOMJSU-UHFFFAOYSA-N ethylparaben Chemical compound CCOC(=O)C1=CC=C(O)C=C1 NUVBSKCKDOMJSU-UHFFFAOYSA-N 0.000 description 1
- 241001233957 eudicotyledons Species 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 210000003722 extracellular fluid Anatomy 0.000 description 1
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 210000003608 fece Anatomy 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- FGIVSGPRGVABAB-UHFFFAOYSA-N fluoren-9-ylmethyl hydrogen carbonate Chemical compound C1=CC=C2C(COC(=O)O)C3=CC=CC=C3C2=C1 FGIVSGPRGVABAB-UHFFFAOYSA-N 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 125000001153 fluoro group Chemical group F* 0.000 description 1
- 201000003444 follicular lymphoma Diseases 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- RGEAONPOJJBMHO-UHFFFAOYSA-N furan-2-ylmethyl carbamate Chemical compound NC(=O)OCC1=CC=CO1 RGEAONPOJJBMHO-UHFFFAOYSA-N 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 201000006585 gastric adenocarcinoma Diseases 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 1
- 230000014509 gene expression Effects 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 201000003115 germ cell cancer Diseases 0.000 description 1
- 208000007565 gingivitis Diseases 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 229950006191 gluconic acid Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- JFCQEDHGNNZCLN-UHFFFAOYSA-N glutaric acid Chemical compound OC(=O)CCCC(O)=O JFCQEDHGNNZCLN-UHFFFAOYSA-N 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 229960005150 glycerol Drugs 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 125000003976 glyceryl group Chemical group [H]C([*])([H])C(O[H])([H])C(O[H])([H])[H] 0.000 description 1
- 229940075507 glyceryl monostearate Drugs 0.000 description 1
- 239000001087 glyceryl triacetate Substances 0.000 description 1
- 235000013773 glyceryl triacetate Nutrition 0.000 description 1
- 210000001126 granulation tissue Anatomy 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- LHGVFZTZFXWLCP-UHFFFAOYSA-N guaiacol Chemical class COC1=CC=CC=C1O LHGVFZTZFXWLCP-UHFFFAOYSA-N 0.000 description 1
- 235000010417 guar gum Nutrition 0.000 description 1
- 239000000665 guar gum Substances 0.000 description 1
- 229960002154 guar gum Drugs 0.000 description 1
- 235000019314 gum ghatti Nutrition 0.000 description 1
- 150000004820 halides Chemical class 0.000 description 1
- 125000005843 halogen group Chemical group 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 201000000459 head and neck squamous cell carcinoma Diseases 0.000 description 1
- 201000002222 hemangioblastoma Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- 125000005549 heteroarylene group Chemical group 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- 150000004687 hexahydrates Chemical class 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 1
- 125000006038 hexenyl group Chemical group 0.000 description 1
- 229960004867 hexetidine Drugs 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000005980 hexynyl group Chemical group 0.000 description 1
- 239000010903 husk Substances 0.000 description 1
- 229930195733 hydrocarbon Natural products 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- ZMZDMBWJUHKJPS-UHFFFAOYSA-N hydrogen thiocyanate Natural products SC#N ZMZDMBWJUHKJPS-UHFFFAOYSA-N 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- HSNUXDIQZKIQRR-UHFFFAOYSA-N hydroxy-imino-bis(phenylmethoxy)-$l^{5}-phosphane Chemical compound C=1C=CC=CC=1COP(=O)(N)OCC1=CC=CC=C1 HSNUXDIQZKIQRR-UHFFFAOYSA-N 0.000 description 1
- QWMUDOFWQWBHFI-UHFFFAOYSA-N hydroxy-imino-diphenoxy-$l^{5}-phosphane Chemical compound C=1C=CC=CC=1OP(=O)(N)OC1=CC=CC=C1 QWMUDOFWQWBHFI-UHFFFAOYSA-N 0.000 description 1
- RIGIWEGXTTUCIQ-UHFFFAOYSA-N hydroxy-imino-diphenyl-$l^{5}-phosphane Chemical compound C=1C=CC=CC=1P(=O)(N)C1=CC=CC=C1 RIGIWEGXTTUCIQ-UHFFFAOYSA-N 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 1
- 201000006866 hypopharynx cancer Diseases 0.000 description 1
- 208000009326 ileitis Diseases 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229940113174 imidurea Drugs 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 125000003453 indazolyl group Chemical group N1N=C(C2=C1C=CC=C2)* 0.000 description 1
- 125000003387 indolinyl group Chemical group N1(CCC2=CC=CC=C12)* 0.000 description 1
- 125000003406 indolizinyl group Chemical group C=1(C=CN2C=CC=CC12)* 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 238000002329 infrared spectrum Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 108010054372 insulin receptor-related receptor Proteins 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 201000004614 iritis Diseases 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 208000037906 ischaemic injury Diseases 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- KQNPFQTWMSNSAP-UHFFFAOYSA-N isobutyric acid Chemical compound CC(C)C(O)=O KQNPFQTWMSNSAP-UHFFFAOYSA-N 0.000 description 1
- 125000004594 isoindolinyl group Chemical group C1(NCC2=CC=CC=C12)* 0.000 description 1
- 125000000904 isoindolyl group Chemical group C=1(NC=C2C=CC=CC12)* 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 1
- 125000001972 isopentyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000002183 isoquinolinyl group Chemical group C1(=NC=CC2=CC=CC=C12)* 0.000 description 1
- 125000001786 isothiazolyl group Chemical group 0.000 description 1
- 125000000842 isoxazolyl group Chemical group 0.000 description 1
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 201000010982 kidney cancer Diseases 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-M lactobionate Chemical compound [O-]C(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-M 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000021374 legumes Nutrition 0.000 description 1
- 206010024217 lentigo Diseases 0.000 description 1
- 235000005772 leucine Nutrition 0.000 description 1
- 229940058352 levulinate Drugs 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 229960001078 lithium Drugs 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 201000003265 lymphadenitis Diseases 0.000 description 1
- 208000037829 lymphangioendotheliosarcoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 208000005158 lymphoid interstitial pneumonia Diseases 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 201000007919 lymphoplasmacytic lymphoma Diseases 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- VTHJTEIRLNZDEV-UHFFFAOYSA-L magnesium dihydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 1
- 239000000347 magnesium hydroxide Substances 0.000 description 1
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 1
- 229960000816 magnesium hydroxide Drugs 0.000 description 1
- 229940037627 magnesium lauryl sulfate Drugs 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 229940091250 magnesium supplement Drugs 0.000 description 1
- HBNDBUATLJAUQM-UHFFFAOYSA-L magnesium;dodecyl sulfate Chemical compound [Mg+2].CCCCCCCCCCCCOS([O-])(=O)=O.CCCCCCCCCCCCOS([O-])(=O)=O HBNDBUATLJAUQM-UHFFFAOYSA-L 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 235000009973 maize Nutrition 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- 239000001630 malic acid Substances 0.000 description 1
- 235000011090 malic acid Nutrition 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 101150069838 mapk-15 gene Proteins 0.000 description 1
- 201000007924 marginal zone B-cell lymphoma Diseases 0.000 description 1
- 208000021937 marginal zone lymphoma Diseases 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 208000008585 mastocytosis Diseases 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 208000030163 medullary breast carcinoma Diseases 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 210000001704 mesoblast Anatomy 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-M methanesulfonate group Chemical group CS(=O)(=O)[O-] AFVFQIVMOAPDHO-UHFFFAOYSA-M 0.000 description 1
- HNQIVZYLYMDVSB-UHFFFAOYSA-N methanesulfonimidic acid Chemical compound CS(N)(=O)=O HNQIVZYLYMDVSB-UHFFFAOYSA-N 0.000 description 1
- RMIODHQZRUFFFF-UHFFFAOYSA-M methoxyacetate Chemical compound COCC([O-])=O RMIODHQZRUFFFF-UHFFFAOYSA-M 0.000 description 1
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 1
- BEGLCMHJXHIJLR-UHFFFAOYSA-N methylisothiazolinone Chemical compound CN1SC=CC1=O BEGLCMHJXHIJLR-UHFFFAOYSA-N 0.000 description 1
- NYEBKUUITGFJAK-UHFFFAOYSA-N methylsulfanylmethanethioic s-acid Chemical compound CSC(O)=S NYEBKUUITGFJAK-UHFFFAOYSA-N 0.000 description 1
- 238000001531 micro-dissection Methods 0.000 description 1
- 206010063344 microscopic polyangiitis Diseases 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 235000019713 millet Nutrition 0.000 description 1
- 235000013379 molasses Nutrition 0.000 description 1
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 1
- 229940111688 monobasic potassium phosphate Drugs 0.000 description 1
- 229940045641 monobasic sodium phosphate Drugs 0.000 description 1
- 201000005328 monoclonal gammopathy of uncertain significance Diseases 0.000 description 1
- RZRNAYUHWVFMIP-UHFFFAOYSA-N monoelaidin Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC(O)CO RZRNAYUHWVFMIP-UHFFFAOYSA-N 0.000 description 1
- 150000004682 monohydrates Chemical class 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 1
- 125000002757 morpholinyl group Chemical group 0.000 description 1
- 208000026114 mu chain disease Diseases 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 201000006417 multiple sclerosis Diseases 0.000 description 1
- 201000002077 muscle cancer Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 208000001611 myxosarcoma Diseases 0.000 description 1
- DUWWHGPELOTTOE-UHFFFAOYSA-N n-(5-chloro-2,4-dimethoxyphenyl)-3-oxobutanamide Chemical compound COC1=CC(OC)=C(NC(=O)CC(C)=O)C=C1Cl DUWWHGPELOTTOE-UHFFFAOYSA-N 0.000 description 1
- YNTOKMNHRPSGFU-UHFFFAOYSA-N n-Propyl carbamate Chemical compound CCCOC(N)=O YNTOKMNHRPSGFU-UHFFFAOYSA-N 0.000 description 1
- JTSLALYXYSRPGW-UHFFFAOYSA-N n-[5-(4-cyanophenyl)-1h-pyrrolo[2,3-b]pyridin-3-yl]pyridine-3-carboxamide Chemical compound C=1C=CN=CC=1C(=O)NC(C1=C2)=CNC1=NC=C2C1=CC=C(C#N)C=C1 JTSLALYXYSRPGW-UHFFFAOYSA-N 0.000 description 1
- GOQYKNQRPGWPLP-UHFFFAOYSA-N n-heptadecyl alcohol Natural products CCCCCCCCCCCCCCCCCO GOQYKNQRPGWPLP-UHFFFAOYSA-N 0.000 description 1
- 125000003136 n-heptyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-M naphthalene-2-sulfonate Chemical compound C1=CC=CC2=CC(S(=O)(=O)[O-])=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-M 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-N naphthalene-2-sulfonic acid Chemical compound C1=CC=CC2=CC(S(=O)(=O)O)=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-N 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 125000004593 naphthyridinyl group Chemical group N1=C(C=CC2=CC=CN=C12)* 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 208000004995 necrotizing enterocolitis Diseases 0.000 description 1
- 201000007970 necrotizing fasciitis Diseases 0.000 description 1
- 125000001971 neopentyl group Chemical group [H]C([*])([H])C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 201000009494 neurilemmomatosis Diseases 0.000 description 1
- 201000002120 neuroendocrine carcinoma Diseases 0.000 description 1
- 208000029974 neurofibrosarcoma Diseases 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- 210000002445 nipple Anatomy 0.000 description 1
- SFDJOSRHYKHMOK-UHFFFAOYSA-N nitramide Chemical compound N[N+]([O-])=O SFDJOSRHYKHMOK-UHFFFAOYSA-N 0.000 description 1
- 229910000069 nitrogen hydride Inorganic materials 0.000 description 1
- XKLJHFLUAHKGGU-UHFFFAOYSA-N nitrous amide Chemical compound ON=N XKLJHFLUAHKGGU-UHFFFAOYSA-N 0.000 description 1
- BDJRBEYXGGNYIS-UHFFFAOYSA-N nonanedioic acid Chemical compound OC(=O)CCCCCCCC(O)=O BDJRBEYXGGNYIS-UHFFFAOYSA-N 0.000 description 1
- 239000012038 nucleophile Substances 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 125000004365 octenyl group Chemical group C(=CCCCCCC)* 0.000 description 1
- JPMIIZHYYWMHDT-UHFFFAOYSA-N octhilinone Chemical compound CCCCCCCCN1SC=CC1=O JPMIIZHYYWMHDT-UHFFFAOYSA-N 0.000 description 1
- 125000005069 octynyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C#C* 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- 229960002969 oleic acid Drugs 0.000 description 1
- 229940055577 oleyl alcohol Drugs 0.000 description 1
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 1
- 206010030306 omphalitis Diseases 0.000 description 1
- 208000005963 oophoritis Diseases 0.000 description 1
- 201000002740 oral squamous cell carcinoma Diseases 0.000 description 1
- 201000005737 orchitis Diseases 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 208000013371 ovarian adenocarcinoma Diseases 0.000 description 1
- 201000011029 ovarian embryonal carcinoma Diseases 0.000 description 1
- 201000006588 ovary adenocarcinoma Diseases 0.000 description 1
- 125000005882 oxadiazolinyl group Chemical group 0.000 description 1
- 125000001715 oxadiazolyl group Chemical group 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 125000002971 oxazolyl group Chemical group 0.000 description 1
- 125000003551 oxepanyl group Chemical group 0.000 description 1
- 125000003585 oxepinyl group Chemical group 0.000 description 1
- 125000003566 oxetanyl group Chemical group 0.000 description 1
- 150000002924 oxiranes Chemical class 0.000 description 1
- 125000000466 oxiranyl group Chemical group 0.000 description 1
- AUONHKJOIZSQGR-UHFFFAOYSA-N oxophosphane Chemical compound P=O AUONHKJOIZSQGR-UHFFFAOYSA-N 0.000 description 1
- 125000003854 p-chlorophenyl group Chemical group [H]C1=C([H])C(*)=C([H])C([H])=C1Cl 0.000 description 1
- 125000006505 p-cyanobenzyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1C#N)C([H])([H])* 0.000 description 1
- 125000006503 p-nitrobenzyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1[N+]([O-])=O)C([H])([H])* 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 208000022102 pancreatic neuroendocrine neoplasm Diseases 0.000 description 1
- 208000004019 papillary adenocarcinoma Diseases 0.000 description 1
- 208000012111 paraneoplastic syndrome Diseases 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 201000001976 pemphigus vulgaris Diseases 0.000 description 1
- 125000002255 pentenyl group Chemical group C(=CCCC)* 0.000 description 1
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 1
- 125000005981 pentynyl group Chemical group 0.000 description 1
- VLTRZXGMWDSKGL-UHFFFAOYSA-M perchlorate Chemical compound [O-]Cl(=O)(=O)=O VLTRZXGMWDSKGL-UHFFFAOYSA-M 0.000 description 1
- 239000002304 perfume Substances 0.000 description 1
- 208000008494 pericarditis Diseases 0.000 description 1
- 201000006195 perinatal necrotizing enterocolitis Diseases 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 210000000578 peripheral nerve Anatomy 0.000 description 1
- JRKICGRDRMAZLK-UHFFFAOYSA-L peroxydisulfate Chemical compound [O-]S(=O)(=O)OOS([O-])(=O)=O JRKICGRDRMAZLK-UHFFFAOYSA-L 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 230000009038 pharmacological inhibition Effects 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- LCPDWSOZIOUXRV-UHFFFAOYSA-N phenoxyacetic acid Chemical compound OC(=O)COC1=CC=CC=C1 LCPDWSOZIOUXRV-UHFFFAOYSA-N 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- BSCCSDNZEIHXOK-UHFFFAOYSA-N phenyl carbamate Chemical compound NC(=O)OC1=CC=CC=C1 BSCCSDNZEIHXOK-UHFFFAOYSA-N 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- FAQJJMHZNSSFSM-UHFFFAOYSA-N phenylglyoxylic acid Chemical compound OC(=O)C(=O)C1=CC=CC=C1 FAQJJMHZNSSFSM-UHFFFAOYSA-N 0.000 description 1
- PDTFCHSETJBPTR-UHFFFAOYSA-N phenylmercuric nitrate Chemical compound [O-][N+](=O)O[Hg]C1=CC=CC=C1 PDTFCHSETJBPTR-UHFFFAOYSA-N 0.000 description 1
- ABOYDMHGKWRPFD-UHFFFAOYSA-N phenylmethanesulfonamide Chemical compound NS(=O)(=O)CC1=CC=CC=C1 ABOYDMHGKWRPFD-UHFFFAOYSA-N 0.000 description 1
- NIXKBAZVOQAHGC-UHFFFAOYSA-N phenylmethanesulfonic acid Chemical compound OS(=O)(=O)CC1=CC=CC=C1 NIXKBAZVOQAHGC-UHFFFAOYSA-N 0.000 description 1
- AFDMODCXODAXLC-UHFFFAOYSA-N phenylmethanimine Chemical compound N=CC1=CC=CC=C1 AFDMODCXODAXLC-UHFFFAOYSA-N 0.000 description 1
- 208000001297 phlebitis Diseases 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 150000008298 phosphoramidates Chemical class 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 230000000865 phosphorylative effect Effects 0.000 description 1
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 1
- 125000005498 phthalate group Chemical class 0.000 description 1
- 125000004592 phthalazinyl group Chemical group C1(=NN=CC2=CC=CC=C12)* 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 235000002949 phytic acid Nutrition 0.000 description 1
- 239000000467 phytic acid Substances 0.000 description 1
- 229940068041 phytic acid Drugs 0.000 description 1
- IBBMAWULFFBRKK-UHFFFAOYSA-N picolinamide Chemical class NC(=O)C1=CC=CC=N1 IBBMAWULFFBRKK-UHFFFAOYSA-N 0.000 description 1
- 229940075930 picrate Drugs 0.000 description 1
- OXNIZHLAWKMVMX-UHFFFAOYSA-M picrate anion Chemical compound [O-]C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O OXNIZHLAWKMVMX-UHFFFAOYSA-M 0.000 description 1
- WLJVNTCWHIRURA-UHFFFAOYSA-M pimelate(1-) Chemical compound OC(=O)CCCCCC([O-])=O WLJVNTCWHIRURA-UHFFFAOYSA-M 0.000 description 1
- 208000024724 pineal body neoplasm Diseases 0.000 description 1
- 201000004123 pineal gland cancer Diseases 0.000 description 1
- 125000004193 piperazinyl group Chemical group 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-M pivalate Chemical compound CC(C)(C)C([O-])=O IUGYQRQAERSCNH-UHFFFAOYSA-M 0.000 description 1
- 125000005547 pivalate group Chemical group 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 210000004180 plasmocyte Anatomy 0.000 description 1
- 208000008423 pleurisy Diseases 0.000 description 1
- 206010035653 pneumoconiosis Diseases 0.000 description 1
- 108010056274 polo-like kinase 1 Proteins 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 239000004584 polyacrylic acid Substances 0.000 description 1
- 125000003367 polycyclic group Chemical group 0.000 description 1
- 208000030151 polycystic kidney disease 3 with or without polycystic liver disease Diseases 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 229920000259 polyoxyethylene lauryl ether Polymers 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229940068984 polyvinyl alcohol Drugs 0.000 description 1
- 235000013809 polyvinylpolypyrrolidone Nutrition 0.000 description 1
- 229920000523 polyvinylpolypyrrolidone Polymers 0.000 description 1
- 235000011056 potassium acetate Nutrition 0.000 description 1
- 229960004109 potassium acetate Drugs 0.000 description 1
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 1
- 235000010235 potassium benzoate Nutrition 0.000 description 1
- 239000004300 potassium benzoate Substances 0.000 description 1
- 229940103091 potassium benzoate Drugs 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 239000004224 potassium gluconate Substances 0.000 description 1
- 235000013926 potassium gluconate Nutrition 0.000 description 1
- 229960003189 potassium gluconate Drugs 0.000 description 1
- 229940096992 potassium oleate Drugs 0.000 description 1
- 229940093916 potassium phosphate Drugs 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- BHZRJJOHZFYXTO-UHFFFAOYSA-L potassium sulfite Chemical compound [K+].[K+].[O-]S([O-])=O BHZRJJOHZFYXTO-UHFFFAOYSA-L 0.000 description 1
- 235000019252 potassium sulphite Nutrition 0.000 description 1
- MLICVSDCCDDWMD-KVVVOXFISA-M potassium;(z)-octadec-9-enoate Chemical compound [K+].CCCCCCCC\C=C/CCCCCCCC([O-])=O MLICVSDCCDDWMD-KVVVOXFISA-M 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229920003124 powdered cellulose Polymers 0.000 description 1
- 235000019814 powdered cellulose Nutrition 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 201000006037 primary mediastinal B-cell lymphoma Diseases 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- OCAAZRFBJBEVPS-UHFFFAOYSA-N prop-2-enyl carbamate Chemical compound NC(=O)OCC=C OCAAZRFBJBEVPS-UHFFFAOYSA-N 0.000 description 1
- ZNZJJSYHZBXQSM-UHFFFAOYSA-N propane-2,2-diamine Chemical compound CC(C)(N)N ZNZJJSYHZBXQSM-UHFFFAOYSA-N 0.000 description 1
- 125000004368 propenyl group Chemical group C(=CC)* 0.000 description 1
- 229940095574 propionic acid Drugs 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229940093625 propylene glycol monostearate Drugs 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 201000005825 prostate adenocarcinoma Diseases 0.000 description 1
- 201000007094 prostatitis Diseases 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 108010067366 proto-oncogene protein c-fes-fps Proteins 0.000 description 1
- 108010067562 proto-oncogene proteins c-fgr Proteins 0.000 description 1
- 125000001042 pteridinyl group Chemical group N1=C(N=CC2=NC=CN=C12)* 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000002098 pyridazinyl group Chemical group 0.000 description 1
- RWUGBYOALBYTGU-UHFFFAOYSA-N pyridin-4-ylmethyl carbamate Chemical compound NC(=O)OCC1=CC=NC=C1 RWUGBYOALBYTGU-UHFFFAOYSA-N 0.000 description 1
- 125000000719 pyrrolidinyl group Chemical group 0.000 description 1
- GZTPJDLYPMPRDF-UHFFFAOYSA-N pyrrolo[3,2-c]pyrazole Chemical compound N1=NC2=CC=NC2=C1 GZTPJDLYPMPRDF-UHFFFAOYSA-N 0.000 description 1
- 125000000168 pyrrolyl group Chemical group 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 150000003242 quaternary ammonium salts Chemical class 0.000 description 1
- 125000002294 quinazolinyl group Chemical group N1=C(N=CC2=CC=CC=C12)* 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- FLCPORVHXQFBHT-UHFFFAOYSA-N quinolin-8-yl carbamate Chemical compound C1=CN=C2C(OC(=O)N)=CC=CC2=C1 FLCPORVHXQFBHT-UHFFFAOYSA-N 0.000 description 1
- 125000001567 quinoxalinyl group Chemical group N1=C(C=NC2=CC=CC=C12)* 0.000 description 1
- 230000005258 radioactive decay Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 208000002574 reactive arthritis Diseases 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000001953 recrystallisation Methods 0.000 description 1
- 230000037425 regulation of transcription Effects 0.000 description 1
- 201000006845 reticulosarcoma Diseases 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 206010039083 rhinitis Diseases 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- YBKWIGSMABMNJZ-UHFFFAOYSA-N s-(2,3,4,5,6-pentachlorophenyl)thiohydroxylamine Chemical compound NSC1=C(Cl)C(Cl)=C(Cl)C(Cl)=C1Cl YBKWIGSMABMNJZ-UHFFFAOYSA-N 0.000 description 1
- RTKRAORYZUBVGQ-UHFFFAOYSA-N s-(2,4-dinitrophenyl)thiohydroxylamine Chemical compound NSC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O RTKRAORYZUBVGQ-UHFFFAOYSA-N 0.000 description 1
- LOVVSIULYJABJF-UHFFFAOYSA-N s-(2-nitrophenyl)thiohydroxylamine Chemical compound NSC1=CC=CC=C1[N+]([O-])=O LOVVSIULYJABJF-UHFFFAOYSA-N 0.000 description 1
- BDEZGPKAMAVGBE-UHFFFAOYSA-N s-(3-nitropyridin-2-yl)thiohydroxylamine Chemical compound NSC1=NC=CC=C1[N+]([O-])=O BDEZGPKAMAVGBE-UHFFFAOYSA-N 0.000 description 1
- DAXSYWBYJZACTA-UHFFFAOYSA-N s-(4-methoxy-2-nitrophenyl)thiohydroxylamine Chemical compound COC1=CC=C(SN)C([N+]([O-])=O)=C1 DAXSYWBYJZACTA-UHFFFAOYSA-N 0.000 description 1
- LOFZYSZWOLKUGE-UHFFFAOYSA-N s-benzyl carbamothioate Chemical compound NC(=O)SCC1=CC=CC=C1 LOFZYSZWOLKUGE-UHFFFAOYSA-N 0.000 description 1
- MAGSSGQAJNNDLU-UHFFFAOYSA-N s-phenylthiohydroxylamine Chemical compound NSC1=CC=CC=C1 MAGSSGQAJNNDLU-UHFFFAOYSA-N 0.000 description 1
- PIDYQAYNSQSDQY-UHFFFAOYSA-N s-tritylthiohydroxylamine Chemical compound C=1C=CC=CC=1C(C=1C=CC=CC=1)(SN)C1=CC=CC=C1 PIDYQAYNSQSDQY-UHFFFAOYSA-N 0.000 description 1
- BPELEZSCHIEMAE-UHFFFAOYSA-N salicylaldehyde imine Chemical compound OC1=CC=CC=C1C=N BPELEZSCHIEMAE-UHFFFAOYSA-N 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 201000000306 sarcoidosis Diseases 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 210000004706 scrotum Anatomy 0.000 description 1
- 208000014956 scrotum Paget disease Diseases 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 229940116351 sebacate Drugs 0.000 description 1
- CXMXRPHRNRROMY-UHFFFAOYSA-L sebacate(2-) Chemical compound [O-]C(=O)CCCCCCCCC([O-])=O CXMXRPHRNRROMY-UHFFFAOYSA-L 0.000 description 1
- 201000008407 sebaceous adenocarcinoma Diseases 0.000 description 1
- 201000003385 seborrheic keratosis Diseases 0.000 description 1
- 125000003548 sec-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 208000011581 secondary neoplasm Diseases 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 201000005574 senile angioma Diseases 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 235000004400 serine Nutrition 0.000 description 1
- 150000003355 serines Chemical class 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 150000004760 silicates Chemical class 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 201000009890 sinusitis Diseases 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 201000000195 skin tag Diseases 0.000 description 1
- 201000002314 small intestine cancer Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- AWUCVROLDVIAJX-GSVOUGTGSA-N sn-glycerol 3-phosphate Chemical compound OC[C@@H](O)COP(O)(O)=O AWUCVROLDVIAJX-GSVOUGTGSA-N 0.000 description 1
- 235000010378 sodium ascorbate Nutrition 0.000 description 1
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 1
- 229960005055 sodium ascorbate Drugs 0.000 description 1
- 229960003885 sodium benzoate Drugs 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000011083 sodium citrates Nutrition 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- APSBXTVYXVQYAB-UHFFFAOYSA-M sodium docusate Chemical compound [Na+].CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC APSBXTVYXVQYAB-UHFFFAOYSA-M 0.000 description 1
- 229940037001 sodium edetate Drugs 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- KSAVQLQVUXSOCR-UHFFFAOYSA-M sodium lauroyl sarcosinate Chemical compound [Na+].CCCCCCCCCCCC(=O)N(C)CC([O-])=O KSAVQLQVUXSOCR-UHFFFAOYSA-M 0.000 description 1
- JXKPEJDQGNYQSM-UHFFFAOYSA-M sodium propionate Chemical compound [Na+].CCC([O-])=O JXKPEJDQGNYQSM-UHFFFAOYSA-M 0.000 description 1
- 235000010334 sodium propionate Nutrition 0.000 description 1
- 239000004324 sodium propionate Substances 0.000 description 1
- 229960003212 sodium propionate Drugs 0.000 description 1
- 229940001482 sodium sulfite Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 235000011069 sorbitan monooleate Nutrition 0.000 description 1
- 239000001593 sorbitan monooleate Substances 0.000 description 1
- 229940035049 sorbitan monooleate Drugs 0.000 description 1
- 235000011071 sorbitan monopalmitate Nutrition 0.000 description 1
- 239000001570 sorbitan monopalmitate Substances 0.000 description 1
- 229940031953 sorbitan monopalmitate Drugs 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- 235000011078 sorbitan tristearate Nutrition 0.000 description 1
- 239000001589 sorbitan tristearate Substances 0.000 description 1
- 229960004129 sorbitan tristearate Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 206010062113 splenic marginal zone lymphoma Diseases 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 229940012831 stearyl alcohol Drugs 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 208000003265 stomatitis Diseases 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- TYFQFVWCELRYAO-UHFFFAOYSA-L suberate(2-) Chemical compound [O-]C(=O)CCCCCCC([O-])=O TYFQFVWCELRYAO-UHFFFAOYSA-L 0.000 description 1
- 125000005346 substituted cycloalkyl group Chemical group 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 125000000565 sulfonamide group Chemical group 0.000 description 1
- 150000003459 sulfonic acid esters Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 210000004243 sweat Anatomy 0.000 description 1
- 201000010965 sweat gland carcinoma Diseases 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 201000004595 synovitis Diseases 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 201000004415 tendinitis Diseases 0.000 description 1
- XBXCNNQPRYLIDE-UHFFFAOYSA-N tert-butylcarbamic acid Chemical compound CC(C)(C)NC(O)=O XBXCNNQPRYLIDE-UHFFFAOYSA-N 0.000 description 1
- 125000001973 tert-pentyl group Chemical group [H]C([H])([H])C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 206010062123 testicular embryonal carcinoma Diseases 0.000 description 1
- 201000002814 testicular lymphoma Diseases 0.000 description 1
- 108091008743 testicular receptors 4 Proteins 0.000 description 1
- 125000003039 tetrahydroisoquinolinyl group Chemical group C1(NCCC2=CC=CC=C12)* 0.000 description 1
- 125000000147 tetrahydroquinolinyl group Chemical group N1(CCCC2=CC=CC=C12)* 0.000 description 1
- 125000003507 tetrahydrothiofenyl group Chemical group 0.000 description 1
- 125000004632 tetrahydrothiopyranyl group Chemical group S1C(CCCC1)* 0.000 description 1
- 125000005247 tetrazinyl group Chemical group N1=NN=NC(=C1)* 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- 125000005305 thiadiazolinyl group Chemical group 0.000 description 1
- 125000001113 thiadiazolyl group Chemical group 0.000 description 1
- 125000005458 thianyl group Chemical group 0.000 description 1
- 125000000335 thiazolyl group Chemical group 0.000 description 1
- 125000001544 thienyl group Chemical group 0.000 description 1
- 125000001583 thiepanyl group Chemical group 0.000 description 1
- 125000003777 thiepinyl group Chemical group 0.000 description 1
- 125000002053 thietanyl group Chemical group 0.000 description 1
- 125000001730 thiiranyl group Chemical group 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 150000003568 thioethers Chemical group 0.000 description 1
- 150000003588 threonines Chemical class 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- UIERETOOQGIECD-ONEGZZNKSA-N tiglic acid Chemical compound C\C=C(/C)C(O)=O UIERETOOQGIECD-ONEGZZNKSA-N 0.000 description 1
- 230000000451 tissue damage Effects 0.000 description 1
- 231100000827 tissue damage Toxicity 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- 235000010384 tocopherol Nutrition 0.000 description 1
- 229930003799 tocopherol Natural products 0.000 description 1
- 239000011732 tocopherol Substances 0.000 description 1
- 229960001295 tocopherol Drugs 0.000 description 1
- 229940042585 tocopherol acetate Drugs 0.000 description 1
- LMYRWZFENFIFIT-UHFFFAOYSA-N toluene-4-sulfonamide Chemical compound CC1=CC=C(S(N)(=O)=O)C=C1 LMYRWZFENFIFIT-UHFFFAOYSA-N 0.000 description 1
- 206010044008 tonsillitis Diseases 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000440 toxicity profile Toxicity 0.000 description 1
- 208000002419 toxicodendron dermatitis Diseases 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 230000037426 transcriptional repression Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000000844 transformation Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 208000009174 transverse myelitis Diseases 0.000 description 1
- 229960002622 triacetin Drugs 0.000 description 1
- 125000004306 triazinyl group Chemical group 0.000 description 1
- 125000005881 triazolinyl group Chemical group 0.000 description 1
- 125000001425 triazolyl group Chemical group 0.000 description 1
- 235000013337 tricalcium citrate Nutrition 0.000 description 1
- 235000019731 tricalcium phosphate Nutrition 0.000 description 1
- 229940066528 trichloroacetate Drugs 0.000 description 1
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- KAKQVSNHTBLJCH-UHFFFAOYSA-N trifluoromethanesulfonimidic acid Chemical compound NS(=O)(=O)C(F)(F)F KAKQVSNHTBLJCH-UHFFFAOYSA-N 0.000 description 1
- 125000000876 trifluoromethoxy group Chemical group FC(F)(F)O* 0.000 description 1
- 125000000026 trimethylsilyl group Chemical group [H]C([H])([H])[Si]([*])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- BZVJOYBTLHNRDW-UHFFFAOYSA-N triphenylmethanamine Chemical compound C=1C=CC=CC=1C(C=1C=CC=CC=1)(N)C1=CC=CC=C1 BZVJOYBTLHNRDW-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229960005066 trisodium edetate Drugs 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- WFKWXMTUELFFGS-UHFFFAOYSA-N tungsten Chemical compound [W] WFKWXMTUELFFGS-UHFFFAOYSA-N 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 239000010937 tungsten Substances 0.000 description 1
- 230000005951 type IV hypersensitivity Effects 0.000 description 1
- 208000027930 type IV hypersensitivity disease Diseases 0.000 description 1
- 229940121358 tyrosine kinase inhibitor Drugs 0.000 description 1
- ZDPHROOEEOARMN-UHFFFAOYSA-N undecanoic acid Chemical compound CCCCCCCCCCC(O)=O ZDPHROOEEOARMN-UHFFFAOYSA-N 0.000 description 1
- 229930195735 unsaturated hydrocarbon Natural products 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 208000000143 urethritis Diseases 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000037965 uterine sarcoma Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- LVLANIHJQRZTPY-UHFFFAOYSA-N vinyl carbamate Chemical compound NC(=O)OC=C LVLANIHJQRZTPY-UHFFFAOYSA-N 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 235000019154 vitamin C Nutrition 0.000 description 1
- 239000011718 vitamin C Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 229940045997 vitamin a Drugs 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 208000028010 vulval Paget disease Diseases 0.000 description 1
- 208000002003 vulvitis Diseases 0.000 description 1
- 208000010484 vulvovaginitis Diseases 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 210000002268 wool Anatomy 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 125000001834 xanthenyl group Chemical group C1=CC=CC=2OC3=CC=CC=C3C(C12)* 0.000 description 1
- UHVMMEOXYDMDKI-JKYCWFKZSA-L zinc;1-(5-cyanopyridin-2-yl)-3-[(1s,2s)-2-(6-fluoro-2-hydroxy-3-propanoylphenyl)cyclopropyl]urea;diacetate Chemical compound [Zn+2].CC([O-])=O.CC([O-])=O.CCC(=O)C1=CC=C(F)C([C@H]2[C@H](C2)NC(=O)NC=2N=CC(=CC=2)C#N)=C1O UHVMMEOXYDMDKI-JKYCWFKZSA-L 0.000 description 1
- 235000004835 α-tocopherol Nutrition 0.000 description 1
- 239000002076 α-tocopherol Substances 0.000 description 1
- OENHQHLEOONYIE-JLTXGRSLSA-N β-Carotene Chemical compound CC=1CCCC(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C OENHQHLEOONYIE-JLTXGRSLSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/415—1,2-Diazoles
- A61K31/4162—1,2-Diazoles condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/445—Non condensed piperidines, e.g. piperocaine
- A61K31/4523—Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems
- A61K31/454—Non condensed piperidines, e.g. piperocaine containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. pimozide, domperidone
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/10—Spiro-condensed systems
Definitions
- CDK cyclin-dependent kinase
- CDK7 exists as a heterotrimeric complex and is believed to function as a CDK1/2-activating kinase (CAK), whereby phosphorylation of conserved residues in CDK1/2 by CDK7 is required for full catalytic CDK activity and cell cycle progression (Desai et al., “Effects of phosphorylation by CAK on cyclin binding by CDCl 2 and CDK2 .” Mol. Cell Biol. 15, 345-350 (1995); Kaldis et al., “Analysis of CAK activities from human cells.” Eur. J. Biochem.
- CDK7 forms the kinase core of the RNA polymerase (RNAP) II general transcription factor complex and is charged with phosphorylating the C-terminal domain (CTD) of RNAP II, a requisite step in gene transcriptional initiation (Serizawa.
- RNAP RNA polymerase
- CTD C-terminal domain
- RNAP II CTD phosphorylation has been shown to preferentially affect proteins with short half-lives, including those of the anti-apoptotic BCL-2 family (Konig et al., “The novel cyclin-dependent kinase inhibitor flavopiridol downregulates Bc1-2 and induces growth arrest and apoptosis in chronic B-cell leukemia lines.” Blood 1, 4307-4312 (1997); Gojo et al., “The cyclin-dependent kinase inhibitor flavopiridol induces apoptosis in multiple myeloma cells through transcriptional repression and down-regulation of Mc1-1.” Clin. Cancer Res. 8, 3527-3538 (2002)).
- Cancer cells have demonstrated ability to circumvent pro-cell death signaling through up-regulation of BCL-2 family members (Llambi et al., “Apoptosis and oncogenesis: give and take in the BCL-2 family.” Curr. Opin. Genet. Dev. 21, 12-20 (2011)). Therefore, inhibition of human CDK7 kinase activity is likely to result in anti-proliferative activity, and pharmacological inhibition is thought to be useful in treating proliferative disorders, including cancer.
- flavopiridol a non-selective pan-CDK inhibitor that targets CTD kinases
- CLL chronic lymphocytic leukemia
- a selective CDK7 inhibitor may hold promise as a therapeutic agent for the treatment of CLL and other cancers.
- the present invention provides compounds of Formula (I), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof.
- the compounds of Formula (I), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof may inhibit the activity of a kinase.
- the inhibited kinase is a CDK.
- the kinase is CDK7.
- the compound of Formula (I) is selective for CDK7 compared to other kinases (e.g., CDK12 and CDK13).
- the present invention further provides methods of using the inventive compounds, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, to study the inhibition of a kinase (e.g., CDK7) and as therapeutics for the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase (e.g., CDK7).
- a kinase e.g., CDK7
- the inventive compounds are used for the prevention and/or treatment of proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject.
- cancers e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer
- benign neoplasms e.g., diseases associated with angiogenesis,
- the compounds of Formula (I) may selectively inhibit the activity of CDK7 compared to CDK13. Since the discovery of selective inhibitors of CDK7 has been hampered by the high sequence and structural similarities of the kinase domain of CDK family members, the development of selective inhibitors of the transcriptional cyclin-dependent kinases (tCDKs) will allow dissection of their individual contributions to the regulation of transcription and evaluation of their therapeutic potential. Without wishing to be bound by any particular theory, the inventive compounds' selectivity for CDK7 may be due to the compounds' ability to covalently modify the cysteine residue (Cys312) of CDK7. Cys312 of CDK7 is largely unique among the CDKs and other kinases.
- the present invention provides compounds of Formula (I):
- R 1 , R 2 , R 3 , R 4 , R 5 , linker L 1 , linker L 2 , Ring A, and Ring B are as defined herein.
- a compound of Formula (I) is of Formula (II):
- R 1 , R 2 , linker L 2 , Ring A, and Ring B are as defined herein.
- a compound of Formula (I) is of Formula (III):
- R 1 , R 2 , linker L 2 , Ring A, and Ring B are as defined herein.
- a compound of Formula (I) is of Formula (V-a), (V-b), (V-c), or (V-d):
- R 2 , R 1a , R 1N , R 2N , linker L 2 , Ring A, and Ring B are as defined herein.
- a compound of Formula (I) is of Formula (IX-a), (IX-b), (IX-C), or (IX-d):
- the present disclosure provides pharmaceutical compositions including a compound described herein, and optionally a pharmaceutically acceptable excipient.
- the pharmaceutical compositions described herein include a therapeutically or prophylactically effective amount of a compound described herein.
- the pharmaceutical composition may be useful for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell.
- the present invention provides methods for treating and/or preventing a proliferative disease.
- proliferative diseases which may be treated include cancer (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasm, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases.
- cancer e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer
- benign neoplasm diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases
- Another aspect of the invention relates to methods of inhibiting the activity of a kinase (e.g., CDK (e.g., CDK7)) in a biological sample or subject.
- a kinase e.g., CDK (e.g., CDK7)
- the method involves the selective inhibition of CDK7.
- Also provided by the present invention are methods of inhibiting transcription in a biological sample or subject.
- the transcription of genes affected by the activity of CDK7 may be inhibited by the compounds of the invention.
- the present invention also provides methods of inhibiting cell growth in a biological sample or subject.
- the present invention provides methods of inducing apoptosis of a cell in a biological sample or a subject.
- the present invention provides compounds of Formula (I), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, for use in the treatment of a proliferative disease (e.g., cancer) in a subject.
- a proliferative disease e.g., cancer
- kits comprising a container with a compound, or pharmaceutical composition thereof, as described herein.
- the kits described herein may include a single dose or multiple doses of the compound or pharmaceutical composition.
- the kits may be useful in a method of the disclosure.
- the kit further includes instructions for using the compound or pharmaceutical composition.
- a kit described herein may also include information (e.g. prescribing information) as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA).
- FDA U.S. Food and Drug Administration
- the present invention describes methods for administering to the subject an effective amount of a compound, or pharmaceutical composition thereof, as described herein. Also described are methods for a cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein. In certain embodiments, a method described herein further includes administering to the subject an additional pharmaceutical agent. In certain embodiments, a method described herein further includes contacting the cell with an additional pharmaceutical agent. A method described herein may further include performing radiotherapy, immunotherapy, and/or transplantation on the subject.
- the present disclosure provides compounds, and pharmaceutical compositions thereof, as described herein for use in a method of the disclosure.
- FIGS. 1A-1H show the total ion chromatograms (TIC; A,E) and extracted ion chromatograms (XIC; B-D, F-H) for CDK7 peptides recorded during analysis of CAK complexes treated with DMSO (A-D) or Compound 101 (E-H).
- FIG. 1A TIC; DMSO.
- FIG. 1B XIC; DMSO.
- FIG. 1C XIC; DMSO.
- FIG. 1D XIC; DMSO.
- FIG. 1E TIC; compound 101.
- FIG. 1F XIC; compound 101.
- FIG. 1G XIC; compound 101.
- FIG. 1H XIC; compound 101.
- FIG. 2 shows an MS spectrum (m/z 686-690) recorded during analysis of peptides derived from CDK7 treated with Compound 101.
- Signal at m/z 687.7498 corresponds to YFSNRPGPTPGCQLPRPNCPVETLK, with Cys312 labeled with Compound 101.
- Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various isomeric forms, e.g., enantiomers and/or diastereomers.
- the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
- Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses.
- HPLC high pressure liquid chromatography
- C 1-6 is intended to encompass, C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 1-6 , C 1-5 , C 1-4 , C 1-3 , C 1-2 , C 2-6 , C 2-5 , C 2-4 , C 2-3 , C 3-6 , C 3-5 , C 3-4 , C 4-6 , C 4-5 , and C 5-6 .
- aliphatic includes both saturated and unsaturated, straight chain (i.e., unbranched), branched, acyclic, cyclic, or polycyclic aliphatic hydrocarbons, which are optionally substituted with one or more functional groups.
- “aliphatic” is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties.
- alkyl includes straight, branched and cyclic alkyl groups. An analogous convention applies to other generic terms such as “alkenyl”, “alkynyl”, and the like.
- alkyl encompass both substituted and unsubstituted groups.
- lower alkyl is used to indicate those alkyl groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-6 carbon atoms.
- the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-20 aliphatic carbon atoms. In certain other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-10 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-8 aliphatic carbon atoms. In still other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-6 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-4 carbon atoms.
- Illustrative aliphatic groups thus include, but are not limited to, for example, methyl, ethyl, n-propyl, isopropyl, cyclopropyl, —CH 2 -cyclopropyl, vinyl, allyl, n-butyl, sec-butyl, isobutyl, tert-butyl, cyclobutyl, —CH 2 -cyclobutyl, n-pentyl, sec-pentyl, isopentyl, tert-pentyl, cyclopentyl, —CH 2 -cyclopentyl, n-hexyl, sec-hexyl, cyclohexyl, —CH 2 -cyclohexyl moieties and the like, which again, may bear one or more substituents.
- Alkenyl groups include, but are not limited to, for example, ethenyl, propenyl, butenyl, 1-methyl-2-buten-1-yl, and the like.
- Representative alkynyl groups include, but are not limited to, ethynyl, 2-propynyl (propargyl), 1-propynyl, and the like.
- alkyl refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (“C 1-10 alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C 1-9 alkyl”). In some embodiments, an alkyl group has 1 to 8 carbon atoms (“C 1-8 alkyl”). In some embodiments, an alkyl group has 1 to 7 carbon atoms (“C 1-7 alkyl”). In some embodiments, an alkyl group has 1 to 6 carbon atoms (“C 1-6 alkyl”). In some embodiments, an alkyl group has 1 to 5 carbon atoms (“C 1-5 alkyl”).
- an alkyl group has 1 to 4 carbon atoms (“C 1-4 alkyl”). In some embodiments, an alkyl group has 1 to 3 carbon atoms (“C 1-3 alkyl”). In some embodiments, an alkyl group has 1 to 2 carbon atoms (“C 1-2 alkyl”). In some embodiments, an alkyl group has 1 carbon atom (“C 1 alkyl”). In some embodiments, an alkyl group has 2 to 6 carbon atoms (“C 2-6 alkyl”).
- C 1-6 alkyl groups include methyl (C 1 ), ethyl (C 2 ), propyl (C 3 ) (e.g., n-propyl, isopropyl), butyl (C 4 ) (e.g., n-butyl, tert-butyl, sec-butyl, iso-butyl), pentyl (C 5 ) (e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butanyl, tertiary amyl), and hexyl (C 6 ) (e.g., n-hexyl).
- alkyl groups include n-heptyl (C 7 ), n-octyl (C 8 ), and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an “unsubstituted alkyl”) or substituted (a “substituted alkyl”) with one or more substituents (e.g., halogen, such as F).
- the alkyl group is an unsubstituted C 1-10 alkyl (such as unsubstituted C 1-6 alkyl, e.g., —CH 3 ).
- the alkyl group is a substituted C 1-10 alkyl (such as substituted C 1-6 alkyl, e.g., —CF 3 ).
- Alkenyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon double bonds, and no triple bonds (“C 2-20 alkenyl”). In some embodiments, an alkenyl group has 2 to 10 carbon atoms (“C 2-10 alkenyl”). In some embodiments, an alkenyl group has 2 to 9 carbon atoms (“C 2-9 alkenyl”). In some embodiments, an alkenyl group has 2 to 8 carbon atoms (“C 2-8 alkenyl”). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (“C 2-7 alkenyl”).
- an alkenyl group has 2 to 6 carbon atoms (“C 2-6 alkenyl”). In some embodiments, an alkenyl group has 2 to 5 carbon atoms (“C 2-5 alkenyl”). In some embodiments, an alkenyl group has 2 to 4 carbon atoms (“C 2-4 alkenyl”). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (“C 2-3 alkenyl”). In some embodiments, an alkenyl group has 2 carbon atoms (“C 2 alkenyl”). The one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl).
- Examples of C 2-4 alkenyl groups include ethenyl (C 2 ), 1-propenyl (C 3 ), 2-propenyl (C 3 ), 1-butenyl (C 4 ), 2-butenyl (C 4 ), butadienyl (C 4 ), and the like.
- Examples of C 2-6 alkenyl groups include the aforementioned C 2-4 alkenyl groups as well as pentenyl (C 5 ), pentadienyl (C 5 ), hexenyl (C 6 ), and the like. Additional examples of alkenyl include heptenyl (C 7 ), octenyl (C 8 ), octatrienyl (C 8 ), and the like.
- each instance of an alkenyl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted alkenyl”) or substituted (a “substituted alkenyl”) with one or more substituents.
- the alkenyl group is unsubstituted C 2-10 alkenyl.
- the alkenyl group is substituted C 2-10 alkenyl.
- a C ⁇ C double bond for which the stereochemistry is not specified e.g., —CH ⁇ CHCH 3 or
- Alkynyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon triple bonds, and optionally one or more double bonds (“C 2-20 alkynyl”).
- an alkynyl group has 2 to 10 carbon atoms (“C 2-10 alkynyl”).
- an alkynyl group has 2 to 9 carbon atoms (“C 2-9 alkynyl”).
- an alkynyl group has 2 to 8 carbon atoms (“C 2-8 alkynyl”).
- an alkynyl group has 2 to 7 carbon atoms (“C 2-7 alkynyl”).
- an alkynyl group has 2 to 6 carbon atoms (“C 2-6 alkynyl”). In some embodiments, an alkynyl group has 2 to 5 carbon atoms (“C 2-5 alkynyl”). In some embodiments, an alkynyl group has 2 to 4 carbon atoms (“C 2-4 alkynyl”). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (“C 2-3 alkynyl”). In some embodiments, an alkynyl group has 2 carbon atoms (“C 2 alkynyl”). The one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl).
- Examples of C 2-4 alkynyl groups include, without limitation, ethynyl (C 2 ), 1-propynyl (C 3 ), 2-propynyl (C 3 ), 1-butynyl (C 4 ), 2-butynyl (C 4 ), and the like.
- Examples of C 2-6 alkenyl groups include the aforementioned C 2-4 alkynyl groups as well as pentynyl (C 5 ), hexynyl (C 6 ), and the like. Additional examples of alkynyl include heptynyl (C 7 ), octynyl (C 8 ), and the like.
- each instance of an alkynyl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted alkynyl”) or substituted (a “substituted alkynyl”) with one or more substituents.
- the alkynyl group is unsubstituted C 2-10 alkynyl.
- the alkynyl group is substituted C 2-10 alkynyl.
- Carbocyclyl or “carbocyclic” refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms (“C 3-10 carbocyclyl”) and zero heteroatoms in the non-aromatic ring system.
- a carbocyclyl group has 3 to 8 ring carbon atoms (“C 3-8 carbocyclyl”).
- a carbocyclyl group has 3 to 6 ring carbon atoms (“C 3-6 carbocyclyl”).
- a carbocyclyl group has 3 to 6 ring carbon atoms (“C 3-6 carbocyclyl”).
- a carbocyclyl group has 5 to 10 ring carbon atoms (“C 5-10 carbocyclyl”).
- Exemplary C 3-6 carbocyclyl groups include, without limitation, cyclopropyl (C 3 ), cyclopropenyl (C 3 ), cyclobutyl (C 4 ), cyclobutenyl (C 4 ), cyclopentyl (C 5 ), cyclopentenyl (C 5 ), cyclohexyl (C 6 ), cyclohexenyl (C 6 ), cyclohexadienyl (C 6 ), and the like.
- Exemplary C 3-8 carbocyclyl groups include, without limitation, the aforementioned C 3-6 carbocyclyl groups as well as cycloheptyl (C 7 ), cycloheptenyl (C 7 ), cycloheptadienyl (C 7 ), cycloheptatrienyl (C 7 ), cyclooctyl (C 8 ), cyclooctenyl (C 8 ), bicyclo[2.2.1]heptanyl (C 7 ), bicyclo[2.2.2]octanyl (C 8 ), and the like.
- Exemplary C 3-10 carbocyclyl groups include, without limitation, the aforementioned C 3-8 carbocyclyl groups as well as cyclononyl (C 9 ), cyclononenyl (C 9 ), cyclodecyl (C 10 ), cyclodecenyl (C 10 ), octahydro-1H-indenyl (C 9 ), decahydronaphthalenyl (Cm), spiro[4.5]decanyl (Cm), and the like.
- the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or contain a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) and can be saturated or can be partially unsaturated.
- “Carbocyclyl” also includes ring systems wherein the carbocyclic ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclic ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system.
- each instance of a carbocyclyl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted carbocyclyl”) or substituted (a “substituted carbocyclyl”) with one or more substituents.
- the carbocyclyl group is unsubstituted C 3-10 carbocyclyl.
- the carbocyclyl group is substituted C 3-10 carbocyclyl.
- “carbocyclyl” is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms (“C 3-10 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms (“C 3-8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms (“C 3-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (“C 5-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (“C 5-10 cycloalkyl”).
- C 5-6 cycloalkyl groups include cyclopentyl (C 5 ) and cyclohexyl (C 5 ).
- Examples of C 3-6 cycloalkyl groups include the aforementioned C 5-6 cycloalkyl groups as well as cyclopropyl (C 3 ) and cyclobutyl (C 4 ).
- Examples of C 3-8 cycloalkyl groups include the aforementioned C 3-6 cycloalkyl groups as well as cycloheptyl (C 7 ) and cyclooctyl (C 8 ).
- each instance of a cycloalkyl group is independently unsubstituted (an “unsubstituted cycloalkyl”) or substituted (a “substituted cycloalkyl”) with one or more substituents.
- the cycloalkyl group is unsubstituted C 3-10 cycloalkyl.
- the cycloalkyl group is substituted C 3-10 cycloalkyl.
- Heterocyclyl or “heterocyclic” refers to a radical of a 3- to 10-membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon (“3-10 membered heterocyclyl”).
- the point of attachment can be a carbon or nitrogen atom, as valency permits.
- a heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or a fused, bridged, or spiro ring system, such as a bicyclic system (“bicyclic heterocyclyl”), and can be saturated or can be partially unsaturated.
- Heterocyclyl bicyclic ring systems can include one or more heteroatoms in one or both rings.
- Heterocyclyl also includes ring systems wherein the heterocyclic ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclic ring, or ring systems wherein the heterocyclic ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclic ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclic ring system.
- each instance of heterocyclyl is independently optionally substituted, i.e., unsubstituted (an “unsubstituted heterocyclyl”) or substituted (a “substituted heterocyclyl”) with one or more substituents.
- the heterocyclyl group is unsubstituted 3-10 membered heterocyclyl. In certain embodiments, the heterocyclyl group is substituted 3-10 membered heterocyclyl.
- a heterocyclyl group is a 5-10 membered, non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon (“5-10 membered heterocyclyl”).
- a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-8 membered heterocyclyl”).
- a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-6 membered heterocyclyl”).
- the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heterocyclyl has one ring heteroatom selected from nitrogen, oxygen, and sulfur.
- Exemplary 3-membered heterocyclyl groups containing one heteroatom include, without limitation, azirdinyl, oxiranyl, thiiranyl.
- Exemplary 4-membered heterocyclyl groups containing one heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl.
- Exemplary 5-membered heterocyclyl groups containing one heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione.
- Exemplary 5-membered heterocyclyl groups containing two heteroatoms include, without limitation, dioxolanyl, oxasulfuranyl, disulfuranyl, and oxazolidin-2-one.
- Exemplary 5-membered heterocyclyl groups containing three heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl.
- Exemplary 6-membered heterocyclyl groups containing one heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl.
- Exemplary 6-membered heterocyclyl groups containing two heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing two heteroatoms include, without limitation, triazinanyl. Exemplary 7-membered heterocyclyl groups containing one heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing one heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl.
- Exemplary 5-membered heterocyclyl groups fused to a C 6 aryl ring include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, benzoxazolinonyl, and the like.
- Exemplary 6-membered heterocyclyl groups fused to an aryl ring include, without limitation, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and the like.
- Aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 pi electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system (“C 6-14 aryl”).
- an aryl group has six ring carbon atoms (“C 6 aryl”; e.g., phenyl).
- an aryl group has ten ring carbon atoms (“C 10 aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl).
- an aryl group has fourteen ring carbon atoms (“C 14 aryl”; e.g., anthracyl).
- Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups, wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system.
- each instance of an aryl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted aryl”) or substituted (a “substituted aryl”) with one or more substituents.
- the aryl group is unsubstituted C 6-14 aryl.
- the aryl group is substituted C 6-14 aryl.
- “Aralkyl” refers to an optionally substituted alkyl group substituted by an optionally substituted aryl group. In certain embodiments, the aralkyl is optionally substituted benzyl. In certain embodiments, the aralkyl is benzyl. In certain embodiments, the aralkyl is optionally substituted phenethyl. In certain embodiments, the aralkyl is phenethyl.
- Heteroaryl refers to a radical of a 5-10 membered, monocyclic or bicyclic 4n+2 aromatic ring system (e.g., having 6 or 10 pi electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-10 membered heteroaryl”).
- heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits.
- Heteroaryl bicyclic ring systems can include one or more heteroatoms in one or both rings.
- Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. “Heteroaryl” also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused (aryl/heteroaryl) ring system.
- Bicyclic heteroaryl groups wherein one ring does not contain a heteroatom e.g., indolyl, quinolinyl, carbazolyl, and the like
- the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
- a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-10 membered heteroaryl”).
- a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-8 membered heteroaryl”).
- a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-6 membered heteroaryl”).
- the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
- the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
- each instance of a heteroaryl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted heteroaryl”) or substituted (a “substituted heteroaryl”) with one or more substituents.
- the heteroaryl group is unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is substituted 5-14 membered heteroaryl.
- Exemplary 5-membered heteroaryl groups containing one heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl.
- Exemplary 5-membered heteroaryl groups containing two heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl.
- Exemplary 5-membered heteroaryl groups containing three heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
- Exemplary 5-membered heteroaryl groups containing four heteroatoms include, without limitation, tetrazolyl.
- Exemplary 6-membered heteroaryl groups containing one heteroatom include, without limitation, pyridinyl.
- Exemplary 6-membered heteroaryl groups containing two heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl.
- Exemplary 6-membered heteroaryl groups containing three or four heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively.
- Exemplary 7-membered heteroaryl groups containing one heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl.
- Exemplary 5,6-bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl.
- Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
- Heteroaralkyl is a subset of alkyl and heteroaryl and refers to an optionally substituted alkyl group substituted by an optionally substituted heteroaryl group.
- “Unsaturated” or “partially unsaturated” refers to a group that includes at least one double or triple bond.
- a “partially unsaturated” ring system is further intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl groups).
- “saturated” refers to a group that does not contain a double or triple bond, i.e., contains all single bonds.
- Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups, which are divalent linking groups, are further referred to using the suffix -ene, e.g., alkylene, alkenylene, alkynylene, carbocyclylene, heterocyclylene, arylene, and heteroarylene.
- An atom, moiety, or group described herein may be unsubstituted or substituted, as valency permits, unless otherwise provided expressly.
- the term “optionally substituted” refers to substituted or unsubstituted.
- alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted (e.g., “substituted” or “unsubstituted” alkyl, “substituted” or “unsubstituted” alkenyl, “substituted” or “unsubstituted” alkynyl, “substituted” or “unsubstituted” carbocyclyl, “substituted” or “unsubstituted” heterocyclyl, “substituted” or “unsubstituted” aryl or “substituted” or “unsubstituted” heteroaryl group).
- substituted means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction.
- a “substituted” group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
- substituted is contemplated to include substitution with all permissible substituents of organic compounds, any of the substituents described herein that results in the formation of a stable compound.
- the present disclosure contemplates any and all such combinations in order to arrive at a stable compound.
- heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety.
- the substituent is a carbon atom substituent.
- the substituent is a nitrogen atom substituent.
- the substituent is an oxygen atom substituent.
- the substituent is a sulfur atom substituent.
- Exemplary carbon atom substituents include, but are not limited to, halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR aa , —ON(R bb ) 2 , N(R bb ) 2 , —N(R bb ) 3 + X ⁇ , —N(OR cc )R bb , —SH, —SR aa , —SSR cc , —C( ⁇ O)R aa , —CO 2 H, —CHO, —C(OR cc ) 2 , —CO 2 R aa , —OC( ⁇ O)R aa , —OCO 2 R aa , —C( ⁇ O)N(R bb ) 2 , —OC( ⁇ O)N(R bb ) 2 , —NR bb C( ⁇
- each instance of R aa is, independently, selected from C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, or two R aa groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R dd groups;
- each instance of R bb is, independently, selected from hydrogen, —OH, —OR aa , —N(R cc ) 2 , —CN, —C( ⁇ O)R aa , —C( ⁇ O)N(R cc ) 2 , —CO 2 R aa , —SO 2 R aa , —C( ⁇ NR cc )OR aa , —C( ⁇ NR cc )N(R cc ) 2 , —SO 2 N(R cc ) 2 , —SO 2 R cc , —SO 2 OR cc , —SOR aa , —C( ⁇ S)N(R cc ) 2 , —C( ⁇ O)SR cc , —C( ⁇ S)SR cc , —P( ⁇ O)(R aa ) 2 , —P( ⁇ O)(OR cc ) 2
- each instance of R cc is, independently, selected from hydrogen, C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, or two R cc groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R dd groups;
- each instance of R dd is, independently, selected from halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR ee , —ON(R ff ) 2 , —N(R ff ) 2 , —N(R ff ) 3 + X ⁇ , —N(OR ee )R ff , —SH, —SR ee , —SSR ee , —C( ⁇ O)R ee , —CO 2 H, —CO 2 R ee , —OC( ⁇ O)R ee , —OCO 2 R ee , —C( ⁇ O)N(R ff ) 2 , —OC( ⁇ O)N(R ff ) 2 , —NR ff C( ⁇ O)R ee , —NR ff CO 2 R
- each instance of R ee is, independently, selected from C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-10 carbocyclyl, C 6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups;
- each instance of R ff is, independently, selected from hydrogen, C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-10 carbocyclyl, 3-10 membered heterocyclyl, C 6-10 aryl and 5-10 membered heteroaryl, or two R ff groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups; and
- each instance of R gg is, independently, halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OC 1-6 alkyl, —ON(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 3 + X ⁇ , —NH(C 1-6 alkyl) 2 + X ⁇ , —NH 2 (C 1-6 alkyl) + X ⁇ , —NH 3 + X ⁇ , —N(OC 1-6 alkyl)(C 1-6 alkyl), —N(OH)(C 1-6 alkyl), —NH(OH), —SH, —SC 1-6 alkyl, —SS(C 1-6 alkyl), —C( ⁇ O)(C 1-6 alkyl), —CO 2 H, —CO 2 (C 1-6 alkyl), —OC( ⁇ O)
- a “counterion” or “anionic counterion” is a negatively charged group associated with a cationic quaternary amino group in order to maintain electronic neutrality.
- An anionic counterion may be monovalent (i.e., including one formal negative charge).
- An anionic counterion may also be multivalent (i.e., including more than one formal negative charge), such as divalent or trivalent.
- Exemplary counterions include halide ions (e.g., F ⁇ , Cl ⁇ , Br ⁇ , I ⁇ ), NO 3 ⁇ , ClO 4 ⁇ , OH ⁇ , H 2 PO 4 ⁇ , HCO 3 ⁇ , HSO 4 ⁇ , sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate, ethan-1-sulfonic acid-2-sulfonate, and the like), carboxylate ions (e.g., acetate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, gluconate, and the like), BF 4
- Exemplary counterions which may be multivalent include CO 3 2 ⁇ , HPO 4 2 ⁇ , PO 4 3 ⁇ , B 4 O 7 2 ⁇ , SO 4 2 ⁇ , S 2 O 3 2 ⁇ , carboxylate anions (e.g., tartrate, citrate, fumarate, maleate, malate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like), and carboranes.
- carboxylate anions e.g., tartrate, citrate, fumarate, maleate, malate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like
- carboranes e.g., tartrate, citrate, fumarate, maleate, mal
- Halo or “halogen” refers to fluorine (fluoro, —F), chlorine (chloro, —Cl), bromine (bromo, —Br), or iodine (iodo, —I).
- “Acyl” refers to a moiety selected from the group consisting of —C( ⁇ O)R aa , —CHO, —CO 2 R aa , —C( ⁇ O)N(R bb ) 2 , —C( ⁇ NR bb )R aa , —C( ⁇ NR bb )OR aa , —C( ⁇ NR bb )N(R bb ) 2 , —C( ⁇ O)NR bb SO 2 R aa , —C( ⁇ S)N(R bb ) 2 , —C( ⁇ O)SR aa , or —C( ⁇ S)SR aa , wherein R aa and R bb are as defined herein.
- Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quaternary nitrogen atoms.
- Exemplary nitrogen atom substituents include, but are not limited to, hydrogen, —OH, —OR aa , —N(R cc ) 2 , —CN, —C( ⁇ O)R aa , —C( ⁇ O)N(R cc ) 2 , —CO 2 R aa , —SO 2 R aa , —C( ⁇ NR bb )R aa , —C( ⁇ NR cc )OR aa , —C( ⁇ NR cc )N(R cc ) 2 , —SO 2 N(R cc ) 2 , —SO 2 R cc , —SO 2 OR cc , —SOR aa , —C( ⁇ S)N(R
- the substituent present on a nitrogen atom is a nitrogen protecting group (also referred to as an amino protecting group).
- Nitrogen protecting groups include, but are not limited to, —OH, —OR aa , —N(R cc ) 2 , —C( ⁇ O)R aa , —C( ⁇ O)N(R cc ) 2 , —CO 2 R aa , —SO 2 R aa , —C( ⁇ NR cc )R aa , —C( ⁇ NR cc )OR aa , —C( ⁇ NR cc )N(R cc ) 2 , —SO 2 N(R cc ) 2 , —SO 2 R cc , —SO 2 OR cc , —SOR aa , —C( ⁇ S)N(R cc ) 2 , —C( ⁇ O)SR cc , —C(C(
- Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis , T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
- nitrogen protecting groups such as amide groups (e.g., —C( ⁇ O)R aa ) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, p-phenylbenzamide, o-nitrophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N′ dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o-nitrocinnamide
- Nitrogen protecting groups such as carbamate groups include, but are not limited to, methyl carbamate, ethyl carbamate, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluorenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-(1-adamantyl)-1-methylethyl carbamate
- Nitrogen protecting groups such as sulfonamide groups include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide
- Ts p-toluenesulfonamide
- nitrogen protecting groups include, but are not limited to, phenothiazinyl-(10)-acyl derivative, N′-p-toluenesulfonylaminoacyl derivative, N′-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4
- oxygen atom substituents include, but are not limited to, —R aa , —C( ⁇ O)SR aa , —C( ⁇ O)R aa , —CO 2 R aa , —C( ⁇ O)N(R bb ) 2 , —C( ⁇ NR bb )R aa , —C( ⁇ NR bb )OR aa , —C( ⁇ NR bb )N(R bb ) 2 , —S( ⁇ O)R aa , —SO 2 R aa , —Si(R aa ) 3 , —P(R cc ) 2 , —P(R cc ) 3 + X ⁇ , —P(OR cc ) 2 , —P(OR cc ) 3 + X ⁇ , —P(OR cc ) 2 , —P(OR cc )
- the oxygen atom substituent present on an oxygen atom is an oxygen protecting group (also referred to as a hydroxyl protecting group).
- Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis , T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
- oxygen protecting groups include, but are not limited to, methyl, t-butyloxycarbonyl (BOC or Boc), methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2-methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4-me
- Exemplary sulfur atom substituents include, but are not limited to, —R aa , —C( ⁇ O)SR aa , —C( ⁇ O)R aa , —CO 2 R aa , —C( ⁇ O)N(R bb ) 2 , —C( ⁇ NR bb )R aa , —C( ⁇ NR bb )OR aa , —C( ⁇ NR bb )N(R bb ) 2 , —S( ⁇ O)R aa , —SO 2 R aa , —Si(R aa ) 3 , —P(R cc ) 2 , —P(R cc ) 3 + X ⁇ , —P(OR cc ) 2 , —P(OR cc ) 3 + X ⁇ , —P(OR cc ) 2 , —P(OR cc
- the sulfur atom substituent present on a sulfur atom is a sulfur protecting group (also referred to as a thiol protecting group).
- Sulfur protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis , T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
- a “hydrocarbon chain” refers to a substituted or unsubstituted divalent alkyl, alkenyl, or alkynyl group.
- a hydrocarbon chain includes (1) one or more chains of carbon atoms immediately between the two radicals of the hydrocarbon chain; (2) optionally one or more hydrogen atoms on the chain(s) of carbon atoms; and (3) optionally one or more substituents (“non-chain substituents,” which are not hydrogen) on the chain(s) of carbon atoms.
- a chain of carbon atoms consists of consecutively connected carbon atoms (“chain atoms” or “carbon units”) and does not include hydrogen atoms or heteroatoms.
- a non-chain substituent of a hydrocarbon chain may include any atoms, including hydrogen atoms, carbon atoms, and heteroatoms.
- hydrocarbon chain —C A H(C B H 2 C C H 3 )— includes one chain atom C A , one hydrogen atom on C A , and non-chain substituent —(C B H 2 C C H 3 ).
- C x hydrocarbon chain wherein x is a positive integer, refers to a hydrocarbon chain that includes x number of chain atom(s) between the two radicals of the hydrocarbon chain. If there is more than one possible value of x, the smallest possible value of x is used for the definition of the hydrocarbon chain.
- —CH(C 2 H 5 )— is a C 1 hydrocarbon chain
- a C 3-10 hydrocarbon chain refers to a hydrocarbon chain where the number of chain atoms of the shortest chain of carbon atoms immediately between the two radicals of the hydrocarbon chain is 3, 4, 5, 6, 7, 8, 9, or 10.
- a hydrocarbon chain may be saturated (e.g., —(CH 2 ) 4 —).
- a hydrocarbon chain may also be unsaturated and include one or more C ⁇ C and/or C ⁇ C bonds anywhere in the hydrocarbon chain.
- —CH ⁇ CH—(CH 2 ) 2 —, —CH 2 —C ⁇ C—CH 2 —, and —C ⁇ C—CH ⁇ CH— are all examples of a unsubstituted and unsaturated hydrocarbon chain.
- the hydrocarbon chain is unsubstituted (e.g., —C ⁇ C— or —(CH 2 ) 4 —).
- the hydrocarbon chain is substituted (e.g., —CH(C 2 H 5 )— and —CF 2 —). Any two substituents on the hydrocarbon chain may be joined to form an optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl ring.
- any two substituents on the hydrocarbon chain may be joined to form an optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl ring.
- leaving group is given its ordinary meaning in the art of synthetic organic chemistry and refers to an atom or a group capable of being displaced by a nucleophile. See, for example, Smith, March Advanced Organic Chemistry 6th ed. (501-502).
- Suitable leaving groups include, but are not limited to, halogen (such as F, Cl, Br, or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,O-dimethylhydroxylamino, pixyl, and haloformates.
- halogen such as F, Cl, Br, or I (iodine
- Exemplary leaving groups include, but are not limited to, activated substituted hydroxyl groups (e.g., —OC( ⁇ O)SR aa , —OC( ⁇ O)R aa , —OCO 2 R aa , —OC( ⁇ O)N(R bb ) 2 , —OC( ⁇ NR bb )R aa , —OC( ⁇ NR bb )OR aa , —OC( ⁇ NR bb )N(R bb ) 2 , —OS( ⁇ O)R aa , —OSO 2 R aa , —OP(R cc ) 2 , —OP(R cc ) 3 , —OP( ⁇ O) 2 R aa , —OP( ⁇ O)(R aa ) 2 , —OP( ⁇ O)(OR cc ) 2 , —OP( ⁇ O) 2 N(R bb ) 2 ,
- the leaving group is a sulfonic acid ester, such as toluenesulfonate (tosylate, —OTs), methanesulfonate (mesylate, —OMs), p-bromobenzenesulfonyloxy (brosylate, —OBs), —OS( ⁇ O) 2 (CF 2 ) 3 CF 3 (nonaflate, —ONf), or trifluoromethanesulfonate (triflate, —OTf).
- the leaving group is a brosylate, such as p-bromobenzenesulfonyloxy.
- the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy.
- the leaving group may also be a phosphineoxide (e.g., formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate.
- phosphineoxide e.g., formed during a Mitsunobu reaction
- an internal leaving group such as an epoxide or cyclic sulfate.
- Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc halides, magnesium moieties, diazonium salts, and copper moieties.
- pharmaceutically acceptable salt refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable salts are well known in the art. For example, Berge et al. describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, incorporated herein by reference.
- Pharmaceutically acceptable salts of the compounds described herein include those derived from suitable inorganic and organic acids and bases.
- Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods known in the art such as ion exchange.
- inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid
- organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods known in the art such as ion exchange.
- salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate,
- Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N + (C 1-4 alkyl) 4 ⁇ salts.
- Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
- Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
- solvate refers to forms of the compound that are associated with a solvent, usually by a solvolysis reaction. This physical association may include hydrogen bonding.
- Conventional solvents include water, methanol, ethanol, acetic acid, DMSO, THF, diethyl ether, and the like.
- the compounds described herein may be prepared, e.g., in crystalline form, and may be solvated.
- Suitable solvates include pharmaceutically acceptable solvates and further include both stoichiometric solvates and non-stoichiometric solvates. In certain instances, the solvate will be capable of isolation, for example, when one or more solvent molecules are incorporated in the crystal lattice of a crystalline solid.
- “Solvate” encompasses both solution-phase and isolatable solvates. Representative solvates include hydrates, ethanolates, and methanolates.
- hydrate refers to a compound that is associated with water.
- the number of the water molecules contained in a hydrate of a compound is in a definite ratio to the number of the compound molecules in the hydrate. Therefore, a hydrate of a compound may be represented, for example, by the general formula R.x H 2 O, wherein R is the compound, and x is a number greater than 0.
- a given compound may form more than one type of hydrate, including, e.g., monohydrates (x is 1), lower hydrates (x is a number greater than 0 and smaller than 1, e.g., hemihydrates (R.0.5 H 2 O)), and polyhydrates (x is a number greater than 1, e.g., dihydrates (R.2 H 2 O) and hexahydrates (R.6 H 2 O)).
- monohydrates x is 1
- lower hydrates x is a number greater than 0 and smaller than 1, e.g., hemihydrates (R.0.5 H 2 O)
- polyhydrates x is a number greater than 1, e.g., dihydrates (R.2 H 2 O) and hexahydrates (R.6 H 2 O)
- tautomers or “tautomeric” refers to two or more interconvertible compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa).
- the exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base.
- Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
- stereoisomers that are not mirror images of one another are termed “diastereomers” and those that are non-superimposable mirror images of each other are termed “enantiomers”.
- enantiomers When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible.
- An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or ( ⁇ )-isomers respectively).
- a chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a “racemic mixture”.
- polymorphs refers to a crystalline form of a compound (or a salt, hydrate, or solvate thereof) in a particular crystal packing arrangement. All polymorphs have the same elemental composition. Different crystalline forms usually have different X-ray diffraction patterns, infrared spectra, melting points, density, hardness, crystal shape, optical and electrical properties, stability, and solubility. Recrystallization solvent, rate of crystallization, storage temperature, and other factors may cause one crystal form to dominate. Various polymorphs of a compound can be prepared by crystallization under different conditions.
- co-crystal refers to a crystalline structure composed of at least two components.
- a co-crystal may contain a compound of the present invention and one or more other component, including but not limited to, atoms, ions, molecules, or solvent molecules.
- a co-crystal may contain a compound of the present invention and one or more components related to said compound, including not limited to, an isomer, tautomer, salt, solvate, hydrate, synthetic precursor, synthetic derivative, fragment or impurity of said compound.
- isotopically labeled derivative or “isotopically labeled” refers to a compound wherein one or more atoms in the compound (or in an associated ion or molecule of a salt, hydrate, or solvate) has been replaced with an isotope of the same element.
- the isotope will be enriched, or present in a higher percentage of all atoms of the element or of all atoms at the position in the molecule in a sample, relative to an unlabeled variant.
- the enriched isotope will be a stable isotope.
- the enriched isotope will be an unstable or radioactive isotope (e.g., a radionuclide).
- the enriched isotope may be detected by a measurement technique, including but not limited to nuclear magnetic resonance, mass spectrometry, infrared spectroscopy, or a technique that measures radioactive decay.
- prodrugs refers to compounds that have cleavable groups and become by solvolysis or under physiological conditions the compounds described herein, which are pharmaceutically active in vivo. Such examples include, but are not limited to, choline ester derivatives and the like, N-alkylmorpholine esters and the like. Other derivatives of the compounds described herein have activity in both their acid and acid derivative forms, but in the acid sensitive form often offer advantages of solubility, tissue compatibility, or delayed release in the mammalian organism (see, Bundgard, H., Design of Prodrugs , pp. 7-9, 21-24, Elsevier, Amsterdam 1985).
- Prodrugs include acid derivatives well known to practitioners of the art, such as, for example, esters prepared by reaction of the parent acid with a suitable alcohol, or amides prepared by reaction of the parent acid compound with a substituted or unsubstituted amine, or acid anhydrides, or mixed anhydrides. Simple aliphatic or aromatic esters, amides, and anhydrides derived from acidic groups pendant on the compounds described herein are particular prodrugs. In some cases it is desirable to prepare double ester type prodrugs such as (acyloxy)alkyl esters or ((alkoxycarbonyl)oxy)alkylesters.
- C 1 -C 8 alkyl, C 2 -C 8 alkenyl, C 2 -C 8 alkynyl, aryl, C 7 -C 12 substituted aryl, and C 7 -C 12 arylalkyl esters of the compounds described herein may be preferred.
- inhibitor refers to the ability of a compound to reduce, slow, halt or prevent activity of a particular biological process (e.g., activity of a bromodomain and/or a bromodomain-containing protein) in a cell relative to vehicle.
- a particular biological process e.g., activity of a bromodomain and/or a bromodomain-containing protein
- a compound, pharmaceutical composition, method, use, or kit When a compound, pharmaceutical composition, method, use, or kit is referred to as “selectively,” “specifically,” or “competitively” binding a first protein or a first chromatin, the compound, pharmaceutical composition, method, use, or kit binds the first protein or the first chromatin with a higher binding affinity (e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold) than binding a second protein or second chromatin that is different from the first protein and the first chromatin.
- a higher binding affinity e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold
- a compound, pharmaceutical composition, method, use, or kit When a compound, pharmaceutical composition, method, use, or kit is referred to as “selectively,” “specifically,” or “competitively” modulating (e.g., increasing or inhibiting) the activity of a bromodomain-containing protein, the compound, pharmaceutical composition, method, use, or kit modulates the activity of the bromodomain-containing protein to a greater extent (e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold) than the activity of at least one protein that is different from the bromodomain-containing protein.
- a greater extent e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold
- abnormal activity refers to activity deviating from normal activity, that is, abnormal activity.
- increased activity refers to activity higher than normal activity.
- composition and “formulation” are used interchangeably.
- a “subject” to which administration is contemplated refers to a human (i.e., male or female of any age group, e.g., pediatric subject (e.g., infant, child, or adolescent) or adult subject (e.g., young adult, middle-aged adult, or senior adult)) or non-human animal.
- the non-human animal is a mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey), commercially relevant mammal (e.g., cattle, pig, horse, sheep, goat, cat, or dog), or bird (e.g., commercially relevant bird, such as chicken, duck, goose, or turkey)).
- primate e.g., cynomolgus monkey or rhesus monkey
- commercially relevant mammal e.g., cattle, pig, horse, sheep, goat, cat, or dog
- bird e.g., commercially relevant bird, such as
- the non-human animal is a fish, reptile, or amphibian.
- the non-human animal may be a male or female at any stage of development.
- the non-human animal may be a transgenic animal or genetically engineered animal.
- a “patient” refers to a human subject in need of treatment of a disease.
- the subject may also be a plant.
- the plant is a land plant.
- the plant is a non-vascular land plant.
- the plant is a vascular land plant.
- the plant is a seed plant.
- the plant is a cultivated plant.
- the plant is a dicot.
- the plant is a monocot.
- the plant is a flowering plant.
- the plant is a cereal plant, e.g., maize, corn, wheat, rice, oat, barley, rye, or millet.
- the plant is a legume, e.g., a bean plant, e.g., soybean plant.
- the plant is a tree or shrub.
- tissue sample refers to any sample including tissue samples (such as tissue sections and needle biopsies of a tissue); cell samples (e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection); samples of whole organisms (such as samples of yeasts or bacteria); or cell fractions, fragments or organelles (such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise).
- tissue samples such as tissue sections and needle biopsies of a tissue
- cell samples e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection) or samples of cells obtained by microdissection
- samples of whole organisms such as samples of yeasts or bacteria
- cell fractions, fragments or organelles such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise.
- biological samples include blood, serum, urine, semen, fecal matter, cerebrospinal fluid, interstitial fluid, mucous, tears, sweat, pus, biopsied tissue (e.g., obtained by a surgical biopsy or needle biopsy), nipple aspirates, milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from another biological sample.
- biopsied tissue e.g., obtained by a surgical biopsy or needle biopsy
- nipple aspirates milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from another biological sample.
- administer refers to implanting, absorbing, ingesting, injecting, inhaling, or otherwise introducing a compound described herein, or a composition thereof, into, in, or on a subject.
- treatment refers to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease described herein.
- treatment may be administered after one or more signs or symptoms of the disease have developed or have been observed.
- treatment may be administered in the absence of signs or symptoms of the disease.
- treatment may be administered to a susceptible subject prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of exposure to a pathogen). Treatment may also be continued after symptoms have resolved, for example, to delay or prevent recurrence.
- an “effective amount” of a compound described herein refers to an amount sufficient to elicit the desired biological response, i.e., treating the condition.
- the effective amount of a compound described herein may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the condition being treated, the mode of administration, and the age and health of the subject.
- an effective amount is a therapeutically effective amount.
- an effective amount is a prophylactic treatment.
- an effective amount is the amount of a compound described herein in a single dose.
- an effective amount is the combined amounts of a compound described herein in multiple doses.
- a “therapeutically effective amount” of a compound described herein is an amount sufficient to provide a therapeutic benefit in the treatment of a condition or to delay or minimize one or more symptoms associated with the condition.
- a therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment of the condition.
- the term “therapeutically effective amount” can encompass an amount that improves overall therapy, reduces or avoids symptoms, signs, or causes of the condition, and/or enhances the therapeutic efficacy of another therapeutic agent.
- a “prophylactically effective amount” of a compound described herein is an amount sufficient to prevent a condition, or one or more symptoms associated with the condition or prevent its recurrence.
- a prophylactically effective amount of a compound means an amount of a therapeutic agent, alone or in combination with other agents, which provides a prophylactic benefit in the prevention of the condition.
- the term “prophylactically effective amount” can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
- proliferative disease refers to a disease that occurs due to abnormal growth or extension by the multiplication of cells (Walker, Cambridge Dictionary of Biology ; Cambridge University Press: Cambridge, UK, 1990).
- a proliferative disease may be associated with: 1) the pathological proliferation of normally quiescent cells; 2) the pathological migration of cells from their normal location (e.g., metastasis of neoplastic cells); 3) the pathological expression of proteolytic enzymes such as the matrix metalloproteinases (e.g., collagenases, gelatinases, and elastases); or 4) the pathological angiogenesis as in proliferative retinopathy and tumor metastasis.
- Exemplary proliferative diseases include cancers (i.e., “malignant neoplasms”), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, and autoimmune diseases.
- angiogenesis refers to the physiological process through which new blood vessels form from pre-existing vessels.
- Angiogenesis is distinct from vasculogenesis, which is the de novo formation of endothelial cells from mesoderm cell precursors. The first vessels in a developing embryo form through vasculogenesis, after which angiogenesis is responsible for most blood vessel growth during normal or abnormal development.
- Angiogenesis is a vital process in growth and development, as well as in wound healing and in the formation of granulation tissue.
- angiogenesis is also a fundamental step in the transition of tumors from a benign state to a malignant one, leading to the use of angiogenesis inhibitors in the treatment of cancer.
- Angiogenesis may be chemically stimulated by angiogenic proteins, such as growth factors (e.g., VEGF).
- angiogenic proteins such as growth factors (e.g., VEGF).
- VEGF growth factors
- “Pathological angiogenesis” refers to abnormal (e.g., excessive or insufficient) angiogenesis that amounts to and/or is associated with a disease.
- neoplasm and “tumor” are used herein interchangeably and refer to an abnormal mass of tissue wherein the growth of the mass surpasses and is not coordinated as in the growth of normal tissue.
- a neoplasm or tumor may be “benign” or “malignant,” depending on the following characteristics: degree of cellular differentiation (including morphology and functionality), rate of growth, local invasion, and metastasis.
- a “benign neoplasm” is generally well differentiated, has characteristically slower growth than a malignant neoplasm, and remains localized to the site of origin.
- a benign neoplasm does not have the capacity to infiltrate, invade, or metastasize to distant sites.
- Exemplary benign neoplasms include, but are not limited to, lipoma, chondroma, adenomas, acrochordon, senile angiomas, seborrheic keratoses, lentigos, and sebaceous hyperplasias.
- certain “benign” tumors may later give rise to malignant neoplasms, which may result from additional genetic changes in a subpopulation of the tumor's neoplastic cells, and these tumors are referred to as “pre-malignant neoplasms.”
- An exemplary pre-malignant neoplasm is a teratoma.
- a “malignant neoplasm” is generally poorly differentiated (anaplasia) and has characteristically rapid growth accompanied by progressive infiltration, invasion, and destruction of the surrounding tissue. Furthermore, a malignant neoplasm generally has the capacity to metastasize to distant sites.
- the term “metastasis,” “metastatic,” or “metastasize” refers to the spread or migration of cancerous cells from a primary or original tumor to another organ or tissue and is typically identifiable by the presence of a “secondary tumor” or “secondary cell mass” of the tissue type of the primary or original tumor and not of that of the organ or tissue in which the secondary (metastatic) tumor is located.
- a prostate cancer that has migrated to bone is said to be metastasized prostate cancer and includes cancerous prostate cancer cells growing in bone tissue.
- cancer refers to a class of diseases characterized by the development of abnormal cells that proliferate uncontrollably and have the ability to infiltrate and destroy normal body tissues. See, e.g., Stedman's Medical Dictionary, 25th ed.; Hensyl ed.; Williams & Wilkins: Philadelphia, 1990.
- Exemplary cancers include, but are not limited to, hematological malignancies.
- Additional exemplary cancers include, but are not limited to, acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer; benign monoclonal gammopathy; biliary cancer (e.g., cholangiocarcinoma); bladder cancer; breast cancer (e.g., adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast, triple negative breast cancer (TNBC)); brain cancer (e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma, oligodendroglioma), medulloblastoma); bronchus cancer; carcinoid tumor; cervical cancer (e.g., cervical adeno
- liver cancer e.g., hepatocellular cancer (HCC), malignant hepatoma
- lung cancer e.g., bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung
- leiomyosarcoma LMS
- mastocytosis e.g., systemic mastocytosis
- muscle cancer myelodysplastic syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD) (e.g., polycythemia vera (PV), essential thrombocytosis (ET), agnogenic myeloid metaplasia (AMM) a.k.a.
- myelofibrosis MF
- chronic idiopathic myelofibrosis chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)
- neuroblastoma e.g., neurofibromatosis (NF) type 1 or type 2, schwannomatosis
- neuroendocrine cancer e.g., gastroenteropancreatic neuroendocrine tumor (GEP-NET), carcinoid tumor
- osteosarcoma e.g., bone cancer
- ovarian cancer e.g., cystadenocarcinoma, ovarian embryonal carcinoma, ovarian adenocarcinoma
- papillary adenocarcinoma pancreatic cancer
- pancreatic cancer e.g., pancreatic andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors
- penile cancer
- hematological malignancy refers to tumors that affect blood, bone marrow, and/or lymph nodes.
- exemplary hematological malignancies include, but are not limited to, leukemia, such as acute lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic myelocytic leukemia (CML) (e.g., B-cell CML, T-cell CML), and chronic lymphocytic leukemia (CLL) (e.g., B-cell CLL, T-cell CLL)); lymphoma, such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL, such as diffuse large cell lymphoma (DLCL) (e.g
- inflammatory disease refers to a disease caused by, resulting from, or resulting in inflammation.
- inflammatory disease may also refer to a dysregulated inflammatory reaction that causes an exaggerated response by macrophages, granulocytes, and/or T-lymphocytes leading to abnormal tissue damage and/or cell death.
- An inflammatory disease can be either an acute or chronic inflammatory condition and can result from infections or non-infectious causes.
- Inflammatory diseases include, without limitation, atherosclerosis, arteriosclerosis, autoimmune disorders, multiple sclerosis, systemic lupus erythematosus, polymyalgia rheumatica (PMR), gouty arthritis, degenerative arthritis, tendonitis, bursitis, psoriasis, cystic fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory arthritis, Sjogren's syndrome, giant cell arteritis, progressive systemic sclerosis (scleroderma), ankylosing spondylitis, polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes (e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Goodpasture's disease, mixed connective tissue disease, sclerosing cholangitis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, per
- autoimmune disease refers to a disease arising from an inappropriate immune response of the body of a subject against substances and tissues normally present in the body. In other words, the immune system mistakes some part of the body as a pathogen and attacks its own cells. This may be restricted to certain organs (e.g., in autoimmune thyroiditis) or involve a particular tissue in different places (e.g., Goodpasture's disease which may affect the basement membrane in both the lung and kidney).
- the treatment of autoimmune diseases is typically with immunosuppression, e.g., medications which decrease the immune response.
- Exemplary autoimmune diseases include, but are not limited to, glomerulonephritis, Goodpasture's syndrome, necrotizing vasculitis, lymphadenitis, peri-arteritis nodosa, systemic lupus erythematosis, rheumatoid arthritis, psoriatic arthritis, systemic lupus erythematosis, psoriasis, ulcerative colitis, systemic sclerosis, dermatomyositis/polymyositis, anti-phospholipid antibody syndrome, scleroderma, pemphigus vulgaris, ANCA-associated vasculitis (e.g., Wegener's granulomatosis, microscopic polyangiitis), uveitis, Sjogren's syndrome, Crohn's disease, Reiter's syndrome, ankylosing spondylitis, Lyme disease, Guillain-Barré syndrome, Hashimoto's thyroiditis, and cardio
- kinase is a type of enzyme that transfers phosphate groups from high energy donor molecules, such as ATP, to specific substrates, referred to as phosphorylation.
- Kinases are part of the larger family of phosphotransferases.
- One of the largest groups of kinases are protein kinases, which act on and modify the activity of specific proteins.
- Kinases are used extensively to transmit signals and control complex processes in cells.
- Various other kinases act on small molecules such as lipids, carbohydrates, amino acids, and nucleotides, either for signaling or to prime them for metabolic pathways.
- Kinases are often named after their substrates. More than 500 different protein kinases have been identified in humans.
- Exemplary human protein kinases include, but are not limited to, AAK1, ABL, ACK, ACTR2, ACTR2B, AKT1, AKT2, AKT3, ALK, ALK1, ALK2, ALK4, ALK7, AMPKa1, AMPKa2, ANKRD3, ANPa, ANPb, ARAF, ARAFps, ARG, AurA, AurAps1, AurAps2, AurB, AurBpsl, AurC, AXL, BARK1, BARK2, BIKE, BLK, BMPR1A, BMPR1Aps1, BMPR1Aps2, BMPR1B, BMPR2, BMX, BRAF, BRAFps, BRK, BRSK1, BRSK2, BTK, BUB1, BUBR1, CaMKla, CaMK1b, CaMK1d, CaMK1g, CaMK2a, CaMK2b, CaMK2d, CaMK2g,
- SRC family kinase refers to a family of non-receptor tyrosine protein kinases that includes nine members: SRCA subfamily that includes c-SRC (proto-oncogene tyrosine-protein kinase SRC), YES (proto-oncogene tyrosine-protein kinase Yes), FYN (proto-oncogene tyrosine-protein kinase FYN), and FGR (Gardner-Rasheed feline sarcoma viral (v-FGR) oncogene homolog); SRCB subfamily that includes LCK (lymphocyte-specific protein tyrosine kinase), HCK (tyrosine-protein kinase HCK, hemopoietic cell kinase), BLK (tyrosine-protein kinase BLK), and LYN (tyrosine-protein kinase LYN); and FRK (F
- CDK refers to a cyclin-dependent kinase.
- a CDK binds a cyclin (e.g., Cyclin H), which is a regulatory protein.
- CDKs phosphorylate their substrates at serines and threonines.
- the consensus sequence for the phosphorylation site in the amino acid sequence of a CDK substrate is [S/T*]PX[K/R], where S/T* is the phosphorylated serine or threonine, P is proline, X is any amino acid, K is lysine, and R is arginine.
- CDKs include CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK11, CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19 and CDK20.
- CDK7 cyclin-dependent kinase 7, is a CDK, wherein the substrate is Cyclin H, MAT1 (e.g., MNAT1), or Cyclin H and MAT1.
- CDK7 is alternatively referred to as CAK1, HCAK, MO15, STK1, CDKN7, and p39MO15.
- Non-limiting examples of the nucleotide and protein sequences for human CDK7 are described in GenBank Accession Number NP_001790, incorporated herein by reference. The amino acid sequence of this CDK7 is as follows:
- Cyclin dependent kinases are key regulators of the cell cycle. Their successive activation and inactivation drives the cycle forward. The activity of CDKs is regulated by multiple mechanisms such as positive and negative phosphorylation, binding of regulatory proteins like cyclins, and CDK inhibitors. Cyclin-dependent kinase 7 (CDK7) plays a critical role in the regulation of RNA polymerase II-mediated transcription of protein-encoding genes. Disruption of CDK7 signaling causes defects in transcription; however, a complete understanding of how CDK7 disruption affects global transcription is lacking. Furthermore, the absence of selective inhibitors of CDK7 has hindered investigation of the transcriptional and functional consequences of acute and long-term inhibition of CDK7 under normal and pathological conditions.
- the present invention describes a cellular screen and conventional proteomics target discovery approach that resulted in the identification of highly selective CDK7 inhibitors and analogs, which have the ability to covalently modify a cysteine residue located outside of the canonical kinase domain (i.e., Cys312 of CDK7).
- This cysteine is exclusively found in CDK7 and provides an unanticipated means of overcoming the daunting challenge of achieving selectivity amongst the 19 CDKs reported to date.
- Irreversible inhibition of CDK7 using an inhibitor of the present invention results in the prolonged disruption of transcription and the induction of apoptosis of a diverse subset of cancer cell lines.
- Genome-wide transcript analysis following inhibitor treatment delineates CDK7-responsive genes as important in the maintenance of the cancer cell state, in particular MYC and MCL-1 genes. Selective covalent inhibition of CDK7 may be a viable cancer therapeutic strategy.
- the present invention provides compounds, which inhibit the activity of a kinase, for the prevention and/or treatment of a subject with a proliferative disease.
- the inventive compounds inhibit the activity of cyclin-dependent kinase (CDK).
- the inventive compounds inhibit the activity of a cyclin-dependent kinase 7 (CDK7).
- the present invention also provides methods of using the compounds described herein, e.g., as biological probes to study the inhibition of the activity of a kinase (e.g., CDK (e.g., CDK7)), and as therapeutics, e.g., in the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase (e.g., CDK (e.g., CDK7)).
- the diseases are proliferative diseases.
- the proliferative diseases that may be treated and/or prevented include, but are not limited to, cancers (e.g., leukemia, melanoma, multiple myeloma), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases.
- cancers e.g., leukemia, melanoma, multiple myeloma
- benign neoplasms e.g., benign neoplasms
- diseases associated with angiogenesis e.g., inflammatory diseases, autoinflammatory diseases, and autoimmune diseases.
- compounds of the present invention are selective for CDK7 relative to other CDKs.
- the present invention addresses potential deficiencies of some previous CDK7 inhibitors which also have the ability to inhibit CDK12 or CDK13 (Kwiatowski et al., “Targeting transcription regulation in cancer with a covalent CDK7 inhibitor.” Nature 511, 616-620 (2014)). This affords the opportunity to more clearly differentiate pharmacological effects that are derived from CDK7 inhibition relative to CDK12 and/or CDK13 inhibition and provides new compounds, and compositions thereof, for drug development and therapeutic use.
- a compound described herein is pyrrolo-pyrazole containing compounds that may be useful in treating and/or preventing proliferative diseases in a subject, inhibiting the activity of a protein kinase (e.g., CDK) in a subject or biological sample, and inducing apoptosis of a cell.
- a compound described herein is a compound of Formula (I), or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof.
- a compound described herein is a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- a compound described herein is of Formula (I):
- R 1 attached to the carbonyl substituent of the pyrrolopyrazole bicyclic ring.
- R 1 may be —NR a R b , —CHR a R b or —OR a , wherein each of R a and R b is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, or an oxygen protecting group when attached to an oxygen atom, or R a and R b are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- R 1 is —NR a R b .
- R 1 is —CHR a R b .
- R 1 is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- R 2′ is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protecting group, and each ring atom is optionally substituted.
- R 1 is
- R 1 is of Formula (ii-1):
- R 1 is of Formula (ii-2):
- R b is hydrogen. In certain embodiments, R b is optionally substituted C 1 -C 6 alkyl. In certain embodiments, R b is unsubstituted C 1 -C 6 alkyl. In certain embodiments, R b is a nitrogen protecting group. In certain embodiments, R b is Bn, BOC, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts.
- R 1a is hydrogen. In certain embodiments, R 1a is methyl. In certain embodiments, R 1a is ethyl. In certain embodiments, R 1a is propyl. In certain embodiments, R 1a is optionally substituted phenyl. In certain embodiments, R 1a is phenyl.
- R 2a is hydrogen. In certain embodiments, R 2a is —OR 1N , wherein R 1N is hydrogen, C 1 -C 6 alkyl, or an oxygen protecting group. In certain embodiments, R 2a is —OH. In certain embodiments, R 2a is —NR 1N R 2N , wherein each of R 1N and R 2N is independently hydrogen, C 1 -C 6 alkyl, or a nitrogen protecting group. In certain embodiments, R 1N and R 2N are the same. In certain embodiments, R 1N and R 2N are distinct. In certain embodiments, R 1N and R 2N are both methyl. In certain embodiments, R 1N and R 2N are both ethyl.
- R 1N and R 2N are both propyl. In certain embodiments, R 1N and R 2N are both hydrogen. In certain embodiments, R 1N and R 2N are both nitrogen protecting groups. In certain embodiments, at least one of R 1N and R 2N is methyl. In certain embodiments, at least one of R 1N and R 2N is ethyl. In certain embodiments, at least one of R 1N and R 2N is propyl. In certain embodiments, at least one of R 1N and R 2N is hydrogen. In certain embodiments, at least one of R 1N and R 2N is a nitrogen protecting group. In certain embodiments, R 1N is methyl, and R 2N is hydrogen.
- R 1N is ethyl, and R 2N is hydrogen. In certain embodiments, R 1N is propyl, and R 2N is hydrogen. In certain embodiments, R 1N is a nitrogen protecting group, and R 2N is hydrogen. In certain embodiments, R 1N is methyl, and R 2N is a nitrogen protecting group. In certain embodiments, R 1 is ethyl, and R 2N is a nitrogen protecting group. In certain embodiments, R 1N is propyl, and R 2N is a nitrogen protecting group.
- R 1 is of Formula (ii-1a):
- R 1 is of Formula (ii-2a):
- R 1a is hydrogen. In certain embodiments, R 1a is methyl. In certain embodiments, R 1a is ethyl. In certain embodiments, R 1a is propyl. In certain embodiments, R 1a is optionally substituted phenyl. In certain embodiments, R 1a is phenyl. In certain embodiments, R 1N and R 2N are the same.
- R 1N and R 2N are distinct. In certain embodiments, R 1N and R 2N are both methyl. In certain embodiments, R 1N and R 2N are both ethyl. In certain embodiments, R 1N and R 2N are both propyl. In certain embodiments, RN and R 2N are both hydrogen. In certain embodiments, R 1N and R 2N are both nitrogen protecting groups. In certain embodiments, at least one of RN and R 2N is methyl. In certain embodiments, at least one of R 1N and R 2N is ethyl. In certain embodiments, at least one of RN and R 2N is propyl. In certain embodiments, at least one of RN and R 2N is hydrogen.
- RN and R 2N is a nitrogen protecting group.
- RN is methyl, and R 2N is hydrogen.
- R 1N is ethyl, and R 2N is hydrogen.
- R 1N is propyl, and R 2N is hydrogen.
- R 1N is a nitrogen protecting group, and R 2N is hydrogen.
- R 1N is methyl, and R 2N is a nitrogen protecting group.
- R 1N is ethyl, and R 2N is a nitrogen protecting group.
- R 1N is propyl, and R 2N is a nitrogen protecting group.
- R 1 is of Formula (ii-1b):
- R 1a is hydrogen, C 1 -C 6 alkyl, or optionally substituted aryl.
- R 1 is of Formula (ii-2b):
- R 1a is hydrogen, C 1 -C 6 alkyl, or optionally substituted aryl.
- R 1a is hydrogen. In certain embodiments, R 1a is methyl. In certain embodiments, R 1a is ethyl. In certain embodiments, R 1a is propyl. In certain embodiments, R 1a is optionally substituted phenyl. In certain embodiments, R 1a is phenyl.
- R 1 is:
- R 1 is:
- R 1 is:
- R 1 is:
- R 1 is of Formula (ii-1c):
- R 1 is of Formula (ii-2c):
- R 1a is hydrogen. In certain embodiments, R 1a is methyl. In certain embodiments, R 1a is ethyl. In certain embodiments, R 1a is propyl. In certain embodiments, R 1a is optionally substituted phenyl. In certain embodiments, R 1a is phenyl. In certain embodiments, R 1N is hydrogen. In certain embodiments, R 1N is methyl. In certain embodiments, R 1N is ethyl. In certain embodiments, R 1N is propyl. In certain embodiments, R 1N is an oxygen protecting group.
- R 1 is of Formula (ii-1d):
- R 1a is hydrogen, C 1 -C 6 alkyl, or optionally substituted aryl.
- R 1 is of Formula (ii-2d):
- R 1a is hydrogen, C 1 -C 6 alkyl, or optionally substituted aryl.
- R 1a is hydrogen. In certain embodiments, R 1a is methyl. In certain embodiments, R 1a is ethyl. In certain embodiments, R 1a is propyl. In certain embodiments, R 1a is optionally substituted phenyl. In certain embodiments, R 1a is phenyl.
- R 1 is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- R 1 is —NR a R b , wherein R a is optionally substituted aryl, and R b is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group.
- R 1 is —NR a R b , wherein R a is optionally substituted heteroaryl, and R b is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group.
- R 1 is —NR a R b , wherein R a is optionally substituted heterocyclyl, and R b is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group.
- R 1 is —NR a R b , wherein R a is optionally substituted carbocyclyl, and R b is selected from hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group.
- R 1 is —NR a R b , wherein R a is optionally substituted aryl, and R b is hydrogen.
- R 1 is —NR a R b , wherein R a is optionally substituted heteroaryl, and R b is hydrogen.
- R 1 is —NR a R b , wherein R a is optionally substituted heterocyclyl, and R b is hydrogen. In certain embodiments, R 1 is —NR a R b , wherein R a is optionally substituted carbocyclyl, and R b is hydrogen. In certain embodiments, R 1 is —NR a R b , wherein R a is optionally substituted pyrazolyl, and R b is hydrogen. In certain embodiments, R 1 is —NR a R b , wherein R a is 1-methyl-1H-pyrazol-4-yl, and R b is hydrogen. In certain embodiments, R 1 is
- Linker L 1 joining the pyrrolopyrazole bicyclic ring and Ring A.
- Linker L 1 may be —NR L —, —NR L C( ⁇ O)—, —C( ⁇ O)NR L —, —O—, or —S—, wherein R L1 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protecting group.
- L 1 is —NR L1 —, wherein R L1 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protecting group.
- L 1 is —NR L C( ⁇ O)—, wherein R L1 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protecting group.
- L 1 is —C( ⁇ O)NR L —, wherein R L1 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protecting group.
- R L1 is hydrogen.
- L 1 is —NH—.
- L 1 is —NH(C ⁇ O)—.
- L 1 is —(C ⁇ O)NH—.
- L 1 is —O—.
- L 1 is —S—.
- Compounds of Formula (I) include R 3 and R 4 attached to the pyrrolopyrazole bicyclic ring.
- Each of R 3 and R 4 is independently hydrogen, halogen, optionally substituted aryl, or optionally substituted C 1 -C 6 alkyl, or R 3 and R 4 are joined to form an optionally substituted C 3 -C 6 carbocyclyl ring.
- R 3 is a substituted or unsubstituted aryl (e.g., substituted or unsubstituted phenyl).
- R 4 is a substituted or unsubstituted aryl (e.g., substituted or unsubstituted phenyl).
- R 3 and R 4 are joined to form an optionally substituted C 3 -C 6 carbocyclyl. In certain embodiments, R 3 and R 4 are joined to form an optionally substituted cyclopropane. In certain embodiments, R 3 and R 4 are joined to form an unsubstituted cyclopropane. In certain embodiments, R 3 and R 4 are joined to form an optionally substituted cyclohexane. In certain embodiments, R 3 and R 4 are joined to form an unsubstituted cyclohexane. In certain embodiments, R 3 and R 4 are the same. In certain embodiments, R 3 and R 4 are distinct.
- R 3 and R 4 are optionally substituted C 1 -C 6 alkyl. In certain embodiments, R 3 and R 4 are unsubstituted C 1 -C 6 alkyl. In certain embodiments, R 3 and R 4 are both methyl. In certain embodiments, R 3 and R 4 are both ethyl. In certain embodiments, R 3 and R 4 are both propyl. In certain embodiments, R 3 and R 4 are both hydrogen. In certain embodiments, R 3 and R 4 are both halogen. In certain embodiments, each of R 3 and R 4 is independently —Cl, —Br, or —I. In certain embodiments, R 3 and R 4 are both —F. In certain embodiments, R 3 and R 4 are joined as —CH 2 CH 2 —.
- R 3 is optionally substituted C 1 -C 6 alkyl (e.g., isopropyl). In certain embodiments, R 3 is unsubstituted C 1 -C 6 alkyl. In certain embodiments, R 3 is methyl. In certain embodiments, R 3 is ethyl. In certain embodiments, R 3 is propyl. In certain embodiments, R 3 is hydrogen. In certain embodiments, R 3 is halogen. In certain embodiment, R 3 is —Cl, —Br, or —I. In certain embodiment, R 3 is —F. In certain embodiments, R 4 is optionally substituted C 1 -C 6 alkyl (e.g., isopropyl).
- R 4 is unsubstituted C 1 -C 6 alkyl. In certain embodiments, R 4 is methyl. In certain embodiments, R 4 is ethyl. In certain embodiments, R 4 is propyl. In certain embodiments, R 4 is hydrogen. In certain embodiments, R 4 is halogen. In certain embodiment, R 4 is —Cl, —Br, or —I. In certain embodiment, R 4 is —F.
- R 3 is hydrogen, and R 4 is methyl. In certain embodiments, R 3 is methyl, and R 4 is hydrogen. In certain embodiments, R 3 is hydrogen, and R 4 is ethyl. In certain embodiments, R 3 is ethyl, and R 4 is hydrogen. In certain embodiments, R 3 is hydrogen, and R 4 is propyl. In certain embodiments, R 3 is propyl, and R 4 is hydrogen. In certain embodiments, R 3 is hydrogen, and R 4 is —Cl, —Br, or —I. In certain embodiments, R 3 is —Cl, Br, or —I, and R 4 is hydrogen. In certain embodiments, R 3 is hydrogen, and R 4 is —F.
- R 3 is —F, and R 4 is hydrogen. In certain embodiments, R 3 is methyl, and R 4 is —F. In certain embodiments, R 3 is —F, and R 4 is methyl. In certain embodiments, R 3 is ethyl, and R 4 is —F. In certain embodiments, R 3 is —F, and R 4 is ethyl. In certain embodiments, R 3 is propyl, and R 4 is —F. In certain embodiments, R 3 is —F, and R 4 is propyl. In certain embodiments, R 3 is methyl, and R 4 is —Cl, —Br, or —I.
- R 3 is —Cl, —Br, or —I, and R 4 is methyl. In certain embodiments, R 3 is ethyl, and R 4 is —Cl, —Br, or —I. In certain embodiments, R 3 is —Cl, —Br, or —I, and R 4 is ethyl. In certain embodiments, R 3 is propyl, and R 4 is —Cl, —Br, or —I. In certain embodiments, R 3 is —Cl, —Br, or —I, and R 4 is propyl.
- R 5 attached to a pyrazole nitrogen.
- R 5 may be hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protecting group.
- R 5 is optionally substituted C 1 -C 6 alkyl.
- R 5 is unsubstituted C 1 -C 6 alkyl.
- R 5 is substituted methyl.
- R 5 is unsubstituted methyl.
- R 5 is hydrogen.
- R 5 is a nitrogen protecting group.
- R 5 is Bn, BOC, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts.
- R 5 is attached to different pyrazole nitrogens in compounds of each formula.
- R 5 is attached to the nitrogen at the position labeled 1, as in Formula (I-a).
- R 5 is attached to the nitrogen at the position labeled 2, as in Formula (I-b).
- compounds of Formula (I) may exist as a mixture of compounds of Formulae (I-a) and (I-b), in which case R 5 is attached to the nitrogen at the position labeled 1 for components of the mixture corresponding to Formula (I-a), and R 5 is the nitrogen at the position labeled 2 for components of the mixture corresponding to Formula (I-b).
- Ring A between linker L 1 and linker L 2 .
- Ring A may be optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl.
- Ring A is optionally substituted carbocyclyl.
- Ring A is optionally substituted heterocyclyl.
- Ring A is optionally substituted aryl.
- Ring A is optionally substituted heteroaryl.
- Ring A is optionally substituted phenyl.
- Ring A is phenyl substituted with only L 1 and L 2 .
- Ring A is optionally substituted cyclohexyl.
- Ring A is optionally substituted piperidinyl. In certain embodiments, Ring A is optionally substituted piperizinyl. In certain embodiments, Ring A is optionally substituted pyridinyl. In certain embodiments, Ring A is optionally substituted pyrimidinyl.
- linkers L 1 and L 2 are attached “ortho” or 1,2 to Ring A. In certain embodiments, linkers L 1 and L 2 are attached “meta” or 1,3 to Ring A. In certain embodiments, linkers L 1 and L 2 are attached “para” or 1,4 to ring A.
- Ring A is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring A is
- Ring A is
- Ring A is
- Ring A is
- Ring A is
- Ring A is
- each ring atom is optionally substituted, and L 1 and L 2 may attach to ring A at either indicated position.
- Ring A is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring A is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring A is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring A is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- L 1 and L 2 may attach to ring A at either indicated position.
- Ring A is
- Ring A is
- Ring A is
- L 1 and L 2 may attach to ring A at either indicated position.
- Linker L 2 may be a bond, —C( ⁇ O)—, —NR L2 —, —C( ⁇ O)NR L2 —, —NR L2 C( ⁇ O)—, —O—, or —S— wherein R L2 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protection group.
- L 2 is a bond, such that Ring B or R 2 is directly attached to Ring A.
- L 2 is —NR L2 —, wherein R L2 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protection group.
- L 2 is —C( ⁇ O)NR L2 —, wherein R L2 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protection group.
- L 2 is —NR L2 C( ⁇ O)—, wherein R L2 is hydrogen, optionally substituted C 1 -C 6 alkyl, or a nitrogen protection group.
- L 2 is —O—.
- L 2 is —S—.
- R L2 is hydrogen.
- L 2 is —C( ⁇ O)—.
- L 2 is —NH—.
- L 2 is —NHC( ⁇ O)—.
- L 2 is —C( ⁇ O)NH—.
- L 2 is —O—.
- L 2 is —S—.
- Compounds of Formula (I) include Ring B between linker L 2 and group R 2 .
- linker L 2 is a bond, such that Ring B is directly attached to Ring A.
- Ring B may absent, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl.
- Ring B is absent, such that L 2 is directly attached to R 2 .
- Ring B is absent and linker L 2 is a bond, such that Ring A is directly attached to R 2 .
- Ring B is optionally substituted carbocyclyl.
- Ring B is optionally substituted heterocyclyl.
- Ring B is optionally substituted aryl.
- Ring B is optionally substituted heteroaryl. In certain embodiments, Ring B is optionally substituted phenyl. In certain embodiments, Ring B is optionally substituted cyclohexyl. In certain embodiments, Ring B is optionally substituted piperidinyl. In certain embodiments, Ring B is optionally substituted piperizinyl. In certain embodiments, Ring B is optionally substituted pyridinyl. In certain embodiments, Ring B is optionally substituted pyrimidinyl.
- linker L 2 and group R 2 are attached “ortho” or 1,2 to each other on Ring B. In certain embodiments, linkers L 2 and group R 2 are attached “meta” or 1,2 to each other on Ring B. In certain embodiments, linkers L 2 and R 2 are attached “para” or 1,4 to each other on Ring B.
- Ring B is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring B is
- Ring B is
- Ring B is
- Ring B is
- Ring B is
- Ring B is
- each ring atom is optionally substituted, and L 2 and R 2 may attach to Ring B at either indicated position.
- Ring B is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring B is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring B is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring B is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- Ring B is
- Ring B is
- Ring B is
- L 2 and R 2 may attach to Ring B at either indicated position.
- Compounds of Formula (I) include R 2 attached to Ring B.
- Ring B is absent, such that R 2 is directly attached to linker L 2 .
- Ring B is absent and L 2 is a bond, such that R 2 is directly attached to Ring A.
- R 2 comprises an electrophilic moiety.
- R 2 comprises a Michael acceptor moiety.
- the electrophilic moiety e.g., Michael acceptor moiety
- CDK e.g., CDK7
- the electrophilic moiety may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)). In certain embodiments, the electrophilic moiety (e.g., Michael acceptor moiety) may react with the Cys312 residue of CDK7.
- the covalent attachment is irreversible. In certain embodiments, the covalent attachment is reversible.
- R 2 may be any one of Formulae (i-1)-(i-42). In certain embodiments, R 2 is of Formula (i-1):
- R 2 is of Formula (i-2):
- R 2 is of Formula (i-3):
- R 2 is of Formula (i-4):
- R 2 is of Formula (i-5):
- R 2 is of Formula (i-6)
- R 2 is of Formula (i-7):
- R 2 is of Formula (i-8):
- R 2 is of Formula (i-9):
- R 2 is of Formula (i-10):
- R 2 is of Formula (i-11):
- R 2 is of Formula (i-12):
- R 2 is of Formula (i-13):
- R 2 is of Formula (i-14):
- R 2 is of Formula (i-15):
- R 2 is of Formula (i-16):
- R 2 is of Formula (i-17):
- R 2 is of Formula (i-18):
- R 2 is of Formula (i-19):
- R 2 is of Formula (i-20):
- R 2 is of Formula (i-21):
- R 2 is of Formula (i-22):
- R 2 is of Formula (i-23):
- R 2 is of Formula (i-24):
- R 2 is of Formula (i-25):
- R 2 is of Formula (i-26):
- R 2 is of Formula (i-27):
- R 2 is of Formula (i-28):
- R 2 is of Formula (i-29):
- R 2 is of Formula (i-30):
- R 2 is of Formula (i-31):
- R 2 is of Formula (i-32):
- R 2 is of Formula (i-33):
- R 2 is of Formula (i-34):
- R 2 is of Formula (i-35):
- R 2 is of Formula (i-36):
- R 2 is of Formula (i-37):
- R 2 is of Formula (i-38):
- R 2 is of Formula (i-39):
- R 2 is of Formula (i-40):
- R 2 is of Formula (i-41):
- R 2 is of Formula (i-42):
- R 2 is of Formula (i-1a):
- R 2 is of Formula (i-1b):
- R 2 is of Formula (i-1c):
- R 2 is of Formula (i-1d):
- R 2 is of Formula (i-1e):
- R 2 is of Formula (i-1f):
- R 2 is of Formula (i-1g):
- R 2 is of Formula (i-1g):
- R 2 is
- R 2 is
- R 2 is
- R 2 is
- R 2 is of Formula (i-1a):
- R 2 is of Formula (i-1b):
- R 2 is of Formula (i-1c):
- R 2 is
- R 2 is of Formula (i-18a):
- R 2 is of Formula (i-18c):
- R 2 is of Formula (i-15a):
- R 2 is of Formula (i-15b):
- R 2 is of Formula (i-15c):
- R 2 may contain linker L 3 or L 4 .
- L 3 is a bond.
- L 3 is an optionally substituted C 1-4 hydrocarbon chain.
- L 3 is optionally substituted ethyl.
- L 3 is optionally substituted alkenyl.
- L 3 is an optionally substituted C 1-4 hydrocarbon chain, wherein one or more carbon units of the hydrocarbon chain are independently replaced with —C( ⁇ O)—, —O—, —S—, —NR L3a —, —NR L3a C( ⁇ O)—, —C( ⁇ O)NR L3a —, —SC( ⁇ O)—, —C( ⁇ O)S—, —OC( ⁇ O)—, —C( ⁇ O)O—, —NR L3a C( ⁇ S)—, —C( ⁇ S)NR L3a , trans-CR L3b ⁇ CR L3b —, cis-CR L3b ⁇ CR L3b —, —C ⁇ C—, —S( ⁇ O)—, —S( ⁇ O)O—, —OS( ⁇ O)—, —S( ⁇ O)NR L3a —, —NR L3a S( ⁇ O)—, —S( ⁇ O)—,
- L 3 is an optionally substituted C 1-4 hydrocarbon chain, wherein one carbon unit of the hydrocarbon chain is replaced with —NR L3a — (e.g., —NH—).
- L 3 is of the formula: —(CH 2 ) 1-4 —NR L3a — (e.g., —(CH 2 ) 1-4 —NH—) or —NR L3a —CH 2 ) 1-4 — (e.g., —NH—CH 2 ) 1-4 —).
- L 3 is —NR L3a —.
- L 3 is —NR L3a (C ⁇ O)—.
- L 3 is —(C ⁇ O)NR L3a —. In certain embodiments, L 3 is —NH—. In certain embodiments, L 3 is —(C ⁇ O)—. In certain embodiments, L 3 is —NH(C ⁇ O)—. In certain embodiments, L 3 is —(C ⁇ O)NH—. In certain embodiments, L 3 is —O—. In certain embodiments, L 3 is —S—. In certain embodiments, L 4 is a bond. In certain embodiments, L 4 is an optionally substituted C 1-4 hydrocarbon chain.
- Linker L 3 may contain groups R L3a or R L3b .
- R L3a is hydrogen.
- at least one instance of R L3b is hydrogen.
- each instance of R L3b is hydrogen.
- at least one instance of R L3b is —Cl, —Br, or —I.
- each instance of R L3b is —Cl, —Br, or —I.
- at least one instance of R L3b is —F.
- each instance of R L3b is —F.
- R L3b is optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl.
- two R L3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring.
- R 2 may contain groups R E1 , R E2 , and/or R E3 .
- R E1 is hydrogen.
- R E2 is hydrogen.
- R E3 is hydrogen.
- R E is —Cl, —Br, or —I.
- R E2 is —Cl, —Br, or —I.
- R E3 is —Cl, —Br, or —I.
- R E1 is —F.
- R E2 is —F.
- R E3 is —F.
- R E1 is optionally substituted alkyl (e.g., substituted or unsubstituted C 1-6 alkyl).
- R E2 is optionally substituted alkyl (e.g., substituted or unsubstituted C 1-6 alkyl).
- R E3 is optionally substituted alkyl (e.g., substituted or unsubstituted C 1-6 alkyl).
- R E1 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH 2 OR EE , —CH 2 N(R EE ) 2 , —CH 2 SR EE , —OR EE , —N(R EE ) 2 , —Si(R EE ) 3 , or —SR EE .
- R E2 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH 2 OR EE , —CH 2 N(R EE ) 2 , —CH 2 SR EE , —OR EE , —N(R EE ) 2 , —Si(R EE ) 3 , or —SR EE
- R E3 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH 2 OR EE , —CH 2 N(R EE ) 2 , —CH 2 SR EE , —OR EE , —N(R EE ) 2
- R E1 is —N(R EE ) 2 . In certain embodiments, R E2 is —N(R EE ) 2 . In certain embodiments, R E3 is —N(R EE ) 2 . In certain embodiments, R E1 is —N(CH 3 ) 2 . In certain embodiments, R E2 is —N(CH 3 ) 2 . In certain embodiments, R E3 is —N(CH 3 ) 2 . In certain embodiments, R E1 is —CH 2 N(R EE ) 2 . In certain embodiments, R E2 is —CH 2 N(R EE ) 2 . In certain embodiments, R E3 is —CH 2 N(R EE ) 2 .
- R E1 is —CH 2 N(CH 3 ) 2 . In certain embodiments, R E2 is —CH 2 N(CH 3 ) 2 . In certain embodiments, R E3 is —CH 2 N(CH 3 ) 2 . In certain embodiments, R E1 is —CN. In certain embodiments, R E2 is —CN. In certain embodiments, R E3 is —CN.
- R E1 and R E3 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, R E1 and R E3 are joined to form an optionally substituted heterocyclic ring. In certain embodiments, R E2 and R E3 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, R E2 and R E3 are joined to form an optionally substituted heterocyclic ring. In certain embodiments, R E1 and R E2 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, R E1 and R E2 are joined to form an optionally substituted heterocyclic ring.
- R 2 may contain group RE, where R E4 is a leaving group.
- R E4 is —Cl, —Br, or —I.
- R E4 is —F.
- R E4 is —OS( ⁇ O)R E4a or —OS( ⁇ O) 2 R E4a , wherein R E4a is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
- R E4 is —OR E4a .
- R E4 is —OMs, —OTf, —OTs, —OBs, or 2-nitrobenzenesulfonyloxy.
- R E4 is —OR E4a .
- R E4 is —OMe, —OCF 3 , or —OPh.
- R E4 is —OC( ⁇ O)R E4a .
- R E4 is —OC( ⁇ O)Me, —OC( ⁇ O)CF 3 , —OC( ⁇ O)Ph, or —OC( ⁇ O)Cl.
- R E4 is —OC( ⁇ O)OR E4a .
- R E4 is —OC( ⁇ O)OMe or —OC( ⁇ O)O(t-Bu).
- R 2 may contain group R E5 , where R E5 is a halogen.
- R E5 is —Cl, —Br, or —I.
- R E5 is —F.
- R 2 may contain group R E6 .
- R E6 is hydrogen.
- R E6 is substituted or unsubstituted C 1 -C 6 alkyl.
- R E6 is a nitrogen protecting group.
- a is 1. In certain embodiments, a is 2.
- z is 0. In certain embodiments, z is 1. In certain embodiments, z is 2. In certain embodiments, z is 3, 4, 5, or 6.
- R 2 may contain group Y.
- Y is O.
- Y is S.
- Y is NR E7 .
- Y is NH.
- a compound described herein is of Formula (II):
- R 1 , R 2 , linker L 2 , Ring A, and Ring B are as defined for Formula (I).
- a compound of Formula (I) is of Formula (III):
- R 1 , R 2 , linker L 2 , Ring A, and Ring B are as defined for Formula (I).
- a compound of Formula (I) is of Formula (IV-a):
- R 1 , R 2 , linker L 1 , linker L 2 , and Ring B are as defined for Formula (I).
- a compound of Formula (I) is of Formula (IV-b):
- R 1 , R 2 , linker L 1 , linker L 2 , and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IV-c):
- R 1 , R 2 , linker L 1 , linker L 2 , and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IV-d):
- R 1 , R 2 , linker L 1 , linker L 2 , and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IV-e):
- R 1 , R 2 , linker L 1 , linker L 2 , and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IV-f):
- R 1 , R 2 , linker Lt, linker L 2 , and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (V-a):
- a compound Formula (I) is of Formula (V-b):
- a compound Formula (I) is of Formula (V-c):
- a compound Formula (I) is of Formula (V-d):
- a compound Formula (I) is of Formula (VI-a):
- a compound Formula (I) is of Formula (VI-b):
- a compound Formula (I) is of Formula (VI-c):
- a compound Formula (I) is of Formula (VI-d):
- a compound Formula (I) is of Formula (VI-e):
- a compound Formula (I) is of Formula (VI-f):
- a compound Formula (I) is of Formula (VI-g):
- a compound Formula (I) is of Formula (VI-h):
- a compound Formula (I) is of Formula (VI-i):
- a compound Formula (I) is of Formula (VI-j):
- a compound Formula (I) is of Formula (VI-k):
- a compound Formula (I) is of Formula (VI-1):
- a compound Formula (I) is of Formula (VII-a):
- a compound Formula (I) is of Formula (VII-b):
- a compound Formula (I) is of Formula (VII-c):
- a compound Formula (I) is of Formula (VII-d):
- a compound Formula (I) is of Formula (VIII-a):
- R 2 , linker L, linker L 2 , and Ring B are as defined for Formula (I); and R 1a is hydrogen, C 1 -C 6 alkyl, or optionally substituted aryl.
- a compound Formula (I) is of Formula (VIII-b):
- a compound Formula (I) is of Formula (VIII-c):
- a compound Formula (I) is of Formula (VIII-d):
- a compound Formula (I) is of Formula (VIII-e):
- a compound Formula (I) is of Formula (VIII-f):
- a compound Formula (I) is of Formula (VIII-g):
- a compound Formula (I) is of Formula (VIII-h):
- a compound Formula (I) is of Formula (VIII-i):
- a compound Formula (I) is of Formula (VIII-j):
- a compound Formula (I) is of Formula (VIII-k):
- a compound Formula (I) is of Formula (VIII-1):
- a compound Formula (I) is of Formula (IX-a):
- R 1 , linker L 2 , Ring A, and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IX-b):
- R 1 , linker L 2 , Ring A, and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IX-c):
- R 1 , linker L 2 , Ring A, and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (IX-d):
- R 1 , linker L 2 , Ring A, and Ring B are as defined for Formula (I).
- a compound Formula (I) is of Formula (X-a):
- a compound Formula (I) is of Formula (X-b):
- a compound Formula (I) is of Formula (X-c):
- a compound Formula (I) is of Formula (X-d):
- a compound Formula (I) is of Formula (XI-a):
- a compound Formula (I) is of Formula (XI-b):
- a compound Formula (I) is of Formula (XI-c):
- a compound Formula (I) is of Formula (XI-d):
- a compound Formula (I) is of Formula (XII-a):
- a compound Formula (I) is of Formula (XII-b):
- a compound Formula (I) is of Formula (XII-c):
- a compound Formula (I) is of Formula (XII-d):
- a compound Formula (I) is of Formula (XIII-a):
- a compound Formula (I) is of Formula (XIII-b):
- a compound Formula (I) is of Formula (XIII-c):
- a compound Formula (I) is of Formula (XIII-d):
- the compound according to Formula (I) is a compound listed in Table 1.
- compositions described herein may be useful in treating and/or preventing proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject.
- cancers e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer
- benign neoplasms e.g., diseases associated with angio
- compositions described herein may also be useful for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell.
- a protein kinase e.g., CDK (e.g., CDK7)
- the compositions described herein may also be useful for inducing apoptosis in a cell.
- compositions comprising a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, and optionally a pharmaceutically acceptable excipient.
- the pharmaceutical composition of the invention comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and optionally a pharmaceutically acceptable excipient.
- a pharmaceutical composition described herein comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
- the compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof is provided in an effective amount in the pharmaceutical composition.
- the effective amount is a therapeutically effective amount (e.g., amount effective for treating a proliferative disease in a subject in need thereof). In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a cell. In certain embodiments, the effective amount is an amount effective for inducing apoptosis in a cell.
- a therapeutically effective amount e.g., amount effective for treating a proliferative disease in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject in need thereof. In certain embodiments, the
- the effective amount is a prophylactically effective amount (e.g., amount effective for preventing a proliferative disease in a subject in need thereof and/or for keeping a subject in need thereof in remission of a proliferative disease).
- a protein kinase described herein is a CDK.
- a protein kinase described herein is CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK11, CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19, or CDK20.
- a protein kinase described herein is CDK7.
- a protein kinase described herein is CDK12.
- a protein kinase described herein is CDK13.
- a protein kinase described herein is a Src family kinase. In certain embodiments, a protein kinase described herein is SRC. In certain embodiments, a protein kinase described herein is FGR. In certain embodiments, a protein kinase described herein is BUB1B. In certain embodiments, a protein kinase described herein is CHEK2. In certain embodiments, a protein kinase described herein is HIPK4. In certain embodiments, a protein kinase described herein is PRKCQ. In certain embodiments, a protein kinase described herein is RET.
- a protein kinase described herein is MELK. In certain embodiments, a protein kinase described herein is IRAK1, IRAK4, BMX, or PI3K. In certain embodiments, a protein kinase described herein is ABL, ARG, BLK, CSK, EphB1, EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, or TEC.
- a protein kinase described herein is ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), PDGFRB, SRC, YES, ABL1(H396P)-nonphosphorylated, ABL1(Y253F)-phosphorylated, ABL1-nonphosphorylated, FRK, LYN, ABL1(Q252H)-nonphosphorylated, DDR1, EPHB1, ERBB4, p38-alpha, ABL2, ABL1(Q252H)-phosphorylated, SIK, EPHA8, MEK5, ABL1(E255K)-phosphorylated, ABL1(F317L)-nonphosphorylated, FYN, LCK, EPHA2, ABL1(M351T)
- a protein kinase described herein is ABL1(F317L)-nonphosphorylated, ABL1(H396P)-nonphosphorylated, ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), LYN, PDGFRB, SRC, YES, ABL1-nonphosphorylated, ABL1(Y253F)-phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABL1(F317I)-nonphosphorylated, DDR1, EPHA2, ABL1(Q252H)-phosphorylated, MEK5, ABL1(Q252H)-nonphosphorylated, ABL2, FYN, EPHB1, ABL1(E255K)-phosphorylated, ABL
- the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%.
- a protein kinase e.g., CDK (e.g., CDK7)
- the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%.
- the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) by a range between a percentage described in this paragraph and another percentage described in this paragraph, inclusive.
- compositions described herein can be prepared by any method known in the art of pharmacology.
- preparatory methods include bringing the compound described herein (i.e., the “active ingredient”) into association with a carrier or excipient, and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping, and/or packaging the product into a desired single- or multi-dose unit.
- compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
- a “unit dose” is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage, such as one-half or one-third of such a dosage.
- Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition described herein will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
- the composition may comprise between 0.1% and 100% (w/w) active ingredient.
- compositions used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
- Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, and mixtures thereof.
- Exemplary granulating and/or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose, and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and mixtures thereof.
- crospovidone cross-linked poly(vinyl-pyrrolidone)
- sodium carboxymethyl starch sodium starch glycolate
- Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and Veegum (magnesium aluminum silicate)), long chain amino acid derivatives, high molecular weight alcohols (e.g., stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g., carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulos
- Exemplary binding agents include starch (e.g., cornstarch and starch paste), gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g., acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum ⁇ ), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, and/or mixtures
- Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, antiprotozoan preservatives, alcohol preservatives, acidic preservatives, and other preservatives.
- the preservative is an antioxidant.
- the preservative is a chelating agent.
- antioxidants include alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
- Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof.
- EDTA ethylenediaminetetraacetic acid
- salts and hydrates thereof e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like
- citric acid and salts and hydrates thereof e.g., citric acid mono
- antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
- antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
- Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
- Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
- preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant® Plus, Phenonip ⁇ , methylparaben, Germall® 115, Germaben® II, Neolone®, Kathon®, and Euxyl®.
- Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer
- Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
- Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus , evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba , macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea
- Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and mixtures thereof.
- Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs.
- the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- inert diluents commonly used in the art such as, for example, water or other solvents, so
- the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
- adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
- the conjugates described herein are mixed with solubilizing agents such as Cremophor®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and mixtures thereof.
- sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation can be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
- acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil can be employed including synthetic mono- or di-glycerides.
- fatty acids such as oleic acid are used in the preparation of injectables.
- the injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing the conjugates described herein with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
- suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
- the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or (a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, (c) humectants such as glycerol, (d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, (e) solution retarding agents such as paraffin, (f) absorption accelerators such as quaternary ammonium compounds, (g) wetting agents such as, for example, cetyl alcohol and glycerol mono
- Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the art of pharmacology. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
- encapsulating compositions which can be used include polymeric substances and waxes.
- Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- the active ingredient can be in a micro-encapsulated form with one or more excipients as noted above.
- the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings, and other coatings well known in the pharmaceutical formulating art.
- the active ingredient can be admixed with at least one inert diluent such as sucrose, lactose, or starch.
- Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose.
- the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
- encapsulating agents which can be used include polymeric substances and waxes.
- Dosage forms for topical and/or transdermal administration of a compound described herein may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, and/or patches.
- the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier or excipient and/or any needed preservatives and/or buffers as can be required.
- the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body.
- Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium.
- the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.
- Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices.
- Intradermal compositions can be administered by devices which limit the effective penetration length of a needle into the skin.
- conventional syringes can be used in the classical mantoux method of intradermal administration.
- Jet injection devices which deliver liquid formulations to the dermis via a liquid jet injector and/or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable.
- Ballistic powder/particle delivery devices which use compressed gas to accelerate the compound in powder form through the outer layers of the skin to the dermis are suitable.
- Formulations suitable for topical administration include, but are not limited to, liquid and/or semi-liquid preparations such as liniments, lotions, oil-in-water and/or water-in-oil emulsions such as creams, ointments, and/or pastes, and/or solutions and/or suspensions.
- Topically administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent.
- Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
- a pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity.
- a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, or from about 1 to about 6 nanometers.
- Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and/or using a self-propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container.
- Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers.
- Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
- Low boiling propellants generally include liquid propellants having a boiling point of below 65° F. at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition.
- the propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
- compositions described herein formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension.
- Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device.
- Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate.
- the droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.
- Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition described herein.
- Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered by rapid inhalation through the nasal passage from a container of the powder held close to the nares.
- Formulations for nasal administration may, for example, comprise from about as little as 0.1% (w/w) to as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein.
- a pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for buccal administration.
- Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
- formulations for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient.
- Such powdered, aerosolized, and/or aerosolized formulations when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
- a pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for ophthalmic administration.
- Such formulations may, for example, be in the form of eye drops including, for example, a 0.1-1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid carrier or excipient.
- Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein.
- Other opthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are also contemplated as being within the scope of this disclosure.
- compositions are principally directed to pharmaceutical compositions which are suitable for administration to humans, such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation.
- the compounds provided herein are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions described herein will be decided by a physician within the scope of sound medical judgment.
- the specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the disease being treated and the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex, and diet of the subject; the time of administration, route of administration, and rate of excretion of the specific active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.
- the compounds and compositions provided herein can be administered by any route, including enteral (e.g., oral), parenteral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
- enteral e.g., oral
- parenteral intravenous, intramuscular, intra-arterial, intramedullary
- intrathecal subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal
- topical as by powders, ointments, creams, and/or drops
- mucosal nasal,
- Specifically contemplated routes are oral administration, intravenous administration (e.g., systemic intravenous injection), regional administration via blood and/or lymph supply, and/or direct administration to an affected site.
- intravenous administration e.g., systemic intravenous injection
- regional administration via blood and/or lymph supply e.g., via blood and/or lymph supply
- direct administration e.g., direct administration to an affected site.
- the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), and/or the condition of the subject (e.g., whether the subject is able to tolerate oral administration).
- the compound or pharmaceutical composition described herein is suitable for topical administration to the eye of a subject.
- any two doses of the multiple doses include different or substantially the same amounts of a compound described herein.
- the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses a day, two doses a day, one dose a day, one dose every other day, one dose every third day, one dose every week, one dose every two weeks, one dose every three weeks, or one dose every four weeks.
- the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is one dose per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is two doses per day.
- the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses per day.
- the duration between the first dose and last dose of the multiple doses is one day, two days, four days, one week, two weeks, three weeks, one month, two months, three months, four months, six months, nine months, one year, two years, three years, four years, five years, seven years, ten years, fifteen years, twenty years, or the lifetime of the subject, biological sample, tissue, or cell.
- the duration between the first dose and last dose of the multiple doses is three months, six months, or one year.
- the duration between the first dose and last dose of the multiple doses is the lifetime of the subject, biological sample, tissue, or cell.
- a dose (e.g., a single dose, or any dose of multiple doses) described herein includes independently between 0.1 ⁇ g and 1 ⁇ g, between 0.001 mg and 0.01 mg, between 0.01 mg and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg and 3 mg, between 3 mg and 10 mg, between 10 mg and 30 mg, between 30 mg and 100 mg, between 100 mg and 300 mg, between 300 mg and 1,000 mg, or between 1 g and 10 g, inclusive, of a compound described herein.
- a dose described herein includes independently between 1 mg and 3 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 3 mg and 10 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 10 mg and 30 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 30 mg and 100 mg, inclusive, of a compound described herein.
- Dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult.
- the amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.
- a compound or composition, as described herein, can be administered in combination with one or more additional pharmaceutical agents (e.g., therapeutically and/or prophylactically active agents) useful in treating and/or preventing a proliferative disease.
- the compounds or compositions can be administered in combination with additional pharmaceutical agents that improve their activity (e.g., activity (e.g., potency and/or efficacy) in treating a proliferative disease in a subject in need thereof, in preventing a proliferative disease in a subject in need thereof, and/or in inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7) in a subject, biological sample, tissue, or cell), improve bioavailability, improve safety, reduce drug resistance, reduce and/or modify metabolism, inhibit excretion, and/or modify distribution in a subject, biological sample, tissue, or cell.
- a protein kinase e.g., CDK (e.g., CDK7)
- a pharmaceutical composition described herein including a compound described herein and an additional pharmaceutical agent shows a synergistic effect that is absent in a pharmaceutical composition including one of the compound and the additional pharmaceutical agent, but not both.
- the compound or composition can be administered concurrently with, prior to, or subsequent to one or more additional pharmaceutical agents, which may be useful as, e.g., combination therapies in treating and/or preventing a proliferative disease.
- Pharmaceutical agents include therapeutically active agents.
- Pharmaceutical agents also include prophylactically active agents.
- Pharmaceutical agents include small organic molecules such as drug compounds (e.g., compounds approved for human or veterinary use by the U.S.
- the additional pharmaceutical agent is a pharmaceutical agent useful in treating a proliferative disease. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in preventing a proliferative disease.
- the additional pharmaceutical agent is a pharmaceutical agent useful in inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell.
- a protein kinase e.g., CDK (e.g., CDK7)
- the additional pharmaceutical agent is a pharmaceutical agent useful in inducing apoptosis in a cell.
- the additional pharmaceutical agent is a pharmaceutical agent approved by a regulatory agency (e.g., the US FDA) for treating and/or preventing a proliferative disease.
- Each additional pharmaceutical agent may be administered at a dose and/or on a time schedule determined for that pharmaceutical agent.
- the additional pharmaceutical agent(s) may also be administered together with each other and/or with the compound or composition described herein in a single dose or administered separately in different doses.
- the particular combination to employ in a regimen will take into account compatibility of the compound described herein with the additional pharmaceutical agent(s) and/or the desired therapeutic and/or prophylactic effect to be achieved.
- the additional pharmaceutical agent(s) in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- the additional pharmaceutical agent is an anti-proliferative agent (e.g., anti-cancer agent). In certain embodiments, the additional pharmaceutical agent is an anti-leukemia agent. In certain embodiments, the additional pharmaceutical agent is ABITREXATE (methotrexate), ADE, Adriamycin RDF (doxorubicin hydrochloride), Ambochlorin (chlorambucil), ARRANON (nelarabine), ARZERRA (ofatumumab), BOSULIF (bosutinib), BUSULFEX (busulfan), CAMPATH (alemtuzumab), CERUBIDINE (daunorubicin hydrochloride), CLAFEN (cyclophosphamide), CLOFAREX (clofarabine), CLOLAR (clofarabine), CVP, CYTOSAR-U (cytarabine), CYTOXAN (cyclophosphamide), ERWINAZE (Asparaginase Erase Er
- the additional pharmaceutical agent is an anti-lymphoma agent.
- the additional pharmaceutical agent is ABITREXATE (methotrexate), ABVD, ABVE, ABVE-PC, ADCETRIS (brentuximab vedotin), ADRIAMYCIN PFS (doxorubicin hydrochloride), ADRIAMYCIN RDF (doxorubicin hydrochloride), AMBOCHLORIN (chlorambucil), AMBOCLORIN (chlorambucil), ARRANON (nelarabine), BEACOPP, BECENUM (carmustine), BELEODAQ (belinostat), BEXXAR (tositumomab and iodine 1131 tositumomab), BICNU (carmustine), BLENOXANE (bleomycin), CARMUBRIS (carmustine), CHOP, CLAFEN (cyclophosphamide), COPP, COPP-ABV, C
- the additional pharmaceutical agent is an anti-myelodysplasia agent.
- the additional pharmaceutical agent is REVLIMID (lenalidomide), DACOGEN (decitabine), VIDAZA (azacitidine), CYTOSAR-U (cytarabine), IDAMYCIN (idarubicin), CERUBIDINE (daunorubicin), or a combination thereof.
- the additional pharmaceutical agent is an anti-macroglobulinemia agent.
- the additional pharmaceutical agent is LEUKERAN (chlorambucil), NEOSAR (cyclophosphamide), FLUDARA (fludarabine), LEUSTATIN (cladribine), or a combination thereof.
- the additional pharmaceutical agent is ABITREXATE (methotrexate), ABRAXANE (paclitaxel albumin-stabilized nanoparticle formulation), AC, AC-T, ADE, ADRIAMYCIN PFS (doxorubicin hydrochloride), ADRUCIL (fluorouracil), AFINITOR (everolimus), AFINITOR DISPERZ (everolimus), ALDARA (imiquimod), ALIMTA (pemetrexed disodium), AREDIA (pamidronate disodium), ARIMIDEX (anastrozole), AROMASIN (exemestane), AVASTIN (bevacizumab), BECENUM (carmustine), BEP, BICNU (carmustine), BLENOXANE (methotrexate), A
- the additional pharmaceutical agent is a protein kinase inhibitor (e.g., tyrosine protein kinase inhibitor). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a Src family kinase. In certain embodiments, the additional pharmaceutical agent is a CDK inhibitor. In certain embodiments, the additional pharmaceutical agent is a CDK7 inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of IRAK1, IRAK4, BMX, and PI3K.
- the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of BUB1B, CDK2, CDK9, CHEK2, FGR, HIPK4, PRKCQ, RET, SRC, or MELK.
- the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL, ARG, BLK, CSK, EphB1, EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, and TEC.
- the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), PDGFRB, SRC, YES, ABL1(H396P)-nonphosphorylated, ABL1(Y253F)-phosphorylated, ABL1-nonphosphorylated, FRK, LYN, ABL1(Q252H)-nonphosphorylated, DDR1, EPHB1, ERBB4, p38-alpha, ABL2, ABL1(Q252H)-phosphorylated, SIK, EPHA8, MEK5, ABL1(E255K)-phosphorylated, ABL1(F317L)-nonphosphorylated, FYN, LCK, EP
- the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL1(F317L)-nonphosphorylated, ABL1(H396P)-nonphosphorylated, ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), LYN, PDGFRB, SRC, YES, ABL1-nonphosphorylated, ABL1(Y253F)-phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABL1(F317I)-nonphosphorylated, DDR1, EPHA2, ABL1(Q252H)-phosphorylated, MEK5, ABL1(Q252H)-nonphosphorylated, ABL2, FYN, EPHB1, ABL1(F317L
- the additional pharmaceutical agent is an anti-angiogenesis agent, anti-inflammatory agent, immunosuppressant, anti-bacterial agent, anti-viral agent, cardiovascular agent, cholesterol-lowering agent, anti-diabetic agent, anti-allergic agent, pain-relieving agent, or a combination thereof.
- the compounds described herein or pharmaceutical compositions can be administered in combination with an anti-cancer therapy including, but not limited to, transplantation (e.g., bone marrow transplantation, stem cell transplantation), surgery, radiation therapy, immunotherapy, and chemotherapy.
- kits e.g., pharmaceutical packs.
- the kits provided may comprise a pharmaceutical composition or compound described herein and a container (e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container).
- a container e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container.
- provided kits may optionally further include a second container comprising a pharmaceutical excipient for dilution or suspension of a pharmaceutical composition or compound described herein.
- the pharmaceutical composition or compound described herein provided in the first container and the second container are combined to form one unit dosage form.
- the present invention also provides methods for the treatment or prevention of a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases).
- a proliferative disease e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with
- the compounds described herein may be able to bind (e.g., covalently modify) a protein kinase described herein.
- the R 2 group of a compound described herein may be able to bind (e.g., covalently modify) to the protein kinase.
- the R 2 group of a compound described herein may be able to covalently bind a cysteine residue of the protein kinase.
- the R 2 group of a compound described herein may be able to covalently bind Cys312 residue of CDK7.
- the present disclosure provides methods of inhibiting the activity of a protein kinase in a subject, the methods comprising administering to the subject an effective amount (e.g., therapeutically effective amount) of a compound, or pharmaceutical composition thereof, as described herein.
- an effective amount e.g., therapeutically effective amount
- the present disclosure provides methods of inhibiting the activity of a protein kinase in a biological sample, the methods comprising contacting the biological sample with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
- the present disclosure provides methods of inhibiting the activity of a protein kinase in a tissue, the methods comprising contacting the tissue with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
- the present disclosure provides methods of inhibiting the activity of a protein kinase in a cell, the methods comprising contacting the cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
- the subject being treated is a mammal.
- the subject is a human.
- the subject is a domesticated animal, such as a dog, cat, cow, pig, horse, sheep, or goat.
- the subject is a companion animal such as a dog or cat.
- the subject is a livestock animal such as a cow, pig, horse, sheep, or goat.
- the subject is a zoo animal.
- the subject is a research animal such as a rodent, dog, or non-human primate.
- the subject is a non-human transgenic animal such as a transgenic mouse or transgenic pig.
- a biological sample described herein is bone marrow, lymph node, spleen, or blood.
- a cell described herein is in vitro. In certain embodiments, a cell described herein is ex vivo. In certain embodiments, a cell described herein is in vivo. In certain embodiments, a cell described herein is a malignant cell (e.g., malignant blood cell). In certain embodiments, a cell described herein is a malignant hematopoietic stem cell (e.g., malignant myeloid cell or malignant lymphoid cell). In certain embodiments, a cell described herein is a malignant lymphocyte (e.g., malignant T-cell or malignant B-cell). In certain embodiments, a cell described herein is a malignant red blood cell, malignant white blood cell, or malignant platelet. In certain embodiments, a cell described herein is a malignant neutrophil, malignant macrophage, or malignant plasma cell.
- the proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a kinase, such as cyclin-dependent kinase (CDK).
- a kinase such as cyclin-dependent kinase (CDK).
- CDK cyclin-dependent kinase
- G1, S, G2, and M The process of eukaryotic cell division may be broadly divided into a series of sequential phases termed G1, S, G2, and M. Correct progression through the various phases of the cell cycle has been shown to be critically dependent upon the spatial and temporal regulation of a family of proteins known as cyclin dependent kinases (CDKs) and a diverse set of their cognate protein partners termed cyclins.
- CDKs cyclin dependent kinases
- CDKs are CDCl 2 (also known as CDK1) homologous serine-threonine kinase proteins that are able to utilize ATP as a substrate in the phosphorylation of diverse polypeptides in a sequence-dependent context.
- Cyclins are a family of proteins characterized by a homology region, containing approximately 100 amino acids, termed the “cyclin box” which is used in binding to, and defining selectivity for, specific CDK partner proteins.
- Modulation of the expression levels, degradation rates, protein levels, and activity levels of various CDKs and cyclins throughout the cell cycle leads to the cyclical formation of a series of CDK/cyclin complexes, in which the CDKs are enzymatically active.
- the formation of these complexes controls passage through discrete cell cycle checkpoints and thereby enables the process of cell division to continue.
- Failure to satisfy the prerequisite biochemical criteria at a given cell cycle checkpoint, i.e., failure to form a required CDK/cyclin complex can lead to cell cycle arrest and/or cellular apoptosis. Aberrant cellular proliferation can often be attributed to loss of correct cell cycle control.
- CDK enzymatic activity therefore provides a means by which abnormally dividing cells can have their division arrested and/or be killed.
- the diversity of CDKs, and CDK complexes, and their critical roles in mediating the cell cycle, provides a broad spectrum of potential therapeutic targets selected on the basis of a defined biochemical rationale.
- CDK7 a member of the CDK family, was originally isolated as the catalytic subunit of the trimeric CDK-activating kinase (CAK) complex.
- This complex consisting of CDK7, cyclin H, and MAT1, is responsible for activation of the mitotic promoting factor in vitro.
- TFIIH basal transcription repair factor IIH
- TFIIH is a multi-subunit protein complex identified as a factor required for RNA polymerase II (RNAP II)-catalyzed transcription, and subsequently this complex was found to play a key role in nucleotide excision repair.
- CDK7 is a component of at least three complexes, i.e., the trimeric CAK complex, the quaternary complex with the XPD (or ERCC2, a protein involved in transcription-coupled nucleotide excision repair), and the nine-subunit TFIIH complex.
- the two functions of CDK7 in CAK and CTD phosphorylation support critical facets of cellular proliferation, cell cycling, and transcription.
- Overexpression of CDK7 may inhibit apoptosis, promote transcription and cell proliferation, and/or disrupt DNA repair, and therefore, cause proliferative diseases.
- the proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a CDK (e.g., CDK7).
- a proliferative disease may be associated with aberrant activity of a CDK (e.g., CDK7).
- Aberrant activity of a CDK e.g., CDK7
- CDK7 may be an elevated and/or an inappropriate activity of the CDK.
- Deregulation of cell cycle progression is a characteristic of a proliferative disease, and a majority of proliferative diseases have abnormalities in some component of CDK (e.g., CDK7) activity, frequently through elevated and/or inappropriate CDK activation. Inhibition of the catalytic activity of CDK7 would be expected to inhibit cell cycle progression by blocking the phosphorylation of cell cycle CDKs, and would additionally inhibit transcription of effectors of cell division.
- CDK7 is not overexpressed, and the activity of CDK7 is elevated and/or inappropriate. In certain other embodiments, CDK7 is overexpressed, and the activity of CDK7 is elevated and/or inappropriate.
- the compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activity of CDK7 and be useful in treating and/or preventing proliferative diseases.
- a proliferative disease may also be associated with inhibition of apoptosis of a cell in a biological sample or subject. All types of biological samples described herein or known in the art are contemplated as being within the scope of the invention.
- Apoptosis is the process of programmed cell death. Inhibition of apoptosis may result in uncontrolled cell proliferation and, therefore, may cause proliferative diseases.
- the cell cycle CDKs (CDK1, 2, 4, and 6) are activated by phosphorylation by CDK7/cyclin H (also called CAK). Inhibition of CDK7 would therefore result in cell-cycle arrest at multiple points in the cell cycle due to failure to activate the cell cycle CDKs.
- CDK 7 activates transcription by phosphorylating the CTD of RNAP II.
- CTD phosphorylation has been shown to inhibit transcription and reduce expression of short lived proteins, including those involved in apoptosis regulation. It is appreciated in the art that stalling of RNA polymerase may activate p53 (also known as protein 53 or tumor protein 53, a tumor suppressor protein that is encoded in humans by the TP53 gene), leading to apoptosis. Thus, inhibition of the activity of CDK7 are expected to cause cytotoxicity by inducing apoptosis.
- p53 also known as protein 53 or tumor protein 53, a tumor suppressor protein that is encoded in humans by the TP53 gene
- the compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may induce apoptosis, and therefore, be useful in treating and/or preventing proliferative diseases.
- the proliferative disease to be treated or prevented using the compounds described herein is cancer. All types of cancers disclosed herein or known in the art are contemplated as being within the scope of the invention.
- the proliferative disease is a cancer associated with dependence on BCL-2 anti-apoptotic proteins (e.g., MCL-1 and/or XIAP).
- the proliferative disease is a cancer associated with overexpression of MYC (a gene that codes for a transcription factor).
- the cancer is a MYC-dependent cancer.
- the proliferative disease is a hematological malignancy.
- the proliferative disease is a blood cancer.
- the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is leukemia. In certain embodiments, the proliferative disease is chronic lymphocytic leukemia (CLL). In certain embodiments, the proliferative disease is acute lymphoblastic leukemia (ALL). In certain embodiments, the proliferative disease is T-cell acute lymphoblastic leukemia (T-ALL). In certain embodiments, the proliferative disease is chronic myelogenous leukemia (CML). In certain embodiments, the proliferative disease is acute myelogenous leukemia (AML). In certain embodiments, the proliferative disease is acute monocytic leukemia (AMoL).
- CLL chronic lymphocytic leukemia
- ALL acute lymphoblastic leukemia
- T-ALL T-cell acute lymphoblastic leukemia
- T-ALL T-cell acute lymphoblastic leukemia
- the proliferative disease is chronic myelogen
- the proliferative disease is lymphoma. In some embodiments, the proliferative disease is Burkitt's lymphoma. In certain embodiments, the proliferative disease is a Hodgkin's lymphoma. In certain embodiments, the proliferative disease is a non-Hodgkin's lymphoma. In certain embodiments, the proliferative disease is multiple myeloma. In certain embodiments, the proliferative disease is melanoma. In certain embodiments, the proliferative disease is colorectal cancer. In certain embodiments, the proliferative disease is breast cancer. In certain embodiments, the proliferative disease is triple-negative breast cancer (TNBC).
- TNBC triple-negative breast cancer
- the proliferative disease is a bone cancer. In certain embodiments, the proliferative disease is osteosarcoma. In certain embodiments, the proliferative disease is Ewing's sarcoma. In some embodiments, the proliferative disease is a brain cancer. In some embodiments, the proliferative disease is neuroblastoma. In some embodiments, the proliferative disease is a lung cancer. In some embodiments, the proliferative disease is small cell lung cancer (SCLC). In some embodiments, the proliferative disease is non-small cell lung cancer. In some embodiments, the proliferative disease is a benign neoplasm.
- SCLC small cell lung cancer
- the proliferative disease is associated with angiogenesis. All types of angiogenesis disclosed herein or known in the art are contemplated as being within the scope of the invention.
- the proliferative disease is an inflammatory disease. All types of inflammatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
- the inflammatory disease is rheumatoid arthritis.
- the proliferative disease is an autoinflammatory disease. All types of autoinflammatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
- the proliferative disease is an autoimmune disease. All types of autoimmune diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
- Another aspect of the invention relates to methods of inhibiting the activity of a kinase in a biological sample or subject.
- the kinase is CDK.
- the kinase is CDK7.
- the activity of the kinase is aberrant activity of the kinase.
- the inhibition of the activity of the kinase is irreversible.
- the inhibition of the activity of the kinase is reversible.
- the methods of inhibiting the activity of the kinase include attaching a compound described herein to the kinase.
- Genes which may have their transcription inhibited by the compounds herein include MYC, KLF2, E2F2, CDK6, CCND3, E2F3, HNRPDL, TET1, and IL7R.
- the present invention also provides methods of inhibiting cell growth in a biological sample or subject.
- the present invention provides methods of inducing apoptosis of a cell in a biological sample or a subject.
- the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, or a pharmaceutical composition thereof.
- the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition thereof.
- the compound is contacted with a biological sample.
- the compound is administered to a subject.
- the compound is administered in combination with one or more additional pharmaceutical agents described herein.
- the additional pharmaceutical agent may be an anti-proliferative agent. In certain embodiments, the additional pharmaceutical agent is an anti-cancer agent.
- the additional pharmaceutical agent may also be a kinase inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a CDK. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is an inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of another CDK.
- the additional pharmaceutical agent is a nonselective inhibitor of another CDK.
- the additional pharmaceutical agent is flavopiridol, triptolide, SNS-032 (BMS-387032), PHA-767491, PHA-793887, BS-181, (S)—CR8, (R)—CR8, or NU6140.
- the additional pharmaceutical agent is an inhibitor of a mitogen-activated protein kinase (MAPK).
- the additional pharmaceutical agent is an inhibitor of a glycogen synthase kinase 3 (GSK3).
- the additional pharmaceutical agent is an inhibitor of an AGC kinase.
- the additional pharmaceutical agent is an inhibitor of a calmodulin-dependent kinase (CaM Kinase). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a casein kinase 1. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a STE kinase. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a tyrosine kinase.
- CaM Kinase calmodulin-dependent kinase
- the additional pharmaceutical agent is an inhibitor of a casein kinase 1.
- the additional pharmaceutical agent is an inhibitor of a STE kinase.
- the additional pharmaceutical agent is an inhibitor of a tyrosine kinase.
- the additional pharmaceutical agent is a topoisomerase inhibitor, a MCL1 inhibitor, a BCL-2 inhibitor, a BCL-xL inhibitor, a BRD4 inhibitor, a CDK9 inhibitor, a Jumonji histone demethylase inhibitor, or a DNA damage inducer.
- the additional pharmaceutical agent is etoposide, obatoclax, navitoclax, JQ1, 4-(((5′-chloro-2′-(((1R,4R)-4-(((R)-1-methoxypropan-2-yl)amino)cyclohexyl)amino)-[2,4′-bipyridin]-6-yl)amino)methyl)tetrahydro-2H-pyran-4-carbonitrile, JIB04, or cisplatin.
- the additional pharmaceutical agent is etoposide, obatoclax, or navitoclax
- the disease to be treated is breast cancer, e.g., triple-negative breast cancer, HER2 positive breast cancer, ER-positive breast cancer, or ER/PR-positive breast cancer.
- the additional pharmaceutical agent is etoposide, JIB04, or cisplatin, and the disease to be treated is Ewing's sarcoma.
- the additional pharmaceutical agent is JQ1 or NVP2
- the disease to be treated is leukemia, e.g., acute myelogenous leukemia, myeloblastic leukemia, promyelocytic leukemia, myelomonocytic leukemia, monocytic leukemia, monoblastic leukemia, or megakaryoblastic leukemia.
- a pharmaceutical composition described herein further comprises a combination of the additional pharmaceutical agents described herein.
- inventive compounds or compositions may synergistically augment inhibition of CDK7 induced by the additional pharmaceutical agent(s) in the biological sample or subject.
- the combination of the inventive compounds or compositions and the additional pharmaceutical agent(s) may be useful in treating proliferative diseases resistant to a treatment using the additional pharmaceutical agent(s) without the inventive compounds or compositions.
- the activity of a protein kinase is non-selectively inhibited by the compounds or pharmaceutical compositions described herein. In some embodiments, the activity of a protein kinase described herein is selectively inhibited by the compounds or pharmaceutical compositions described herein, compared to the activity of a different protein (e.g., a different protein kinase). In certain embodiments, the activity of CDK (e.g., CDK7) is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different protein. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different CDK protein.
- CDK e.g., CDK7
- the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK13. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12 and the activity of CDK13.
- the selectivity of a compound or pharmaceutical composition described herein in inhibiting the activity of a protein kinase over a different protein may be measured by the quotient of the IC 50 value of the compound or pharmaceutical composition in inhibiting the activity of the different protein over the IC 50 value of the compound or pharmaceutical composition in inhibiting the activity of the protein kinase.
- the selectivity of a compound or pharmaceutical composition described herein for a protein kinase over a different protein may also be measured by the quotient of the K d value of an adduct of the compound or pharmaceutical composition and the different protein over the K d value of an adduct of the compound or pharmaceutical composition and the protein kinase.
- the selectivity is at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 30-fold, at least 100-fold, at least 300-fold, at least 1,000-fold, at least 3,000-fold, at least 10,000-fold, at least 30,000-fold, or at least 100,000-fold. In certain embodiments, the selectivity is not more than 100,000-fold, not more than 10,000-fold, not more than 1,000-fold, not more than 100-fold, not more than 10-fold, or not more than 2-fold. Combinations of the above-referenced ranges (e.g., at least 2-fold and not more than 10,000-fold) are also within the scope of the disclosure.
- a kit described herein includes a first container comprising a compound or pharmaceutical composition described herein.
- a kit described herein is useful in treating a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a
- kits described herein further includes instructions for using the compound or pharmaceutical composition included in the kit.
- a kit described herein may also include information as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA).
- the information included in the kits is prescribing information.
- the kits and instructions provide for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell.
- a kit described herein may include one or more additional pharmaceutical agents described herein as a separate composition.
- TLC thin layer chromatography
- E. Merck pre-coated silica gel plates 60 F 254
- Waters LCMS system Waters 2489 UV/Visible Detector, Waters 3100 Mass, Waters 515 HPLC pump, Waters 2545 Binary Grad
- Exemplary compounds of the invention were tested at different concentrations.
- Cells were plated in 96-well plates at the following seeding densities: Jurkat T-cell acute lymphoblastic leukemia 25,000 cells/well; HCT116 colorectal carcinoma 8,000 cells/well; Kelly neuroblastoma 4,000 cells/well.
- the cells were treated with various concentration of compounds (ranging from 1 nM to 10 ⁇ M).
- DMSO solvent with no compound served as a control.
- cell survival following treatment with exemplary compounds described herein was assessed by CellTiter-Glo® Luminescent cell viability assay (Promega).
- IC 50 values were determined using GRAPHPAD PRISM 6 software.
- CAK complex (Millipore cat #14-476) in 40 mM Hepes pH 7.4, 150 mM NaCl, 5% glycerol and 1 mM DTT with protease and phosphatase inhibitors was incubated with a 10-fold molar excess of Compound 101 for 6 hrs at 37° C. Proteins were resolved by SDS-PAGE, bands corresponding to CDK7 were digested in-gel with trypsin, and peptides analyzed by nano LC-MS using an Orbitrap XL mass spectrometer (ThermoFisher Scientific, San Jose, Calif.).
- the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim.
- any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim.
- elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features.
Abstract
Description
- This application is a divisional of and claims priority under 35 U.S.C. § 120 to U.S. patent application U.S. Ser. No. 15/538,763, filed Jun. 22, 2017, which is a national stage filing under 35 U.S.C. § 371 of International PCT Application, PCT/US2015/000297, filed Dec. 23, 2015, which claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application, U.S. Ser. No. 62/096,040, filed on Dec. 23, 2014, each of which is incorporated herein by reference.
- This invention was made with government support under grant number 1 R01 CA 179483-01A1 awarded by the National Institutes of Health. The government has certain rights in the invention.
- The members of the cyclin-dependent kinase (CDK) family play critical regulatory roles in cell proliferation. There are currently 20 known mammalian CDKs. While CDK7-CDK13 have been linked to transcription, only CDK1, 2, 4, and 6 show demonstrable association with the cell cycle. Unique among the mammalian CDKs, CDK7 has consolidated kinase activities, regulating both the cell cycle and transcription. In the cytosol, CDK7 exists as a heterotrimeric complex and is believed to function as a CDK1/2-activating kinase (CAK), whereby phosphorylation of conserved residues in CDK1/2 by CDK7 is required for full catalytic CDK activity and cell cycle progression (Desai et al., “Effects of phosphorylation by CAK on cyclin binding by CDCl2 and CDK2.” Mol. Cell Biol. 15, 345-350 (1995); Kaldis et al., “Analysis of CAK activities from human cells.” Eur. J. Biochem. 267, 4213-4221 (2000); Larochelle et al., “Requirements for CDK7 in the assembly of CDK1/cyclin B and activation of CDK2 revealed by chemical genetics in human cells.” Mol. Cell 25, 839-850 (2007)). In the nucleus, CDK7 forms the kinase core of the RNA polymerase (RNAP) II general transcription factor complex and is charged with phosphorylating the C-terminal domain (CTD) of RNAP II, a requisite step in gene transcriptional initiation (Serizawa. et al., “Association of CDK-activating kinase subunits with transcription factor TFIIH.” Nature 374, 280-282 (1995); Shiekhattar et al., “CDK-activating kinase complex is a component of human transcription factor TFIIH.” Nature 374, 283-287 (1995); Drapkin et al., “Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.” Proc. Natl. Acad. Sci. U.S.A. 93, 6488-6493 (1996); Liu. et al., “Two cyclin-dependent kinases promote RNA polymerase II transcription and formation of the scaffold complex.” Mol. Cell Biol. 24, 1721-1735 (2004); Akhtar et al., “TFIIH kinase places bivalent marks on the carboxy-terminal domain of RNA polymerase II.” Mol. Cell 34, 387-393 (2009); Glover-Cutter et al., “TFIIH-associated CDK7 kinase functions in phosphorylation of C-terminal domain Ser7 residues, promoter-proximal pausing, and termination by RNA polymerase II.” Mol. Cell Biol. 29, 5455-5464 (2009)). Together, the two functions of CDK7, i.e., CAK and CTD phosphorylation, support critical facets of cellular proliferation, cell cycling, and transcription.
- Disruption of RNAP II CTD phosphorylation has been shown to preferentially affect proteins with short half-lives, including those of the anti-apoptotic BCL-2 family (Konig et al., “The novel cyclin-dependent kinase inhibitor flavopiridol downregulates Bc1-2 and induces growth arrest and apoptosis in chronic B-cell leukemia lines.” Blood 1, 4307-4312 (1997); Gojo et al., “The cyclin-dependent kinase inhibitor flavopiridol induces apoptosis in multiple myeloma cells through transcriptional repression and down-regulation of Mc1-1.” Clin. Cancer Res. 8, 3527-3538 (2002)). Cancer cells have demonstrated ability to circumvent pro-cell death signaling through up-regulation of BCL-2 family members (Llambi et al., “Apoptosis and oncogenesis: give and take in the BCL-2 family.” Curr. Opin. Genet. Dev. 21, 12-20 (2011)). Therefore, inhibition of human CDK7 kinase activity is likely to result in anti-proliferative activity, and pharmacological inhibition is thought to be useful in treating proliferative disorders, including cancer. Indeed, flavopiridol, a non-selective pan-CDK inhibitor that targets CTD kinases, has demonstrated efficacy for the treatment of chronic lymphocytic leukemia (CLL) but suffers from a poor toxicity profile (Lin et al., “Phase II study of flavopiridol in relapsed chronic lymphocytic leukemia demonstrating high response rates in genetically high-risk disease.” J. Clin. Oncol. 27, 6012-6018 (2009); Christian et al., “Flavopiridol in chronic lymphocytic leukemia: a concise review.” Clin. Lymphoma Myeloma 9 Suppl. 3, S179-S185 (2009)). A selective CDK7 inhibitor may hold promise as a therapeutic agent for the treatment of CLL and other cancers.
- The present invention provides compounds of Formula (I), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof. The compounds of Formula (I), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activity of a kinase. In certain embodiments, the inhibited kinase is a CDK. In certain embodiments, the kinase is CDK7. In certain embodiments, the compound of Formula (I) is selective for CDK7 compared to other kinases (e.g., CDK12 and CDK13). The present invention further provides methods of using the inventive compounds, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, to study the inhibition of a kinase (e.g., CDK7) and as therapeutics for the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase (e.g., CDK7). In certain embodiments, the inventive compounds are used for the prevention and/or treatment of proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject.
- In certain embodiments, the compounds of Formula (I) may selectively inhibit the activity of CDK7 compared to CDK13. Since the discovery of selective inhibitors of CDK7 has been hampered by the high sequence and structural similarities of the kinase domain of CDK family members, the development of selective inhibitors of the transcriptional cyclin-dependent kinases (tCDKs) will allow dissection of their individual contributions to the regulation of transcription and evaluation of their therapeutic potential. Without wishing to be bound by any particular theory, the inventive compounds' selectivity for CDK7 may be due to the compounds' ability to covalently modify the cysteine residue (Cys312) of CDK7. Cys312 of CDK7 is largely unique among the CDKs and other kinases.
- In one aspect, the present invention provides compounds of Formula (I):
- and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein R1, R2, R3, R4, R5, linker L1, linker L2, Ring A, and Ring B are as defined herein.
- In certain embodiments, a compound of Formula (I) is of Formula (II):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L2, Ring A, and Ring B are as defined herein.
- In certain embodiments, a compound of Formula (I) is of Formula (III):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L2, Ring A, and Ring B are as defined herein.
- In certain embodiments, a compound of Formula (I) is of Formula (V-a), (V-b), (V-c), or (V-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R2, R1a, R1N, R2N, linker L2, Ring A, and Ring B are as defined herein.
- In certain embodiments, a compound of Formula (I) is of Formula (IX-a), (IX-b), (IX-C), or (IX-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, linker L2, Ring A, and Ring B are as defined herein.
- In another aspect, the present disclosure provides pharmaceutical compositions including a compound described herein, and optionally a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutical compositions described herein include a therapeutically or prophylactically effective amount of a compound described herein. The pharmaceutical composition may be useful for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell.
- In another aspect, the present invention provides methods for treating and/or preventing a proliferative disease. Exemplary proliferative diseases which may be treated include cancer (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasm, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases.
- Another aspect of the invention relates to methods of inhibiting the activity of a kinase (e.g., CDK (e.g., CDK7)) in a biological sample or subject. In certain embodiments, the method involves the selective inhibition of CDK7.
- Also provided by the present invention are methods of inhibiting transcription in a biological sample or subject. The transcription of genes affected by the activity of CDK7 may be inhibited by the compounds of the invention.
- The present invention also provides methods of inhibiting cell growth in a biological sample or subject. In still another aspect, the present invention provides methods of inducing apoptosis of a cell in a biological sample or a subject.
- In yet another aspect, the present invention provides compounds of Formula (I), and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, for use in the treatment of a proliferative disease (e.g., cancer) in a subject.
- Another aspect of the present disclosure relates to kits comprising a container with a compound, or pharmaceutical composition thereof, as described herein. The kits described herein may include a single dose or multiple doses of the compound or pharmaceutical composition. The kits may be useful in a method of the disclosure. In certain embodiments, the kit further includes instructions for using the compound or pharmaceutical composition. A kit described herein may also include information (e.g. prescribing information) as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA).
- The present invention describes methods for administering to the subject an effective amount of a compound, or pharmaceutical composition thereof, as described herein. Also described are methods for a cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein. In certain embodiments, a method described herein further includes administering to the subject an additional pharmaceutical agent. In certain embodiments, a method described herein further includes contacting the cell with an additional pharmaceutical agent. A method described herein may further include performing radiotherapy, immunotherapy, and/or transplantation on the subject.
- In yet another aspect, the present disclosure provides compounds, and pharmaceutical compositions thereof, as described herein for use in a method of the disclosure.
- The details of one or more embodiments of the invention are set forth herein. Other features, objects, and advantages of the invention will be apparent from the Detailed Description, the Examples, and the Claims.
- The accompanying drawing, which are incorporated in and constitute a part of this specification, illustrate several embodiments of the invention and together with the description, serve to explain the principles of the invention.
-
FIGS. 1A-1H show the total ion chromatograms (TIC; A,E) and extracted ion chromatograms (XIC; B-D, F-H) for CDK7 peptides recorded during analysis of CAK complexes treated with DMSO (A-D) or Compound 101 (E-H).FIG. 1A : TIC; DMSO.FIG. 1B : XIC; DMSO.FIG. 1C : XIC; DMSO.FIG. 1D : XIC; DMSO.FIG. 1E : TIC;compound 101.FIG. 1F : XIC;compound 101.FIG. 1G : XIC;compound 101.FIG. 1H : XIC;compound 101. -
FIG. 2 shows an MS spectrum (m/z 686-690) recorded during analysis of peptides derived from CDK7 treated withCompound 101. Signal at m/z 687.7498 corresponds to YFSNRPGPTPGCQLPRPNCPVETLK, with Cys312 labeled withCompound 101. - Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75th Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Thomas Sorrell, Organic Chemistry, University Science Books, Sausalito, 1999; Smith and March, March's Advanced Organic Chemistry, 5th Edition, John Wiley & Sons, Inc., New York, 2001; Larock, Comprehensive Organic Transformations, VCH Publishers, Inc., New York, 1989; and Carruthers, Some Modern Methods of Organic Synthesis, 3rd Edition, Cambridge University Press, Cambridge, 1987. The disclosure is not intended to be limited in any manner by the exemplary listing of substituents described herein.
- Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various isomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel, Stereochemistry of Carbon Compounds (McGraw-Hill, N Y, 1962); and Wilen, Tables of Resolving Agents and Optical Resolutions p. 268 (E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, Ind. 1972). The disclosure additionally encompasses compounds described herein as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
- When a range of values is listed, it is intended to encompass each value and sub-range within the range. For example “C1-6” is intended to encompass, C1, C2, C3, C4, C5, C6, C1-6, C1-5, C1-4, C1-3, C1-2, C2-6, C2-5, C2-4, C2-3, C3-6, C3-5, C3-4, C4-6, C4-5, and C5-6.
- The term “aliphatic” includes both saturated and unsaturated, straight chain (i.e., unbranched), branched, acyclic, cyclic, or polycyclic aliphatic hydrocarbons, which are optionally substituted with one or more functional groups. As will be appreciated by one of ordinary skill in the art, “aliphatic” is intended herein to include, but is not limited to, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties. Thus, the term “alkyl” includes straight, branched and cyclic alkyl groups. An analogous convention applies to other generic terms such as “alkenyl”, “alkynyl”, and the like. Furthermore, the terms “alkyl”, “alkenyl”, “alkynyl”, and the like encompass both substituted and unsubstituted groups. In certain embodiments, “lower alkyl” is used to indicate those alkyl groups (cyclic, acyclic, substituted, unsubstituted, branched or unbranched) having 1-6 carbon atoms.
- In certain embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-20 aliphatic carbon atoms. In certain other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-10 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-8 aliphatic carbon atoms. In still other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-6 aliphatic carbon atoms. In yet other embodiments, the alkyl, alkenyl, and alkynyl groups employed in the disclosure contain 1-4 carbon atoms. Illustrative aliphatic groups thus include, but are not limited to, for example, methyl, ethyl, n-propyl, isopropyl, cyclopropyl, —CH2-cyclopropyl, vinyl, allyl, n-butyl, sec-butyl, isobutyl, tert-butyl, cyclobutyl, —CH2-cyclobutyl, n-pentyl, sec-pentyl, isopentyl, tert-pentyl, cyclopentyl, —CH2-cyclopentyl, n-hexyl, sec-hexyl, cyclohexyl, —CH2-cyclohexyl moieties and the like, which again, may bear one or more substituents. Alkenyl groups include, but are not limited to, for example, ethenyl, propenyl, butenyl, 1-methyl-2-buten-1-yl, and the like. Representative alkynyl groups include, but are not limited to, ethynyl, 2-propynyl (propargyl), 1-propynyl, and the like.
- The term “alkyl” refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (“C1-10 alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C1-9 alkyl”). In some embodiments, an alkyl group has 1 to 8 carbon atoms (“C1-8 alkyl”). In some embodiments, an alkyl group has 1 to 7 carbon atoms (“C1-7 alkyl”). In some embodiments, an alkyl group has 1 to 6 carbon atoms (“C1-6 alkyl”). In some embodiments, an alkyl group has 1 to 5 carbon atoms (“C1-5 alkyl”). In some embodiments, an alkyl group has 1 to 4 carbon atoms (“C1-4 alkyl”). In some embodiments, an alkyl group has 1 to 3 carbon atoms (“C1-3 alkyl”). In some embodiments, an alkyl group has 1 to 2 carbon atoms (“C1-2 alkyl”). In some embodiments, an alkyl group has 1 carbon atom (“C1 alkyl”). In some embodiments, an alkyl group has 2 to 6 carbon atoms (“C2-6 alkyl”). Examples of C1-6 alkyl groups include methyl (C1), ethyl (C2), propyl (C3) (e.g., n-propyl, isopropyl), butyl (C4) (e.g., n-butyl, tert-butyl, sec-butyl, iso-butyl), pentyl (C5) (e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butanyl, tertiary amyl), and hexyl (C6) (e.g., n-hexyl). Additional examples of alkyl groups include n-heptyl (C7), n-octyl (C8), and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an “unsubstituted alkyl”) or substituted (a “substituted alkyl”) with one or more substituents (e.g., halogen, such as F). In certain embodiments, the alkyl group is an unsubstituted C1-10 alkyl (such as unsubstituted C1-6 alkyl, e.g., —CH3). In certain embodiments, the alkyl group is a substituted C1-10 alkyl (such as substituted C1-6 alkyl, e.g., —CF3).
- “Alkenyl” refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon double bonds, and no triple bonds (“C2-20 alkenyl”). In some embodiments, an alkenyl group has 2 to 10 carbon atoms (“C2-10 alkenyl”). In some embodiments, an alkenyl group has 2 to 9 carbon atoms (“C2-9 alkenyl”). In some embodiments, an alkenyl group has 2 to 8 carbon atoms (“C2-8 alkenyl”). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (“C2-7 alkenyl”). In some embodiments, an alkenyl group has 2 to 6 carbon atoms (“C2-6 alkenyl”). In some embodiments, an alkenyl group has 2 to 5 carbon atoms (“C2-5 alkenyl”). In some embodiments, an alkenyl group has 2 to 4 carbon atoms (“C2-4 alkenyl”). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (“C2-3 alkenyl”). In some embodiments, an alkenyl group has 2 carbon atoms (“C2 alkenyl”). The one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl). Examples of C2-4 alkenyl groups include ethenyl (C2), 1-propenyl (C3), 2-propenyl (C3), 1-butenyl (C4), 2-butenyl (C4), butadienyl (C4), and the like. Examples of C2-6 alkenyl groups include the aforementioned C2-4 alkenyl groups as well as pentenyl (C5), pentadienyl (C5), hexenyl (C6), and the like. Additional examples of alkenyl include heptenyl (C7), octenyl (C8), octatrienyl (C8), and the like. Unless otherwise specified, each instance of an alkenyl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted alkenyl”) or substituted (a “substituted alkenyl”) with one or more substituents. In certain embodiments, the alkenyl group is unsubstituted C2-10 alkenyl. In certain embodiments, the alkenyl group is substituted C2-10 alkenyl. In an alkenyl group, a C═C double bond for which the stereochemistry is not specified (e.g., —CH═CHCH3 or)
- may be an (E)- or (Z)-double bond.
- “Alkynyl” refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 20 carbon atoms, one or more carbon-carbon triple bonds, and optionally one or more double bonds (“C2-20 alkynyl”). In some embodiments, an alkynyl group has 2 to 10 carbon atoms (“C2-10 alkynyl”). In some embodiments, an alkynyl group has 2 to 9 carbon atoms (“C2-9 alkynyl”). In some embodiments, an alkynyl group has 2 to 8 carbon atoms (“C2-8 alkynyl”). In some embodiments, an alkynyl group has 2 to 7 carbon atoms (“C2-7 alkynyl”). In some embodiments, an alkynyl group has 2 to 6 carbon atoms (“C2-6 alkynyl”). In some embodiments, an alkynyl group has 2 to 5 carbon atoms (“C2-5 alkynyl”). In some embodiments, an alkynyl group has 2 to 4 carbon atoms (“C2-4 alkynyl”). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (“C2-3 alkynyl”). In some embodiments, an alkynyl group has 2 carbon atoms (“C2 alkynyl”). The one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl). Examples of C2-4 alkynyl groups include, without limitation, ethynyl (C2), 1-propynyl (C3), 2-propynyl (C3), 1-butynyl (C4), 2-butynyl (C4), and the like. Examples of C2-6 alkenyl groups include the aforementioned C2-4 alkynyl groups as well as pentynyl (C5), hexynyl (C6), and the like. Additional examples of alkynyl include heptynyl (C7), octynyl (C8), and the like. Unless otherwise specified, each instance of an alkynyl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted alkynyl”) or substituted (a “substituted alkynyl”) with one or more substituents. In certain embodiments, the alkynyl group is unsubstituted C2-10 alkynyl. In certain embodiments, the alkynyl group is substituted C2-10 alkynyl.
- “Carbocyclyl” or “carbocyclic” refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms (“C3-10 carbocyclyl”) and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms (“C3-8 carbocyclyl”). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (“C3-6 carbocyclyl”). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (“C3-6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms (“C5-10 carbocyclyl”). Exemplary C3-6 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclopropenyl (C3), cyclobutyl (C4), cyclobutenyl (C4), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl (C6), cyclohexenyl (C6), cyclohexadienyl (C6), and the like. Exemplary C3-8 carbocyclyl groups include, without limitation, the aforementioned C3-6 carbocyclyl groups as well as cycloheptyl (C7), cycloheptenyl (C7), cycloheptadienyl (C7), cycloheptatrienyl (C7), cyclooctyl (C8), cyclooctenyl (C8), bicyclo[2.2.1]heptanyl (C7), bicyclo[2.2.2]octanyl (C8), and the like. Exemplary C3-10 carbocyclyl groups include, without limitation, the aforementioned C3-8 carbocyclyl groups as well as cyclononyl (C9), cyclononenyl (C9), cyclodecyl (C10), cyclodecenyl (C10), octahydro-1H-indenyl (C9), decahydronaphthalenyl (Cm), spiro[4.5]decanyl (Cm), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or contain a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) and can be saturated or can be partially unsaturated. “Carbocyclyl” also includes ring systems wherein the carbocyclic ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclic ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted carbocyclyl”) or substituted (a “substituted carbocyclyl”) with one or more substituents. In certain embodiments, the carbocyclyl group is unsubstituted C3-10 carbocyclyl. In certain embodiments, the carbocyclyl group is substituted C3-10 carbocyclyl.
- In some embodiments, “carbocyclyl” is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms (“C3-10 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms (“C3-8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms (“C3-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (“C5-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (“C5-10 cycloalkyl”). Examples of C5-6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5). Examples of C3-6 cycloalkyl groups include the aforementioned C5-6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C4). Examples of C3-8 cycloalkyl groups include the aforementioned C3-6 cycloalkyl groups as well as cycloheptyl (C7) and cyclooctyl (C8). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an “unsubstituted cycloalkyl”) or substituted (a “substituted cycloalkyl”) with one or more substituents. In certain embodiments, the cycloalkyl group is unsubstituted C3-10 cycloalkyl. In certain embodiments, the cycloalkyl group is substituted C3-10 cycloalkyl.
- “Heterocyclyl” or “heterocyclic” refers to a radical of a 3- to 10-membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon (“3-10 membered heterocyclyl”). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or a fused, bridged, or spiro ring system, such as a bicyclic system (“bicyclic heterocyclyl”), and can be saturated or can be partially unsaturated. Heterocyclyl bicyclic ring systems can include one or more heteroatoms in one or both rings. “Heterocyclyl” also includes ring systems wherein the heterocyclic ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclic ring, or ring systems wherein the heterocyclic ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclic ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclic ring system. Unless otherwise specified, each instance of heterocyclyl is independently optionally substituted, i.e., unsubstituted (an “unsubstituted heterocyclyl”) or substituted (a “substituted heterocyclyl”) with one or more substituents. In certain embodiments, the heterocyclyl group is unsubstituted 3-10 membered heterocyclyl. In certain embodiments, the heterocyclyl group is substituted 3-10 membered heterocyclyl.
- In some embodiments, a heterocyclyl group is a 5-10 membered, non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon (“5-10 membered heterocyclyl”). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-8 membered heterocyclyl”). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-6 membered heterocyclyl”). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has one ring heteroatom selected from nitrogen, oxygen, and sulfur.
- Exemplary 3-membered heterocyclyl groups containing one heteroatom include, without limitation, azirdinyl, oxiranyl, thiiranyl. Exemplary 4-membered heterocyclyl groups containing one heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl. Exemplary 5-membered heterocyclyl groups containing one heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary 5-membered heterocyclyl groups containing two heteroatoms include, without limitation, dioxolanyl, oxasulfuranyl, disulfuranyl, and oxazolidin-2-one. Exemplary 5-membered heterocyclyl groups containing three heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing one heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing two heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary 6-membered heterocyclyl groups containing two heteroatoms include, without limitation, triazinanyl. Exemplary 7-membered heterocyclyl groups containing one heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing one heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplary 5-membered heterocyclyl groups fused to a C6 aryl ring (also referred to herein as a 5,6-bicyclic heterocyclic ring) include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, benzoxazolinonyl, and the like. Exemplary 6-membered heterocyclyl groups fused to an aryl ring (also referred to herein as a 6,6-bicyclic heterocyclic ring) include, without limitation, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and the like.
- “Aryl” refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 pi electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system (“C6-14 aryl”). In some embodiments, an aryl group has six ring carbon atoms (“C6 aryl”; e.g., phenyl). In some embodiments, an aryl group has ten ring carbon atoms (“C10 aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has fourteen ring carbon atoms (“C14 aryl”; e.g., anthracyl). “Aryl” also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups, wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted aryl”) or substituted (a “substituted aryl”) with one or more substituents. In certain embodiments, the aryl group is unsubstituted C6-14 aryl. In certain embodiments, the aryl group is substituted C6-14 aryl.
- “Aralkyl” refers to an optionally substituted alkyl group substituted by an optionally substituted aryl group. In certain embodiments, the aralkyl is optionally substituted benzyl. In certain embodiments, the aralkyl is benzyl. In certain embodiments, the aralkyl is optionally substituted phenethyl. In certain embodiments, the aralkyl is phenethyl.
- “Heteroaryl” refers to a radical of a 5-10 membered, monocyclic or bicyclic 4n+2 aromatic ring system (e.g., having 6 or 10 pi electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-10 membered heteroaryl”). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl bicyclic ring systems can include one or more heteroatoms in one or both rings. “Heteroaryl” includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. “Heteroaryl” also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused (aryl/heteroaryl) ring system. Bicyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
- In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-10 membered heteroaryl”). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-8 membered heteroaryl”). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur (“5-6 membered heteroaryl”). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently optionally substituted, i.e., unsubstituted (an “unsubstituted heteroaryl”) or substituted (a “substituted heteroaryl”) with one or more substituents. In certain embodiments, the heteroaryl group is unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is substituted 5-14 membered heteroaryl.
- Exemplary 5-membered heteroaryl groups containing one heteroatom include, without limitation, pyrrolyl, furanyl, and thiophenyl. Exemplary 5-membered heteroaryl groups containing two heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing three heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl. Exemplary 5-membered heteroaryl groups containing four heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryl groups containing one heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryl groups containing two heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary 6-membered heteroaryl groups containing three or four heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing one heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6-bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
- “Heteroaralkyl” is a subset of alkyl and heteroaryl and refers to an optionally substituted alkyl group substituted by an optionally substituted heteroaryl group.
- “Unsaturated” or “partially unsaturated” refers to a group that includes at least one double or triple bond. A “partially unsaturated” ring system is further intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl groups). Likewise, “saturated” refers to a group that does not contain a double or triple bond, i.e., contains all single bonds.
- Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups, which are divalent linking groups, are further referred to using the suffix -ene, e.g., alkylene, alkenylene, alkynylene, carbocyclylene, heterocyclylene, arylene, and heteroarylene.
- An atom, moiety, or group described herein may be unsubstituted or substituted, as valency permits, unless otherwise provided expressly. The term “optionally substituted” refers to substituted or unsubstituted.
- A group is optionally substituted unless expressly provided otherwise. The term “optionally substituted” refers to being substituted or unsubstituted. In certain embodiments, alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups are optionally substituted (e.g., “substituted” or “unsubstituted” alkyl, “substituted” or “unsubstituted” alkenyl, “substituted” or “unsubstituted” alkynyl, “substituted” or “unsubstituted” carbocyclyl, “substituted” or “unsubstituted” heterocyclyl, “substituted” or “unsubstituted” aryl or “substituted” or “unsubstituted” heteroaryl group). In general, the term “substituted”, whether preceded by the term “optionally” or not, means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a “substituted” group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term “substituted” is contemplated to include substitution with all permissible substituents of organic compounds, any of the substituents described herein that results in the formation of a stable compound. The present disclosure contemplates any and all such combinations in order to arrive at a stable compound. For purposes of this disclosure, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety. In certain embodiments, the substituent is a carbon atom substituent. In certain embodiments, the substituent is a nitrogen atom substituent. In certain embodiments, the substituent is an oxygen atom substituent. In certain embodiments, the substituent is a sulfur atom substituent.
- Exemplary carbon atom substituents include, but are not limited to, halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORaa, —ON(Rbb)2, N(Rbb)2, —N(Rbb)3 +X−, —N(ORcc)Rbb, —SH, —SRaa, —SSRcc, —C(═O)Raa, —CO2H, —CHO, —C(ORcc)2, —CO2Raa, —OC(═O)Raa, —OCO2Raa, —C(═O)N(Rbb)2, —OC(═O)N(Rbb)2, —NRbbC(═O)Raa, —NRbbCO2Raa, —NRbbC(═O)N(Rbb)2, —C(═NRbb)Raa, —C(═NRbb)ORaa, —OC(═NRbb)Raa, —OC(═NRbb)ORaa, —C(═NRbb)N(Rbb)2, —OC(═NRbb)N(Rbb)2, NRbbc (—NRbb)N(Rbb)2, C(═O)NRbbSO2Raa, —NRbbSO2Raa, —SO2N(Rbb)2, —SO2Raa, —SO2ORaa, —OSO2Raa, —S(═O)Raa, —OS(═O)Raa, —Si(Raa)3, —OSi(Raa)3, —C(═S)N(Rbb)2, —C(═O)SRaa, —C(═S)SRaa, —SC(═S)SRaa, —SC(═O)SRaa, —OC(═O)SRaa, —SC(═O)ORaa, —SC(═O)Raa, —P(═O)(Raa)2, —P(═O)(ORcc)2, —OP(═O)(Raa)2, —OP(═O)(ORcc)2, —P(═O)(N(Rbb)2)2, —OP(═O)(N(Rbb)2)2, NRbbP(═O)(Raa)2, —NRbbP(═O)(ORcc)2, —NRbbP(═O)(N(Rbb)2)2, —P(Rcc)2, —P(ORcc)2, —P(Rcc)3 +X−, —P(ORcc)3 +X−, —P(Rcc)4, —P(ORcc)4, —OP(Rcc)2, —OP(Rcc)3 +X−, —OP(ORcc)2, —OP(ORcc)3 +X−, —OP(Rcc)4, —OP(ORcc)4, —B(Raa)2, —B(ORcc)2, —BRaa(ORcc), C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups; wherein X− is a counterion;
- or two geminal hydrogens on a carbon atom are replaced with the group ═O, ═S, ═NN(Rbb)2, ═NNRbbC(═O)Raa, ═NNRbbC(═O)ORaa, ═NNRbbS(═O)2Raa, ═NRbb, or ═NORcc;
- each instance of Raa is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Raa groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
- each instance of Rbb is, independently, selected from hydrogen, —OH, —ORaa, —N(Rcc)2, —CN, —C(═O)Raa, —C(═O)N(Rcc)2, —CO2Raa, —SO2Raa, —C(═NRcc)ORaa, —C(═NRcc)N(Rcc)2, —SO2N(Rcc)2, —SO2Rcc, —SO2ORcc, —SORaa, —C(═S)N(Rcc)2, —C(═O)SRcc, —C(═S)SRcc, —P(═O)(Raa)2, —P(═O)(ORcc)2, —P(═O)(N(Rcc)2)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rbb groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups; wherein X− is a counterion;
- each instance of Rcc is, independently, selected from hydrogen, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rcc groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
- each instance of Rdd is, independently, selected from halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORee, —ON(Rff)2, —N(Rff)2, —N(Rff)3 +X−, —N(ORee)Rff, —SH, —SRee, —SSRee, —C(═O)Ree, —CO2H, —CO2Ree, —OC(═O)Ree, —OCO2Ree, —C(═O)N(Rff)2, —OC(═O)N(Rff)2, —NRffC(═O)Ree, —NRffCO2Ree, —NRffC(═O)N(Rff)2, —C(═NRff)ORee, —OC(═NRff)Ree, —OC(═NRff)ORee, —C(═NRff)N(Rff)2, —OC(═NRff)N(Rff)2, —NRffC(═NRff)N(Rff)2, —NRffSO2Ree, —SO2N(Rff)2, —SO2Ree, —SO2ORee, —OSO2Ree, —S(═O)Ree, —Si(Ree)3, —OSi(Ree)3, —C(═S)N(Rff)2, —C(═O)SRee, —C(═S)SRee, —SC(═S)SRee, —P(═O)(ORee)2, —P(═O)(Ree)2, —OP(═O)(Ree)2, —OP(═O)(ORee)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups, or two geminal Rdd substituents can be joined to form ═O or ═S; wherein X− is a counterion;
- each instance of Ree is, independently, selected from C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups;
- each instance of Rff is, independently, selected from hydrogen, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl and 5-10 membered heteroaryl, or two Rff groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups; and
- each instance of Rgg is, independently, halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OC1-6 alkyl, —ON(C1-6 alkyl)2, —N(C1-6 alkyl)2, —N(C1-6 alkyl)3 +X−, —NH(C1-6 alkyl)2 +X−, —NH2(C1-6 alkyl)+X−, —NH3 +X−, —N(OC1-6 alkyl)(C1-6 alkyl), —N(OH)(C1-6 alkyl), —NH(OH), —SH, —SC1-6 alkyl, —SS(C1-6 alkyl), —C(═O)(C1-6 alkyl), —CO2H, —CO2(C1-6 alkyl), —OC(═O)(C1-6 alkyl), —OCO2(C1-6 alkyl), —C(═O)NH2, —C(═O)N(C1-6 alkyl), —OC(═O)NH(C1-6 alkyl), —NHC(═O)(C1-6 alkyl), —N(C1-6 alkyl)C(═O)(C1-6 alkyl), —NHCO2(C1-6 alkyl), —NHC(═O)N(C1-6 alkyl)2, —NHC(═O)NH(C1-6 alkyl), —NHC(═O)NH2, —C(═NH)O(C1-6 alkyl), —OC(═NH)(C1-6 alkyl), —OC(═NH)OC1-6 alkyl, —C(═NH)N(C1-6 alkyl), —C(═NH)NH(C1-6 alkyl), —C(═NH)NH2, —OC(═NH)N(C1-6 alkyl)2, —OC(NH)NH(C1-6 alkyl), —OC(NH)NH2, —NHC(NH)N(C1-6 alkyl)2, —NHC(═NH)NH2, —NHSO2(C1-6 alkyl), —SO2N(C1-6 alkyl)2, —SO2NH(C1-6 alkyl), —SO2NH2, —SO2C1-6 alkyl, —SO2OC1-6 alkyl, —OSO2C1-6 alkyl, —SOC1-6 alkyl, —Si(C1-6 alkyl), —OSi(C1-6 alkyl)3-C(═S)N(C1-6 alkyl)2, C(═S)NH(C1-6 alkyl), C(═S)NH2, —C(═O)S(C1-6 alkyl), —C(═S)SC1-6 alkyl, —SC(═S)SC1-6 alkyl, —P(═O)2(C1-6 alkyl), —P(═O)(C1-6 alkyl), —OP(═O)(C1-6 alkyl)2, —OP(═O)(OC1-6 alkyl)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two geminal Rgg substituents can be joined to form ═O or ═S; wherein X− is a counterion.
- A “counterion” or “anionic counterion” is a negatively charged group associated with a cationic quaternary amino group in order to maintain electronic neutrality. An anionic counterion may be monovalent (i.e., including one formal negative charge). An anionic counterion may also be multivalent (i.e., including more than one formal negative charge), such as divalent or trivalent. Exemplary counterions include halide ions (e.g., F−, Cl−, Br−, I−), NO3 −, ClO4 −, OH−, H2PO4 −, HCO3 −, HSO4 −, sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate, ethan-1-sulfonic acid-2-sulfonate, and the like), carboxylate ions (e.g., acetate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, gluconate, and the like), BF4 −, PF4 −, PF6 −, AsF6 −, SbF6 −, B[3,5-(CF3)2C6H3]4]−, B(C6F5)4 −, BPh4 −, Al(OC(CF3)3)4 −, and carborane anions (e.g., CB11H12 − or (HCB11Me5Br6)−). Exemplary counterions which may be multivalent include CO3 2−, HPO4 2−, PO4 3−, B4O7 2−, SO4 2−, S2O3 2−, carboxylate anions (e.g., tartrate, citrate, fumarate, maleate, malate, malonate, gluconate, succinate, glutarate, adipate, pimelate, suberate, azelate, sebacate, salicylate, phthalates, aspartate, glutamate, and the like), and carboranes.
- “Halo” or “halogen” refers to fluorine (fluoro, —F), chlorine (chloro, —Cl), bromine (bromo, —Br), or iodine (iodo, —I).
- “Acyl” refers to a moiety selected from the group consisting of —C(═O)Raa, —CHO, —CO2Raa, —C(═O)N(Rbb)2, —C(═NRbb)Raa, —C(═NRbb)ORaa, —C(═NRbb)N(Rbb)2, —C(═O)NRbbSO2Raa, —C(═S)N(Rbb)2, —C(═O)SRaa, or —C(═S)SRaa, wherein Raa and Rbb are as defined herein.
- Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quaternary nitrogen atoms. Exemplary nitrogen atom substituents include, but are not limited to, hydrogen, —OH, —ORaa, —N(Rcc)2, —CN, —C(═O)Raa, —C(═O)N(Rcc)2, —CO2Raa, —SO2Raa, —C(═NRbb)Raa, —C(═NRcc)ORaa, —C(═NRcc)N(Rcc)2, —SO2N(Rcc)2, —SO2Rcc, —SO2ORcc, —SORaa, —C(═S)N(Rcc)2, —C(═O)SRcc, —C(═S)SRcc, —P(═O) (ORcc)2, —P(═O)(Raa)2, —P(═O)(N(Rcc)2)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rcc groups attached to a nitrogen atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc, and Rdd are as defined above.
- In certain embodiments, the substituent present on a nitrogen atom is a nitrogen protecting group (also referred to as an amino protecting group). Nitrogen protecting groups include, but are not limited to, —OH, —ORaa, —N(Rcc)2, —C(═O)Raa, —C(═O)N(Rcc)2, —CO2Raa, —SO2Raa, —C(═NRcc)Raa, —C(═NRcc)ORaa, —C(═NRcc)N(Rcc)2, —SO2N(Rcc)2, —SO2Rcc, —SO2ORcc, —SORaa, —C(═S)N(Rcc)2, —C(═O)SRcc, —C(═S)SRcc, C1-10 alkyl (e.g., aralkyl, heteroaralkyl), C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc and Rdd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
- For example, nitrogen protecting groups such as amide groups (e.g., —C(═O)Raa) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, p-phenylbenzamide, o-nitrophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N′ dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine derivative, o-nitrobenzamide, and o-(benzoyloxymethyl)benzamide.
- Nitrogen protecting groups such as carbamate groups (e.g., —C(═O)ORaa) include, but are not limited to, methyl carbamate, ethyl carbamate, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluorenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-(1-adamantyl)-1-methylethyl carbamate (Adpoc), 1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc), 1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2′- and 4′-pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate (BOC or Boc), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), p-nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(1,3-dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate, t-amyl carbamate, S-benzyl thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate, 1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate, 1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p′-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1-methyl-1-cyclopropylmethyl carbamate, 1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate, 1-methyl-1-(p-phenylazophenyl)ethyl carbamate, 1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate, 2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6-trimethylbenzyl carbamate.
- Nitrogen protecting groups such as sulfonamide groups (e.g., —S(═O)2Raa) include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), β-trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4′,8′-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS), benzylsulfonamide, trifluoromethylsulfonamide, and phenacylsulfonamide.
- Other nitrogen protecting groups include, but are not limited to, phenothiazinyl-(10)-acyl derivative, N′-p-toluenesulfonylaminoacyl derivative, N′-phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2-(trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(1-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr), N-9-phenylfluorenylamine (PhF), N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino (Fcm), N-2-picolylamino N′-oxide, N-1,1-dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine, N—(N′,N′-dimethylaminomethylene)amine, N,N′-isopropylidenediamine, N-p-nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N-[phenyl(pentaacylchromium- or tungsten)acyl]amine, N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide, triphenylmethylsulfenamide, and 3-nitropyridinesulfenamide (Npys).
- Exemplary oxygen atom substituents include, but are not limited to, —Raa, —C(═O)SRaa, —C(═O)Raa, —CO2Raa, —C(═O)N(Rbb)2, —C(═NRbb)Raa, —C(═NRbb)ORaa, —C(═NRbb)N(Rbb)2, —S(═O)Raa, —SO2Raa, —Si(Raa)3, —P(Rcc)2, —P(Rcc)3 +X−, —P(ORcc)2, —P(ORcc)3 +X−, —P(═O)(Raa)2, —P(═O)(ORcc)2, and —P(═O)(N(Rbb)2)2, wherein X−, Raa, Rbb, and Rcc are as defined herein. In certain embodiments, the oxygen atom substituent present on an oxygen atom is an oxygen protecting group (also referred to as a hydroxyl protecting group). Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference. Exemplary oxygen protecting groups include, but are not limited to, methyl, t-butyloxycarbonyl (BOC or Boc), methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2-methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl S,S-dioxide, 1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl (CTMP), 1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl, 1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl, 1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl, p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), p-methoxybenzyl, 3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl, 4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl, p,p′-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, α-naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl, di(p-methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl, 4-(4′-bromophenacyloxyphenyl)diphenylmethyl, 4,4′,4″-tris(4,5-dichlorophthalimidophenyl)methyl, 4,4′,4″-tris(levulinoyloxyphenyl)methyl, 4,4′,4″-tris(benzoyloxyphenyl)methyl, 3-(imidazol-1-yl)bis(4′,4″-dimethoxyphenyl)methyl, 1,1-bis(4-methoxyphenyl)-1′-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl, 1,3-benzodisulfuran-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS), t-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl, triphenylsilyl, diphenylmethylsilyl (DPMS), t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate (levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, p-phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), alkyl methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl 2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec), 2-(triphenylphosphonio) ethyl carbonate (Peoc), alkyl isobutyl carbonate, alkyl vinyl carbonate alkyl allyl carbonate, alkyl p-nitrophenyl carbonate, alkyl benzyl carbonate, alkyl p-methoxybenzyl carbonate, alkyl 3,4-dimethoxybenzyl carbonate, alkyl o-nitrobenzyl carbonate, alkyl p-nitrobenzyl carbonate, alkyl S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4-methylphenoxyacetate, 2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate, 2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, a-naphthoate, nitrate, alkyl N,N,N′,N′-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
- Exemplary sulfur atom substituents include, but are not limited to, —Raa, —C(═O)SRaa, —C(═O)Raa, —CO2Raa, —C(═O)N(Rbb)2, —C(═NRbb)Raa, —C(═NRbb)ORaa, —C(═NRbb)N(Rbb)2, —S(═O)Raa, —SO2Raa, —Si(Raa)3, —P(Rcc)2, —P(Rcc)3 +X−, —P(ORcc)2, —P(ORcc)3 +X−, —P(═O)(Raa)2, —P(═O)(ORcc)2, and —P(═O)(N(Rbb)2)2, wherein Raa, Rbb, and Rcc are as defined herein. In certain embodiments, the sulfur atom substituent present on a sulfur atom is a sulfur protecting group (also referred to as a thiol protecting group). Sulfur protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
- A “hydrocarbon chain” refers to a substituted or unsubstituted divalent alkyl, alkenyl, or alkynyl group. A hydrocarbon chain includes (1) one or more chains of carbon atoms immediately between the two radicals of the hydrocarbon chain; (2) optionally one or more hydrogen atoms on the chain(s) of carbon atoms; and (3) optionally one or more substituents (“non-chain substituents,” which are not hydrogen) on the chain(s) of carbon atoms. A chain of carbon atoms consists of consecutively connected carbon atoms (“chain atoms” or “carbon units”) and does not include hydrogen atoms or heteroatoms. However, a non-chain substituent of a hydrocarbon chain may include any atoms, including hydrogen atoms, carbon atoms, and heteroatoms. For example, hydrocarbon chain —CAH(CBH2CCH3)— includes one chain atom CA, one hydrogen atom on CA, and non-chain substituent —(CBH2CCH3). The term “Cx hydrocarbon chain,” wherein x is a positive integer, refers to a hydrocarbon chain that includes x number of chain atom(s) between the two radicals of the hydrocarbon chain. If there is more than one possible value of x, the smallest possible value of x is used for the definition of the hydrocarbon chain. For example, —CH(C2H5)— is a C1 hydrocarbon chain, and
- is a C3 hydrocarbon chain. When a range of values is used, the meaning of the range is as described herein. For example, a C3-10 hydrocarbon chain refers to a hydrocarbon chain where the number of chain atoms of the shortest chain of carbon atoms immediately between the two radicals of the hydrocarbon chain is 3, 4, 5, 6, 7, 8, 9, or 10. A hydrocarbon chain may be saturated (e.g., —(CH2)4—). A hydrocarbon chain may also be unsaturated and include one or more C═C and/or C≡C bonds anywhere in the hydrocarbon chain. For instance, —CH═CH—(CH2)2—, —CH2—C≡C—CH2—, and —C≡C—CH═CH— are all examples of a unsubstituted and unsaturated hydrocarbon chain. In certain embodiments, the hydrocarbon chain is unsubstituted (e.g., —C≡C— or —(CH2)4—). In certain embodiments, the hydrocarbon chain is substituted (e.g., —CH(C2H5)— and —CF2—). Any two substituents on the hydrocarbon chain may be joined to form an optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl ring. For instance,
- are all examples of a hydrocarbon chain. In contrast, in certain embodiments,
- are not within the scope of the hydrocarbon chains described herein. When a chain atom of a Cx hydrocarbon chain is replaced with a heteroatom, the resulting group is referred to as a Cx hydrocarbon chain wherein a chain atom is replaced with a heteroatom, as opposed to a Cx-1 hydrocarbon chain. For example,
- is a C3 hydrocarbon chain wherein one chain atom is replaced with an oxygen atom.
- The term “leaving group” is given its ordinary meaning in the art of synthetic organic chemistry and refers to an atom or a group capable of being displaced by a nucleophile. See, for example, Smith, March Advanced Organic Chemistry 6th ed. (501-502). Examples of suitable leaving groups include, but are not limited to, halogen (such as F, Cl, Br, or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy, methoxy, N,O-dimethylhydroxylamino, pixyl, and haloformates. Exemplary leaving groups include, but are not limited to, activated substituted hydroxyl groups (e.g., —OC(═O)SRaa, —OC(═O)Raa, —OCO2Raa, —OC(═O)N(Rbb)2, —OC(═NRbb)Raa, —OC(═NRbb)ORaa, —OC(═NRbb)N(Rbb)2, —OS(═O)Raa, —OSO2Raa, —OP(Rcc)2, —OP(Rcc)3, —OP(═O)2Raa, —OP(═O)(Raa)2, —OP(═O)(ORcc)2, —OP(═O)2N(Rbb)2, and —OP(═O)(NRbb)2, wherein Raa, Rbb, and Rcc are as defined herein). In some cases, the leaving group is a sulfonic acid ester, such as toluenesulfonate (tosylate, —OTs), methanesulfonate (mesylate, —OMs), p-bromobenzenesulfonyloxy (brosylate, —OBs), —OS(═O)2(CF2)3CF3 (nonaflate, —ONf), or trifluoromethanesulfonate (triflate, —OTf). In some cases, the leaving group is a brosylate, such as p-bromobenzenesulfonyloxy. In some cases, the leaving group is a nosylate, such as 2-nitrobenzenesulfonyloxy. The leaving group may also be a phosphineoxide (e.g., formed during a Mitsunobu reaction) or an internal leaving group such as an epoxide or cyclic sulfate. Other non-limiting examples of leaving groups are water, ammonia, alcohols, ether moieties, thioether moieties, zinc halides, magnesium moieties, diazonium salts, and copper moieties.
- The term “pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response, and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, Berge et al. describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, incorporated herein by reference. Pharmaceutically acceptable salts of the compounds described herein include those derived from suitable inorganic and organic acids and bases. Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid, and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid, or malonic acid or by using other methods known in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N+(C1-4 alkyl)4 − salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
- The term “solvate” refers to forms of the compound that are associated with a solvent, usually by a solvolysis reaction. This physical association may include hydrogen bonding. Conventional solvents include water, methanol, ethanol, acetic acid, DMSO, THF, diethyl ether, and the like. The compounds described herein may be prepared, e.g., in crystalline form, and may be solvated. Suitable solvates include pharmaceutically acceptable solvates and further include both stoichiometric solvates and non-stoichiometric solvates. In certain instances, the solvate will be capable of isolation, for example, when one or more solvent molecules are incorporated in the crystal lattice of a crystalline solid. “Solvate” encompasses both solution-phase and isolatable solvates. Representative solvates include hydrates, ethanolates, and methanolates.
- The term “hydrate” refers to a compound that is associated with water. Typically, the number of the water molecules contained in a hydrate of a compound is in a definite ratio to the number of the compound molecules in the hydrate. Therefore, a hydrate of a compound may be represented, for example, by the general formula R.x H2O, wherein R is the compound, and x is a number greater than 0. A given compound may form more than one type of hydrate, including, e.g., monohydrates (x is 1), lower hydrates (x is a number greater than 0 and smaller than 1, e.g., hemihydrates (R.0.5 H2O)), and polyhydrates (x is a number greater than 1, e.g., dihydrates (R.2 H2O) and hexahydrates (R.6 H2O)).
- The term “tautomers” or “tautomeric” refers to two or more interconvertible compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base. Exemplary tautomerizations include keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine, and enamine-to-(a different enamine) tautomerizations.
- It is also to be understood that compounds that have the same molecular formula but differ in the nature or sequence of bonding of their atoms or the arrangement of their atoms in space are termed “isomers”. Isomers that differ in the arrangement of their atoms in space are termed “stereoisomers”.
- Stereoisomers that are not mirror images of one another are termed “diastereomers” and those that are non-superimposable mirror images of each other are termed “enantiomers”. When a compound has an asymmetric center, for example, it is bonded to four different groups, a pair of enantiomers is possible. An enantiomer can be characterized by the absolute configuration of its asymmetric center and is described by the R- and S-sequencing rules of Cahn and Prelog, or by the manner in which the molecule rotates the plane of polarized light and designated as dextrorotatory or levorotatory (i.e., as (+) or (−)-isomers respectively). A chiral compound can exist as either individual enantiomer or as a mixture thereof. A mixture containing equal proportions of the enantiomers is called a “racemic mixture”.
- The term “polymorphs” refers to a crystalline form of a compound (or a salt, hydrate, or solvate thereof) in a particular crystal packing arrangement. All polymorphs have the same elemental composition. Different crystalline forms usually have different X-ray diffraction patterns, infrared spectra, melting points, density, hardness, crystal shape, optical and electrical properties, stability, and solubility. Recrystallization solvent, rate of crystallization, storage temperature, and other factors may cause one crystal form to dominate. Various polymorphs of a compound can be prepared by crystallization under different conditions.
- The term “co-crystal” refers to a crystalline structure composed of at least two components. In certain embodiments, a co-crystal may contain a compound of the present invention and one or more other component, including but not limited to, atoms, ions, molecules, or solvent molecules. In certain embodiments, a co-crystal may contain a compound of the present invention and one or more components related to said compound, including not limited to, an isomer, tautomer, salt, solvate, hydrate, synthetic precursor, synthetic derivative, fragment or impurity of said compound.
- The term “isotopically labeled derivative” or “isotopically labeled” refers to a compound wherein one or more atoms in the compound (or in an associated ion or molecule of a salt, hydrate, or solvate) has been replaced with an isotope of the same element. For the given element or position in the molecule the isotope will be enriched, or present in a higher percentage of all atoms of the element or of all atoms at the position in the molecule in a sample, relative to an unlabeled variant. In certain embodiments, the enriched isotope will be a stable isotope. In certain embodiments, the enriched isotope will be an unstable or radioactive isotope (e.g., a radionuclide). In certain embodiments, the enriched isotope may be detected by a measurement technique, including but not limited to nuclear magnetic resonance, mass spectrometry, infrared spectroscopy, or a technique that measures radioactive decay.
- The term “prodrugs” refers to compounds that have cleavable groups and become by solvolysis or under physiological conditions the compounds described herein, which are pharmaceutically active in vivo. Such examples include, but are not limited to, choline ester derivatives and the like, N-alkylmorpholine esters and the like. Other derivatives of the compounds described herein have activity in both their acid and acid derivative forms, but in the acid sensitive form often offer advantages of solubility, tissue compatibility, or delayed release in the mammalian organism (see, Bundgard, H., Design of Prodrugs, pp. 7-9, 21-24, Elsevier, Amsterdam 1985). Prodrugs include acid derivatives well known to practitioners of the art, such as, for example, esters prepared by reaction of the parent acid with a suitable alcohol, or amides prepared by reaction of the parent acid compound with a substituted or unsubstituted amine, or acid anhydrides, or mixed anhydrides. Simple aliphatic or aromatic esters, amides, and anhydrides derived from acidic groups pendant on the compounds described herein are particular prodrugs. In some cases it is desirable to prepare double ester type prodrugs such as (acyloxy)alkyl esters or ((alkoxycarbonyl)oxy)alkylesters. C1-C8 alkyl, C2-C8alkenyl, C2-C8alkynyl, aryl, C7-C12 substituted aryl, and C7-C12 arylalkyl esters of the compounds described herein may be preferred.
- The term “inhibition”, “inhibiting”, “inhibit,” or “inhibitor” refer to the ability of a compound to reduce, slow, halt or prevent activity of a particular biological process (e.g., activity of a bromodomain and/or a bromodomain-containing protein) in a cell relative to vehicle.
- When a compound, pharmaceutical composition, method, use, or kit is referred to as “selectively,” “specifically,” or “competitively” binding a first protein or a first chromatin, the compound, pharmaceutical composition, method, use, or kit binds the first protein or the first chromatin with a higher binding affinity (e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold) than binding a second protein or second chromatin that is different from the first protein and the first chromatin. When a compound, pharmaceutical composition, method, use, or kit is referred to as “selectively,” “specifically,” or “competitively” modulating (e.g., increasing or inhibiting) the activity of a bromodomain-containing protein, the compound, pharmaceutical composition, method, use, or kit modulates the activity of the bromodomain-containing protein to a greater extent (e.g., not less than about 2-fold, not less than about 5-fold, not less than about 10-fold, not less than about 30-fold, not less than about 100-fold, not less than about 1,000-fold, or not less than about 10,000-fold) than the activity of at least one protein that is different from the bromodomain-containing protein.
- The term “aberrant activity” refers to activity deviating from normal activity, that is, abnormal activity. The term “increased activity” refers to activity higher than normal activity.
- The terms “composition” and “formulation” are used interchangeably.
- A “subject” to which administration is contemplated refers to a human (i.e., male or female of any age group, e.g., pediatric subject (e.g., infant, child, or adolescent) or adult subject (e.g., young adult, middle-aged adult, or senior adult)) or non-human animal. In certain embodiments, the non-human animal is a mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey), commercially relevant mammal (e.g., cattle, pig, horse, sheep, goat, cat, or dog), or bird (e.g., commercially relevant bird, such as chicken, duck, goose, or turkey)). In certain embodiments, the non-human animal is a fish, reptile, or amphibian. The non-human animal may be a male or female at any stage of development. The non-human animal may be a transgenic animal or genetically engineered animal. A “patient” refers to a human subject in need of treatment of a disease. The subject may also be a plant. In certain embodiments, the plant is a land plant. In certain embodiments, the plant is a non-vascular land plant. In certain embodiments, the plant is a vascular land plant. In certain embodiments, the plant is a seed plant. In certain embodiments, the plant is a cultivated plant. In certain embodiments, the plant is a dicot. In certain embodiments, the plant is a monocot. In certain embodiments, the plant is a flowering plant. In some embodiments, the plant is a cereal plant, e.g., maize, corn, wheat, rice, oat, barley, rye, or millet. In some embodiments, the plant is a legume, e.g., a bean plant, e.g., soybean plant. In some embodiments, the plant is a tree or shrub.
- The term “biological sample” refers to any sample including tissue samples (such as tissue sections and needle biopsies of a tissue); cell samples (e.g., cytological smears (such as Pap or blood smears) or samples of cells obtained by microdissection); samples of whole organisms (such as samples of yeasts or bacteria); or cell fractions, fragments or organelles (such as obtained by lysing cells and separating the components thereof by centrifugation or otherwise). Other examples of biological samples include blood, serum, urine, semen, fecal matter, cerebrospinal fluid, interstitial fluid, mucous, tears, sweat, pus, biopsied tissue (e.g., obtained by a surgical biopsy or needle biopsy), nipple aspirates, milk, vaginal fluid, saliva, swabs (such as buccal swabs), or any material containing biomolecules that is derived from another biological sample.
- The terms “administer,” “administering,” or “administration” refers to implanting, absorbing, ingesting, injecting, inhaling, or otherwise introducing a compound described herein, or a composition thereof, into, in, or on a subject.
- The terms “treatment,” “treat,” and “treating” refer to reversing, alleviating, delaying the onset of, or inhibiting the progress of a disease described herein. In some embodiments, treatment may be administered after one or more signs or symptoms of the disease have developed or have been observed. In other embodiments, treatment may be administered in the absence of signs or symptoms of the disease. For example, treatment may be administered to a susceptible subject prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of exposure to a pathogen). Treatment may also be continued after symptoms have resolved, for example, to delay or prevent recurrence.
- The terms “condition,” “disease,” and “disorder” are used interchangeably.
- An “effective amount” of a compound described herein refers to an amount sufficient to elicit the desired biological response, i.e., treating the condition. As will be appreciated by those of ordinary skill in this art, the effective amount of a compound described herein may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the condition being treated, the mode of administration, and the age and health of the subject. In certain embodiments, an effective amount is a therapeutically effective amount. In certain embodiments, an effective amount is a prophylactic treatment. In certain embodiments, an effective amount is the amount of a compound described herein in a single dose. In certain embodiments, an effective amount is the combined amounts of a compound described herein in multiple doses.
- A “therapeutically effective amount” of a compound described herein is an amount sufficient to provide a therapeutic benefit in the treatment of a condition or to delay or minimize one or more symptoms associated with the condition. A therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment of the condition. The term “therapeutically effective amount” can encompass an amount that improves overall therapy, reduces or avoids symptoms, signs, or causes of the condition, and/or enhances the therapeutic efficacy of another therapeutic agent.
- A “prophylactically effective amount” of a compound described herein is an amount sufficient to prevent a condition, or one or more symptoms associated with the condition or prevent its recurrence. A prophylactically effective amount of a compound means an amount of a therapeutic agent, alone or in combination with other agents, which provides a prophylactic benefit in the prevention of the condition. The term “prophylactically effective amount” can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
- A “proliferative disease” refers to a disease that occurs due to abnormal growth or extension by the multiplication of cells (Walker, Cambridge Dictionary of Biology; Cambridge University Press: Cambridge, UK, 1990). A proliferative disease may be associated with: 1) the pathological proliferation of normally quiescent cells; 2) the pathological migration of cells from their normal location (e.g., metastasis of neoplastic cells); 3) the pathological expression of proteolytic enzymes such as the matrix metalloproteinases (e.g., collagenases, gelatinases, and elastases); or 4) the pathological angiogenesis as in proliferative retinopathy and tumor metastasis. Exemplary proliferative diseases include cancers (i.e., “malignant neoplasms”), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, and autoimmune diseases.
- The term “angiogenesis” refers to the physiological process through which new blood vessels form from pre-existing vessels. Angiogenesis is distinct from vasculogenesis, which is the de novo formation of endothelial cells from mesoderm cell precursors. The first vessels in a developing embryo form through vasculogenesis, after which angiogenesis is responsible for most blood vessel growth during normal or abnormal development. Angiogenesis is a vital process in growth and development, as well as in wound healing and in the formation of granulation tissue. However, angiogenesis is also a fundamental step in the transition of tumors from a benign state to a malignant one, leading to the use of angiogenesis inhibitors in the treatment of cancer. Angiogenesis may be chemically stimulated by angiogenic proteins, such as growth factors (e.g., VEGF). “Pathological angiogenesis” refers to abnormal (e.g., excessive or insufficient) angiogenesis that amounts to and/or is associated with a disease.
- The terms “neoplasm” and “tumor” are used herein interchangeably and refer to an abnormal mass of tissue wherein the growth of the mass surpasses and is not coordinated as in the growth of normal tissue. A neoplasm or tumor may be “benign” or “malignant,” depending on the following characteristics: degree of cellular differentiation (including morphology and functionality), rate of growth, local invasion, and metastasis. A “benign neoplasm” is generally well differentiated, has characteristically slower growth than a malignant neoplasm, and remains localized to the site of origin. In addition, a benign neoplasm does not have the capacity to infiltrate, invade, or metastasize to distant sites. Exemplary benign neoplasms include, but are not limited to, lipoma, chondroma, adenomas, acrochordon, senile angiomas, seborrheic keratoses, lentigos, and sebaceous hyperplasias. In some cases, certain “benign” tumors may later give rise to malignant neoplasms, which may result from additional genetic changes in a subpopulation of the tumor's neoplastic cells, and these tumors are referred to as “pre-malignant neoplasms.” An exemplary pre-malignant neoplasm is a teratoma. In contrast, a “malignant neoplasm” is generally poorly differentiated (anaplasia) and has characteristically rapid growth accompanied by progressive infiltration, invasion, and destruction of the surrounding tissue. Furthermore, a malignant neoplasm generally has the capacity to metastasize to distant sites. The term “metastasis,” “metastatic,” or “metastasize” refers to the spread or migration of cancerous cells from a primary or original tumor to another organ or tissue and is typically identifiable by the presence of a “secondary tumor” or “secondary cell mass” of the tissue type of the primary or original tumor and not of that of the organ or tissue in which the secondary (metastatic) tumor is located. For example, a prostate cancer that has migrated to bone is said to be metastasized prostate cancer and includes cancerous prostate cancer cells growing in bone tissue.
- The term “cancer” refers to a class of diseases characterized by the development of abnormal cells that proliferate uncontrollably and have the ability to infiltrate and destroy normal body tissues. See, e.g., Stedman's Medical Dictionary, 25th ed.; Hensyl ed.; Williams & Wilkins: Philadelphia, 1990. Exemplary cancers include, but are not limited to, hematological malignancies. Additional exemplary cancers include, but are not limited to, acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal cancer; angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer; benign monoclonal gammopathy; biliary cancer (e.g., cholangiocarcinoma); bladder cancer; breast cancer (e.g., adenocarcinoma of the breast, papillary carcinoma of the breast, mammary cancer, medullary carcinoma of the breast, triple negative breast cancer (TNBC)); brain cancer (e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma, oligodendroglioma), medulloblastoma); bronchus cancer; carcinoid tumor; cervical cancer (e.g., cervical adenocarcinoma); choriocarcinoma; chordoma; craniopharyngioma; colorectal cancer (e.g., colon cancer, rectal cancer, colorectal adenocarcinoma); connective tissue cancer; epithelial carcinoma; ependymoma; endotheliosarcoma (e.g., Kaposi's sarcoma, multiple idiopathic hemorrhagic sarcoma); endometrial cancer (e.g., uterine cancer, uterine sarcoma); esophageal cancer (e.g., adenocarcinoma of the esophagus, Barrett's adenocarcinoma); Ewing's sarcoma; ocular cancer (e.g., intraocular melanoma, retinoblastoma); familiar hypereosinophilia; gall bladder cancer; gastric cancer (e.g., stomach adenocarcinoma); gastrointestinal stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g., head and neck squamous cell carcinoma, oral cancer (e.g., oral squamous cell carcinoma), throat cancer (e.g., laryngeal cancer, pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer)); heavy chain disease (e.g., alpha chain disease, gamma chain disease, mu chain disease; hemangioblastoma; hypopharynx cancer; inflammatory myofibroblastic tumors; immunocytic amyloidosis; kidney cancer (e.g., nephroblastoma a.k.a. Wilms' tumor, renal cell carcinoma); liver cancer (e.g., hepatocellular cancer (HCC), malignant hepatoma); lung cancer (e.g., bronchogenic carcinoma, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung); leiomyosarcoma (LMS); mastocytosis (e.g., systemic mastocytosis); muscle cancer; myelodysplastic syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD) (e.g., polycythemia vera (PV), essential thrombocytosis (ET), agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF), chronic idiopathic myelofibrosis, chronic myelocytic leukemia (CML), chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome (HES)); neuroblastoma; neurofibroma (e.g., neurofibromatosis (NF) type 1 or type 2, schwannomatosis); neuroendocrine cancer (e.g., gastroenteropancreatic neuroendocrine tumor (GEP-NET), carcinoid tumor); osteosarcoma (e.g., bone cancer); ovarian cancer (e.g., cystadenocarcinoma, ovarian embryonal carcinoma, ovarian adenocarcinoma); papillary adenocarcinoma; pancreatic cancer (e.g., pancreatic andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN), Islet cell tumors); penile cancer (e.g., Paget's disease of the penis and scrotum); pinealoma; primitive neuroectodermal tumor (PNT); plasma cell neoplasia; paraneoplastic syndromes; intraepithelial neoplasms; prostate cancer (e.g., prostate adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland cancer; skin cancer (e.g., squamous cell carcinoma (SCC), keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small bowel cancer (e.g., appendix cancer); soft tissue sarcoma (e.g., malignant fibrous histiocytoma (MFH), liposarcoma, malignant peripheral nerve sheath tumor (MPNST), chondrosarcoma, fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small intestine cancer; sweat gland carcinoma; synovioma; testicular cancer (e.g., seminoma, testicular embryonal carcinoma); thyroid cancer (e.g., papillary carcinoma of the thyroid, papillary thyroid carcinoma (PTC), medullary thyroid cancer); urethral cancer; vaginal cancer; and vulvar cancer (e.g., Paget's disease of the vulva).
- The term “hematological malignancy” refers to tumors that affect blood, bone marrow, and/or lymph nodes. Exemplary hematological malignancies include, but are not limited to, leukemia, such as acute lymphoblastic leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic myelocytic leukemia (CML) (e.g., B-cell CML, T-cell CML), and chronic lymphocytic leukemia (CLL) (e.g., B-cell CLL, T-cell CLL)); lymphoma, such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL, such as diffuse large cell lymphoma (DLCL) (e.g., diffuse large B-cell lymphoma (DLBCL, e.g., activated B-cell (ABC) DLBCL (ABC-DLBCL))), follicular lymphoma, chronic lymphocytic leukemia/small lymphocytic lymphoma (CLL/SLL), mantle cell lymphoma (MCL), marginal zone B-cell lymphoma (e.g., mucosa-associated lymphoid tissue (MALT) lymphoma, nodal marginal zone B-cell lymphoma, splenic marginal zone B-cell lymphoma), primary mediastinal B-cell lymphoma, Burkitt's lymphoma, Waldenström's macroglobulinemia (WM, lymphoplasmacytic lymphoma), hairy cell leukemia (HCL), immunoblastic large cell lymphoma, precursor B-lymphoblastic lymphoma, central nervous system (CNS) lymphoma (e.g., primary CNS lymphoma and secondary CNS lymphoma); and T-cell NHL, such as precursor T-lymphoblastic lymphoma/leukemia, peripheral T-cell lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma (CTCL) (e.g., mycosis fungoides, Sezary syndrome), angioimmunoblastic T-cell lymphoma, extranodal natural killer T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous panniculitis-like T-cell lymphoma, and anaplastic large cell lymphoma); lymphoma of an immune privileged site (e.g., cerebral lymphoma, ocular lymphoma, lymphoma of the placenta, lymphoma of the fetus, testicular lymphoma); a mixture of one or more leukemia/lymphoma as described above; myelodysplasia; and multiple myeloma (MM).
- The term “inflammatory disease” refers to a disease caused by, resulting from, or resulting in inflammation. The term “inflammatory disease” may also refer to a dysregulated inflammatory reaction that causes an exaggerated response by macrophages, granulocytes, and/or T-lymphocytes leading to abnormal tissue damage and/or cell death. An inflammatory disease can be either an acute or chronic inflammatory condition and can result from infections or non-infectious causes. Inflammatory diseases include, without limitation, atherosclerosis, arteriosclerosis, autoimmune disorders, multiple sclerosis, systemic lupus erythematosus, polymyalgia rheumatica (PMR), gouty arthritis, degenerative arthritis, tendonitis, bursitis, psoriasis, cystic fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory arthritis, Sjogren's syndrome, giant cell arteritis, progressive systemic sclerosis (scleroderma), ankylosing spondylitis, polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes (e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves' disease, Goodpasture's disease, mixed connective tissue disease, sclerosing cholangitis, inflammatory bowel disease, Crohn's disease, ulcerative colitis, pernicious anemia, inflammatory dermatoses, usual interstitial pneumonitis (UIP), asbestosis, silicosis, bronchiectasis, berylliosis, talcosis, pneumoconiosis, sarcoidosis, desquamative interstitial pneumonia, lymphoid interstitial pneumonia, giant cell interstitial pneumonia, cellular interstitial pneumonia, extrinsic allergic alveolitis, Wegener's granulomatosis and related forms of angiitis (temporal arteritis and polyarteritis nodosa), inflammatory dermatoses, hepatitis, delayed-type hypersensitivity reactions (e.g., poison ivy dermatitis), pneumonia, respiratory tract inflammation, Adult Respiratory Distress Syndrome (ARDS), encephalitis, immediate hypersensitivity reactions, asthma, hay fever, allergies, acute anaphylaxis, rheumatic fever, glomerulonephritis, pyelonephritis, cellulitis, cystitis, chronic cholecystitis, ischemia (ischemic injury), reperfusion injury, allograft rejection, host-versus-graft rejection, appendicitis, arteritis, blepharitis, bronchiolitis, bronchitis, cervicitis, cholangitis, chorioamnionitis, conjunctivitis, dacryoadenitis, dermatomyositis, endocarditis, endometritis, enteritis, enterocolitis, epicondylitis, epididymitis, fasciitis, fibrositis, gastritis, gastroenteritis, gingivitis, ileitis, iritis, laryngitis, myelitis, myocarditis, nephritis, omphalitis, oophoritis, orchitis, osteitis, otitis, pancreatitis, parotitis, pericarditis, pharyngitis, pleuritis, phlebitis, pneumonitis, proctitis, prostatitis, rhinitis, salpingitis, sinusitis, stomatitis, synovitis, testitis, tonsillitis, urethritis, urocystitis, uveitis, vaginitis, vasculitis, vulvitis, vulvovaginitis, angitis, chronic bronchitis, osteomyelitis, optic neuritis, temporal arteritis, transverse myelitis, necrotizing fasciitis, and necrotizing enterocolitis.
- An “autoimmune disease” refers to a disease arising from an inappropriate immune response of the body of a subject against substances and tissues normally present in the body. In other words, the immune system mistakes some part of the body as a pathogen and attacks its own cells. This may be restricted to certain organs (e.g., in autoimmune thyroiditis) or involve a particular tissue in different places (e.g., Goodpasture's disease which may affect the basement membrane in both the lung and kidney). The treatment of autoimmune diseases is typically with immunosuppression, e.g., medications which decrease the immune response. Exemplary autoimmune diseases include, but are not limited to, glomerulonephritis, Goodpasture's syndrome, necrotizing vasculitis, lymphadenitis, peri-arteritis nodosa, systemic lupus erythematosis, rheumatoid arthritis, psoriatic arthritis, systemic lupus erythematosis, psoriasis, ulcerative colitis, systemic sclerosis, dermatomyositis/polymyositis, anti-phospholipid antibody syndrome, scleroderma, pemphigus vulgaris, ANCA-associated vasculitis (e.g., Wegener's granulomatosis, microscopic polyangiitis), uveitis, Sjogren's syndrome, Crohn's disease, Reiter's syndrome, ankylosing spondylitis, Lyme disease, Guillain-Barré syndrome, Hashimoto's thyroiditis, and cardiomyopathy.
- The term “kinase” is a type of enzyme that transfers phosphate groups from high energy donor molecules, such as ATP, to specific substrates, referred to as phosphorylation. Kinases are part of the larger family of phosphotransferases. One of the largest groups of kinases are protein kinases, which act on and modify the activity of specific proteins. Kinases are used extensively to transmit signals and control complex processes in cells. Various other kinases act on small molecules such as lipids, carbohydrates, amino acids, and nucleotides, either for signaling or to prime them for metabolic pathways. Kinases are often named after their substrates. More than 500 different protein kinases have been identified in humans. Exemplary human protein kinases include, but are not limited to, AAK1, ABL, ACK, ACTR2, ACTR2B, AKT1, AKT2, AKT3, ALK, ALK1, ALK2, ALK4, ALK7, AMPKa1, AMPKa2, ANKRD3, ANPa, ANPb, ARAF, ARAFps, ARG, AurA, AurAps1, AurAps2, AurB, AurBpsl, AurC, AXL, BARK1, BARK2, BIKE, BLK, BMPR1A, BMPR1Aps1, BMPR1Aps2, BMPR1B, BMPR2, BMX, BRAF, BRAFps, BRK, BRSK1, BRSK2, BTK, BUB1, BUBR1, CaMKla, CaMK1b, CaMK1d, CaMK1g, CaMK2a, CaMK2b, CaMK2d, CaMK2g, CaMK4, CaMKK1, CaMKK2, caMLCK, CASK, CCK4, CCRK, CDCl2, CDCl7, CDK10, CDK11, CDK2, CDK3, CDK4, CDK4ps, CDK5, CDK5ps, CDK6, CDK7, CDK7ps, CDK8, CDK8ps, CDK9, CDKL1, CDKL2, CDKL3, CDKL4, CDKL5, CGDps, CHED, CHK1, CHK2, CHK2ps1, CHK2ps2, CKla, CKla2, CKlaps1, CKlaps2, CKlaps3, CKld, CKle, CKlg1, CK1g2, CKlg2ps, CK1g3, CK2a1, CK2a1-rs, CK2a2, CLIK1, CLIKIL, CLK1, CLK2, CLK2ps, CLK3, CLK3ps, CLK4, COT, CRIK, CRK7, CSK, CTK, CYGD, CYGF, DAPK1, DAPK2, DAPK3, DCAMKL1, DCAMKL2, DCAMKL3, DDR1, DDR2, DLK, DMPK1, DMPK2, DRAK1, DRAK2, DYRKIA, DYRKIB, DYRK2, DYRK3, DYRK4, EGFR, EphA1, EphA10, EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8, EphB1, EphB2, EphB3, EphB4, EphB6, Erk1, Erk2, Erk3, Erk3ps1, Erk3ps2, Erk3ps3, Erk3ps4, Erk4, Erk5, Erk7, FAK, FER, FERps, FES, FGFR1, FGFR2, FGFR3, FGFR4, FGR, FLT1, FLT1ps, FLT3, FLT4, FMS, FRK, Fused, FYN, GAK, GCK, GCN2, GCN22, GPRK4, GPRK5, GPRK6, GPRK6ps, GPRK7, GSK3A, GSK3B, Haspin, HCK, HER2/ErbB2, HER3/ErbB3, HER4/ErbB4, HH498, HIPK1, HIPK2, HIPK3, HIPK4, HPK1, HRI, HRIps, HSER, HUNK, ICK, IGF1R, IKKa, IKKb, IKKe, ILK, INSR, IRAK1, IRAK2, IRAK3, IRAK4, IRE1, IRE2, IRR, ITK, JAK1, JAK2, JAK3, JNK1, JNK2, JNK3, KDR, KHS1, KHS2, KIS, KIT, KSGCps, KSR1, KSR2, LATS1, LATS2, LCK, LIMK1, LIMK2, LIMK2ps, LKB1, LMR1, LMR2, LMR3, LOK, LRRK1, LRRK2, LTK, LYN, LZK, MAK, MAP2K1, MAP2K1ps, MAP2K2, MAP2K2ps, MAP2K3, MAP2K4, MAP2K5, MAP2K6, MAP2K7, MAP3K1, MAP3K2, MAP3K3, MAP3K4, MAP3K5, MAP3K6, MAP3K7, MAP3K8, MAPKAPK2, MAPKAPK3, MAPKAPK5, MAPKAPKps1, MARK1, MARK2, MARK3, MARK4, MARKps01, MARKps02, MARKps03, MARKps04, MARKps05, MARKps07, MARKps08, MARKps09, MARKps10, MARKps11, MARKps12, MARKps13, MARKps15, MARKps16, MARKps17, MARKps18, MARKps19, MARKps20, MARKps21, MARKps22, MARKps23, MARKps24, MARKps25, MARKps26, MARKps27, MARKps28, MARKps29, MARKps30, MAST1, MAST2, MAST3, MAST4, MASTL, MELK, MER, MET, MISR2, MLK1, MLK2, MLK3, MLK4, MLKL, MNK1, MNK1ps, MNK2, MOK, MOS, MPSK1, MPSK1ps, MRCKa, MRCKb, MRCKps, MSK1, MSK12, MSK2, MSK22, MSSK1, MST1, MST2, MST3, MST3ps, MST4, MUSK, MYO3A, MYO3B, MYT1, NDR1, NDR2, NEK1, NEK10, NEK11, NEK2, NEK2ps1, NEK2ps2, NEK2ps3, NEK3, NEK4, NEK4ps, NEK5, NEK6, NEK7, NEK8, NEK9, NIK, NIM1, NLK, NRBP1, NRBP2, NuaK1, NuaK2, Obsen, Obscn2, OSR1, p38a, p38b, p38d, p38g, p70S6K, p70S6Kb, p70S6Kps1, p70S6Kps2, PAK1, PAK2, PAK2ps, PAK3, PAK4, PAK5, PAK6, PASK, PBK, PCTAIRE1, PCTAIRE2, PCTAIRE3, PDGFRa, PDGFRb, PDK1, PEK, PFTAIRE1, PFTAIRE2, PHKg1, PHKglps1, PHKglps2, PHKglps3, PHKg2, PIK3R4, PIM1, PIM2, PIM3, PINK1, PITSLRE, PKACa, PKACb, PKACg, PKCa, PKCb, PKCd, PKCe, PKCg, PKCh, PKCi, PKCips, PKCt, PKCz, PKD1, PKD2, PKD3, PKG1, PKG2, PKN1, PKN2, PKN3, PKR, PLK1, PLK1ps1, PLK1ps2, PLK2, PLK3, PLK4, PRKX, PRKXps, PRKY, PRP4, PRP4ps, PRPK, PSKH1, PSKHlps, PSKH2, PYK2, QIK, QSK, RAF1, RAF1ps, RET, RHOK, RIPK1, RIPK2, RIPK3, RNAseL, ROCK1, ROCK2, RON, ROR1, ROR2, ROS, RSK1, RSK12, RSK2, RSK22, RSK3, RSK32, RSK4, RSK42, RSKL1, RSKL2, RYK, RYKps, SAKps, SBK, SCYL1, SCYL2, SCYL2ps, SCYL3, SGK, SgK050ps, SgK069, SgK071, SgK085, SgK110, SgK196, SGK2, SgK223, SgK269, SgK288, SGK3, SgK307, SgK384ps, SgK396, SgK424, SgK493, SgK494, SgK495, SgK496, SIK(e.g., SIK1, SIK2), skMLCK, SLK, Slob, smMLCK, SNRK, SPEG, SPEG2, SRC, SRM, SRPK1, SRPK2, SRPK2ps, SSTK, STK33, STK33ps, STLK3, STLK5, STLK6, STLK6ps1, STLK6-rs, SuRTK106, SYK, TAK1, TAO1, TAO2, TAO3, TBCK, TBK1, TEC, TESK1, TESK2, TGFbR1, TGFbR2, TIE1, TIE2, TLK1, TLK1ps, TLK2, TLK2ps1, TLK2ps2, TNK1, Trad, Trb1, Trb2, Trb3, Trio, TRKA, TRKB, TRKC, TSSK1, TSSK2, TSSK3, TSSK4, TSSKps1, TSSKps2, TTBK1, TTBK2, TTK, TTN, TXK, TYK2, TYK22, TYRO3, TYRO3ps, ULK1, ULK2, ULK3, ULK4, VACAMKL, VRK1, VRK2, VRK3, VRK3ps, Weel, WeelB, WeelBps, Weelps1, Weelps2, Wnk1, Wnk2, Wnk3, Wnk4, YANK1, YANK2, YANK3, YES, YESps, YSK1, ZAK, ZAP70, ZC1/HGK, ZC2/TNIK, ZC3/MINK, and ZC4/NRK.
- The term “SRC family kinase” refers to a family of non-receptor tyrosine protein kinases that includes nine members: SRCA subfamily that includes c-SRC (proto-oncogene tyrosine-protein kinase SRC), YES (proto-oncogene tyrosine-protein kinase Yes), FYN (proto-oncogene tyrosine-protein kinase FYN), and FGR (Gardner-Rasheed feline sarcoma viral (v-FGR) oncogene homolog); SRCB subfamily that includes LCK (lymphocyte-specific protein tyrosine kinase), HCK (tyrosine-protein kinase HCK, hemopoietic cell kinase), BLK (tyrosine-protein kinase BLK), and LYN (tyrosine-protein kinase LYN); and FRK (Fyn-related kinase).
- The term “CDK” refers to a cyclin-dependent kinase. A CDK binds a cyclin (e.g., Cyclin H), which is a regulatory protein. CDKs phosphorylate their substrates at serines and threonines. The consensus sequence for the phosphorylation site in the amino acid sequence of a CDK substrate is [S/T*]PX[K/R], where S/T* is the phosphorylated serine or threonine, P is proline, X is any amino acid, K is lysine, and R is arginine. CDKs include CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK11, CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19 and CDK20.
- CDK7, cyclin-dependent kinase 7, is a CDK, wherein the substrate is Cyclin H, MAT1 (e.g., MNAT1), or Cyclin H and MAT1. CDK7 is alternatively referred to as CAK1, HCAK, MO15, STK1, CDKN7, and p39MO15. Non-limiting examples of the nucleotide and protein sequences for human CDK7 are described in GenBank Accession Number NP_001790, incorporated herein by reference. The amino acid sequence of this CDK7 is as follows:
-
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRS EAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDL EVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDE NGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDM WAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPD YVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKY FSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKK LIF - Cyclin dependent kinases (CDKs) are key regulators of the cell cycle. Their successive activation and inactivation drives the cycle forward. The activity of CDKs is regulated by multiple mechanisms such as positive and negative phosphorylation, binding of regulatory proteins like cyclins, and CDK inhibitors. Cyclin-dependent kinase 7 (CDK7) plays a critical role in the regulation of RNA polymerase II-mediated transcription of protein-encoding genes. Disruption of CDK7 signaling causes defects in transcription; however, a complete understanding of how CDK7 disruption affects global transcription is lacking. Furthermore, the absence of selective inhibitors of CDK7 has hindered investigation of the transcriptional and functional consequences of acute and long-term inhibition of CDK7 under normal and pathological conditions. The present invention describes a cellular screen and conventional proteomics target discovery approach that resulted in the identification of highly selective CDK7 inhibitors and analogs, which have the ability to covalently modify a cysteine residue located outside of the canonical kinase domain (i.e., Cys312 of CDK7). This cysteine is exclusively found in CDK7 and provides an unanticipated means of overcoming the daunting challenge of achieving selectivity amongst the 19 CDKs reported to date. Irreversible inhibition of CDK7 using an inhibitor of the present invention results in the prolonged disruption of transcription and the induction of apoptosis of a diverse subset of cancer cell lines. Genome-wide transcript analysis following inhibitor treatment delineates CDK7-responsive genes as important in the maintenance of the cancer cell state, in particular MYC and MCL-1 genes. Selective covalent inhibition of CDK7 may be a viable cancer therapeutic strategy.
- The present invention provides compounds, which inhibit the activity of a kinase, for the prevention and/or treatment of a subject with a proliferative disease. In certain embodiments, the inventive compounds inhibit the activity of cyclin-dependent kinase (CDK). In certain embodiments, the inventive compounds inhibit the activity of a cyclin-dependent kinase 7 (CDK7). The present invention also provides methods of using the compounds described herein, e.g., as biological probes to study the inhibition of the activity of a kinase (e.g., CDK (e.g., CDK7)), and as therapeutics, e.g., in the prevention and/or treatment of diseases associated with the overexpression and/or aberrant activity of a kinase (e.g., CDK (e.g., CDK7)). In certain embodiments, the diseases are proliferative diseases. The proliferative diseases that may be treated and/or prevented include, but are not limited to, cancers (e.g., leukemia, melanoma, multiple myeloma), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases. Also provided by the present disclosure are pharmaceutical compositions, kits, methods, and uses including a compound of Formula (I) as described herein.
- In addition to inhibiting the activity of CDK7, compounds of the present invention are selective for CDK7 relative to other CDKs. The present invention addresses potential deficiencies of some previous CDK7 inhibitors which also have the ability to inhibit CDK12 or CDK13 (Kwiatowski et al., “Targeting transcription regulation in cancer with a covalent CDK7 inhibitor.” Nature 511, 616-620 (2014)). This affords the opportunity to more clearly differentiate pharmacological effects that are derived from CDK7 inhibition relative to CDK12 and/or CDK13 inhibition and provides new compounds, and compositions thereof, for drug development and therapeutic use.
- Aspects of the present disclosure relate to the compounds described herein. The compounds described herein are pyrrolo-pyrazole containing compounds that may be useful in treating and/or preventing proliferative diseases in a subject, inhibiting the activity of a protein kinase (e.g., CDK) in a subject or biological sample, and inducing apoptosis of a cell. In certain embodiments, a compound described herein is a compound of Formula (I), or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof. In certain embodiments, a compound described herein is a compound of Formula (I), or a pharmaceutically acceptable salt thereof.
- Provided herein are compounds of Formula (I):
- and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein:
-
- R1 is —NRaRb, —CHRaRb or —ORa, wherein each of Ra and Rb is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, or an oxygen protecting group when attached to an oxygen atom, or Ra and Rb are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring;
- each of R3 and R4 is independently hydrogen, halogen, optionally substituted C1-C6 alkyl, or optionally substituted aryl, or R3 and R4 are joined to form an optionally substituted C3-C6 carbocyclyl ring;
- R5 is independently hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- L1 is —NRL1—, —NRL1C(═O)—, —C(═O)NRL1—, —O—, or —S—, wherein RL1 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- Ring A is optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl;
- L2 is a bond, —C(═O)—, —NRL2—, —C(═O)NRL2—, —NRL2C(═O)—, —O—, or —S—, wherein RL2 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- Ring B is absent, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl; and
- R2 is any of Formulae (i-1)-(i-42) as defined herein:
-
- wherein:
- L3 is a bond or an optionally substituted C1-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with —C(═O)—, —O—, —S—, —NRL3a—, —NRL3aC(═O)—, —C(═O)NRL3a—, —SC(═O)—, —C(═O)S—, —OC(═O)—, —C(═O)O—, —NRL3aC(═S)—, —C(═S)NRL3a—, trans-CRL3b═CRL3b—, cis-CRL3b═CRL3b, —C≡C—, —S(═O)—, —S(═O)O—, —OS(═O)—, —S(═O)NRL3a—, —NRL3aS(═O)—, —S(═O)2—, —S(═O)2O—, —OS(═O)2—, —S(═O)2NRL3a, or —NRL3aS(═O)2—, wherein RL3a is hydrogen, substituted or unsubstituted C1-6 alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3b is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
- L4 is a bond or an optionally substituted, branched or unbranched C1-6 hydrocarbon chain; each of RE1, RE2, and RE3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH2OREE, —CH2N(REE)2, —CH2SREE, —OREE, —N(REE)2, —Si(REE)3, and —SREE, wherein each occurrence of REE is independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring; or RE1 and RE3, or RE2 and RE3, or RE1 and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
- RE4 is a leaving group;
- RE5 is halogen;
- RE6 is hydrogen, substituted or unsubstituted C1-6 alkyl, or a nitrogen protecting group; each instance of Y is independently O, S, or NRE7, wherein RE7 is hydrogen, substituted or unsubstituted C1-6 alkyl, or a nitrogen protecting group;
- a is 1 or 2; and
- each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
- In certain embodiments, a compound described herein is of Formula (I):
- and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, and prodrugs thereof, wherein:
-
- R1 is —NRaRb, —CHRaRb or —ORa, wherein each of Ra and Rb is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, or an oxygen protecting group when attached to an oxygen atom, or Ra and Rb are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring;
- each of R3 and R4 is independently hydrogen, halogen, or optionally substituted C1-C6 alkyl, or R3 and R4 are joined to form an optionally substituted C3-C6 carbocyclyl ring;
- R5 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- L1 is —NRL1—, —NRL1C(═O)—, —C(═O)NRL1—, —O—, or —S—, wherein R is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- Ring A is optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl;
- L2 is a bond, —C(═O)—, —NRL2—, —C(═O)NRL2—, —NRL2C(═O)—, —O—, or —S—, wherein RL2 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- Ring B is absent, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl; and
- R2 is any of Formulae (i-1)-(i-41) as defined herein:
-
- wherein:
- L3 is a bond or an optionally substituted C1-4 hydrocarbon chain, optionally wherein one or more carbon units of the hydrocarbon chain are independently replaced with —C(═O)—, —O—, —S—, —NRL3a—, —NRL3aC(═O)—, —C(═O)NRL3a—, —SC(═O)—, —C(═O)S—, —OC(═O)—, —C(═O)O—, —NRL3aC(═S)—, —C(═S)NRL3a—, trans-CRL3b═CRL3b—, cis-CRL3b═CRL3b, —C≡C—, —S(═O)—, —S(═O)O—, —OS(═O)—, —S(═O)NRL3a—, NRL3aS(═O)2—, —S(═O)2—, —S(═O)2O—, —OS(═O)2—, —S(═O)2NRL3a, or —NRL3aS(═O)2—, wherein RL3a is hydrogen, substituted or unsubstituted C1-6 alkyl, or a nitrogen protecting group, and wherein each occurrence of RL3b is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two RL3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
- L4 is a bond or an optionally substituted, branched or unbranched C1-6 hydrocarbon chain;
- each of RE1, RE2, and RE3 is independently hydrogen, halogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH2OREE, —CH2N(REE)2, —CH2SREE, —OREE, —N(REE)2, —Si(REE)3, and —SREE, wherein each occurrence of REE is independently hydrogen, optionally substituted alkyl, optionally substituted alkoxy, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl, or two REE groups are joined to form an optionally substituted heterocyclic ring; or RE1 and RE3, or RE2 and RE3, or RE1 and RE2 are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring;
- RE4 is a leaving group;
- RE5 is halogen;
- RE6 is hydrogen, substituted or unsubstituted C1-6 alkyl, or a nitrogen protecting group; each instance of Y is independently O, S, or NRE7, wherein RE7 is hydrogen, substituted or unsubstituted C1-6 alkyl, or a nitrogen protecting group;
- a is 1 or 2; and
- each instance of z is independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
- Compounds of Formula (I) include R1 attached to the carbonyl substituent of the pyrrolopyrazole bicyclic ring. R1 may be —NRaRb, —CHRaRb or —ORa, wherein each of Ra and Rb is independently hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, a nitrogen protecting group when attached to a nitrogen atom, or an oxygen protecting group when attached to an oxygen atom, or Ra and Rb are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring. In certain embodiments, R1 is —NRaRb. In certain embodiments, R1 is —CHRaRb. In certain embodiments, R1 is —ORa.
- In certain embodiments, R1 is
- wherein R2′ is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group, and each ring atom is optionally substituted. In certain embodiments, R1 is
- In certain embodiments, R1 is of Formula (ii-1):
- wherein:
-
- Rb is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- R2a is hydrogen, —OR1N, or —NR1NR2N, wherein each of R1N and R2N is independently hydrogen, C1-C6 alkyl, a nitrogen protecting group when attached to a nitrogen atom, or an oxygen protecting group when attached to an oxygen atom.
- In certain embodiments, R1 is of Formula (ii-2):
- wherein:
-
- Rb is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group;
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- R2a is hydrogen, —OR1N, or —NR1NR2N, wherein each of R1N and R2N is independently hydrogen, C1-C6 alkyl, a nitrogen protecting group when attached to a nitrogen atom, or an oxygen protecting group when attached to an oxygen atom.
- In certain embodiments, Rb is hydrogen. In certain embodiments, Rb is optionally substituted C1-C6 alkyl. In certain embodiments, Rb is unsubstituted C1-C6 alkyl. In certain embodiments, Rb is a nitrogen protecting group. In certain embodiments, Rb is Bn, BOC, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts.
- In certain embodiments, R1a is hydrogen. In certain embodiments, R1a is methyl. In certain embodiments, R1a is ethyl. In certain embodiments, R1a is propyl. In certain embodiments, R1a is optionally substituted phenyl. In certain embodiments, R1a is phenyl.
- In certain embodiments, R2a is hydrogen. In certain embodiments, R2a is —OR1N, wherein R1N is hydrogen, C1-C6 alkyl, or an oxygen protecting group. In certain embodiments, R2a is —OH. In certain embodiments, R2a is —NR1NR2N, wherein each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group. In certain embodiments, R1N and R2N are the same. In certain embodiments, R1N and R2N are distinct. In certain embodiments, R1N and R2N are both methyl. In certain embodiments, R1N and R2N are both ethyl. In certain embodiments, R1N and R2N are both propyl. In certain embodiments, R1N and R2N are both hydrogen. In certain embodiments, R1N and R2N are both nitrogen protecting groups. In certain embodiments, at least one of R1N and R2N is methyl. In certain embodiments, at least one of R1N and R2N is ethyl. In certain embodiments, at least one of R1N and R2N is propyl. In certain embodiments, at least one of R1N and R2N is hydrogen. In certain embodiments, at least one of R1N and R2N is a nitrogen protecting group. In certain embodiments, R1N is methyl, and R2N is hydrogen. In certain embodiments, R1N is ethyl, and R2N is hydrogen. In certain embodiments, R1N is propyl, and R2N is hydrogen. In certain embodiments, R1N is a nitrogen protecting group, and R2N is hydrogen. In certain embodiments, R1N is methyl, and R2N is a nitrogen protecting group. In certain embodiments, R1 is ethyl, and R2N is a nitrogen protecting group. In certain embodiments, R1N is propyl, and R2N is a nitrogen protecting group.
- In certain embodiments, R1 is of Formula (ii-1a):
- wherein:
-
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group.
- In certain embodiments, R1 is of Formula (ii-2a):
- wherein:
-
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group.
- In certain embodiments, R1a is hydrogen. In certain embodiments, R1a is methyl. In certain embodiments, R1a is ethyl. In certain embodiments, R1a is propyl. In certain embodiments, R1a is optionally substituted phenyl. In certain embodiments, R1a is phenyl. In certain embodiments, R1N and R2N are the same.
- In certain embodiments, R1N and R2N are distinct. In certain embodiments, R1N and R2N are both methyl. In certain embodiments, R1N and R2N are both ethyl. In certain embodiments, R1N and R2N are both propyl. In certain embodiments, RN and R2N are both hydrogen. In certain embodiments, R1N and R2N are both nitrogen protecting groups. In certain embodiments, at least one of RN and R2N is methyl. In certain embodiments, at least one of R1N and R2N is ethyl. In certain embodiments, at least one of RN and R2N is propyl. In certain embodiments, at least one of RN and R2N is hydrogen. In certain embodiments, at least one of RN and R2N is a nitrogen protecting group. In certain embodiments, RN is methyl, and R2N is hydrogen. In certain embodiments, R1N is ethyl, and R2N is hydrogen. In certain embodiments, R1N is propyl, and R2N is hydrogen. In certain embodiments, R1N is a nitrogen protecting group, and R2N is hydrogen. In certain embodiments, R1N is methyl, and R2N is a nitrogen protecting group. In certain embodiments, R1N is ethyl, and R2N is a nitrogen protecting group. In certain embodiments, R1N is propyl, and R2N is a nitrogen protecting group.
- In certain embodiments, R1 is of Formula (ii-1b):
- wherein R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, R1 is of Formula (ii-2b):
- wherein R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, R1a is hydrogen. In certain embodiments, R1a is methyl. In certain embodiments, R1a is ethyl. In certain embodiments, R1a is propyl. In certain embodiments, R1a is optionally substituted phenyl. In certain embodiments, R1a is phenyl.
- In certain embodiments, R1 is:
- In certain embodiments, R1 is:
- In certain embodiments, R1 is:
- In certain embodiments, R1 is:
- In certain embodiments, R1 is of Formula (ii-1c):
- wherein:
-
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or an oxygen protecting group.
- In certain embodiments, R1 is of Formula (ii-2c):
- wherein:
-
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or an oxygen protecting group.
- In certain embodiments, R1a is hydrogen. In certain embodiments, R1a is methyl. In certain embodiments, R1a is ethyl. In certain embodiments, R1a is propyl. In certain embodiments, R1a is optionally substituted phenyl. In certain embodiments, R1a is phenyl. In certain embodiments, R1N is hydrogen. In certain embodiments, R1N is methyl. In certain embodiments, R1N is ethyl. In certain embodiments, R1N is propyl. In certain embodiments, R1N is an oxygen protecting group.
- In certain embodiments, R1 is of Formula (ii-1d):
- wherein R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, R1 is of Formula (ii-2d):
- wherein R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, R1a is hydrogen. In certain embodiments, R1a is methyl. In certain embodiments, R1a is ethyl. In certain embodiments, R1a is propyl. In certain embodiments, R1a is optionally substituted phenyl. In certain embodiments, R1a is phenyl.
- In certain embodiments, R1 is
- In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted aryl, and Rb is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted heteroaryl, and Rb is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted heterocyclyl, and Rb is hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted carbocyclyl, and Rb is selected from hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, or a nitrogen protecting group. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted aryl, and Rb is hydrogen. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted heteroaryl, and Rb is hydrogen. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted heterocyclyl, and Rb is hydrogen. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted carbocyclyl, and Rb is hydrogen. In certain embodiments, R1 is —NRaRb, wherein Ra is optionally substituted pyrazolyl, and Rb is hydrogen. In certain embodiments, R1 is —NRaRb, wherein Ra is 1-methyl-1H-pyrazol-4-yl, and Rb is hydrogen. In certain embodiments, R1 is
- Compounds of Formula (I) include linker L1 joining the pyrrolopyrazole bicyclic ring and Ring A. Linker L1 may be —NRL—, —NRLC(═O)—, —C(═O)NRL—, —O—, or —S—, wherein RL1 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group. In certain embodiments, L1 is —NRL1—, wherein RL1 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group. In certain embodiments, L1 is —NRLC(═O)—, wherein RL1 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group. In certain embodiments, L1 is —C(═O)NRL—, wherein RL1 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group. In certain embodiments, RL1 is hydrogen. In certain embodiments, L1 is —NH—. In certain embodiments, L1 is —NH(C═O)—. In certain embodiments, L1 is —(C═O)NH—. In certain embodiments, L1 is —O—. In certain embodiments, L1 is —S—.
- Compounds of Formula (I) include R3 and R4 attached to the pyrrolopyrazole bicyclic ring. Each of R3 and R4 is independently hydrogen, halogen, optionally substituted aryl, or optionally substituted C1-C6 alkyl, or R3 and R4 are joined to form an optionally substituted C3-C6 carbocyclyl ring. In certain embodiments, R3 is a substituted or unsubstituted aryl (e.g., substituted or unsubstituted phenyl). In certain embodiments, R4 is a substituted or unsubstituted aryl (e.g., substituted or unsubstituted phenyl). In certain embodiments, R3 and R4 are joined to form an optionally substituted C3-C6 carbocyclyl. In certain embodiments, R3 and R4 are joined to form an optionally substituted cyclopropane. In certain embodiments, R3 and R4 are joined to form an unsubstituted cyclopropane. In certain embodiments, R3 and R4 are joined to form an optionally substituted cyclohexane. In certain embodiments, R3 and R4 are joined to form an unsubstituted cyclohexane. In certain embodiments, R3 and R4 are the same. In certain embodiments, R3 and R4 are distinct. In certain embodiments, R3 and R4 are optionally substituted C1-C6 alkyl. In certain embodiments, R3 and R4 are unsubstituted C1-C6 alkyl. In certain embodiments, R3 and R4 are both methyl. In certain embodiments, R3 and R4 are both ethyl. In certain embodiments, R3 and R4 are both propyl. In certain embodiments, R3 and R4 are both hydrogen. In certain embodiments, R3 and R4 are both halogen. In certain embodiments, each of R3 and R4 is independently —Cl, —Br, or —I. In certain embodiments, R3 and R4 are both —F. In certain embodiments, R3 and R4 are joined as —CH2CH2—.
- In certain embodiments, R3 is optionally substituted C1-C6 alkyl (e.g., isopropyl). In certain embodiments, R3 is unsubstituted C1-C6 alkyl. In certain embodiments, R3 is methyl. In certain embodiments, R3 is ethyl. In certain embodiments, R3 is propyl. In certain embodiments, R3 is hydrogen. In certain embodiments, R3 is halogen. In certain embodiment, R3 is —Cl, —Br, or —I. In certain embodiment, R3 is —F. In certain embodiments, R4 is optionally substituted C1-C6 alkyl (e.g., isopropyl). In certain embodiments, R4 is unsubstituted C1-C6 alkyl. In certain embodiments, R4 is methyl. In certain embodiments, R4 is ethyl. In certain embodiments, R4 is propyl. In certain embodiments, R4 is hydrogen. In certain embodiments, R4 is halogen. In certain embodiment, R4 is —Cl, —Br, or —I. In certain embodiment, R4 is —F.
- In certain embodiments, R3 is hydrogen, and R4 is methyl. In certain embodiments, R3 is methyl, and R4 is hydrogen. In certain embodiments, R3 is hydrogen, and R4 is ethyl. In certain embodiments, R3 is ethyl, and R4 is hydrogen. In certain embodiments, R3 is hydrogen, and R4 is propyl. In certain embodiments, R3 is propyl, and R4 is hydrogen. In certain embodiments, R3 is hydrogen, and R4 is —Cl, —Br, or —I. In certain embodiments, R3 is —Cl, Br, or —I, and R4 is hydrogen. In certain embodiments, R3 is hydrogen, and R4 is —F. In certain embodiments, R3 is —F, and R4 is hydrogen. In certain embodiments, R3 is methyl, and R4 is —F. In certain embodiments, R3 is —F, and R4 is methyl. In certain embodiments, R3 is ethyl, and R4 is —F. In certain embodiments, R3 is —F, and R4 is ethyl. In certain embodiments, R3 is propyl, and R4 is —F. In certain embodiments, R3 is —F, and R4 is propyl. In certain embodiments, R3 is methyl, and R4 is —Cl, —Br, or —I. In certain embodiments, R3 is —Cl, —Br, or —I, and R4 is methyl. In certain embodiments, R3 is ethyl, and R4 is —Cl, —Br, or —I. In certain embodiments, R3 is —Cl, —Br, or —I, and R4 is ethyl. In certain embodiments, R3 is propyl, and R4 is —Cl, —Br, or —I. In certain embodiments, R3 is —Cl, —Br, or —I, and R4 is propyl.
- Compounds of Formula (I) include R5 attached to a pyrazole nitrogen. R5 may be hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protecting group. In certain embodiments, R5 is optionally substituted C1-C6 alkyl. In certain embodiments, R5 is unsubstituted C1-C6 alkyl. In certain embodiments, R5 is substituted methyl. In certain embodiments, R5 is unsubstituted methyl. In certain embodiments, R5 is hydrogen. In certain embodiments, R5 is a nitrogen protecting group. In certain embodiments, R5 is Bn, BOC, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or Ts.
- Compounds of Formula (I) may exist as tautomers or mixtures thereof of Formulae (I-a) and (I-b):
- In each tautomer, R5 is attached to different pyrazole nitrogens in compounds of each formula. In certain embodiments, R5 is attached to the nitrogen at the position labeled 1, as in Formula (I-a). In certain embodiments, R5 is attached to the nitrogen at the position labeled 2, as in Formula (I-b). In certain embodiments, compounds of Formula (I) may exist as a mixture of compounds of Formulae (I-a) and (I-b), in which case R5 is attached to the nitrogen at the position labeled 1 for components of the mixture corresponding to Formula (I-a), and R5 is the nitrogen at the position labeled 2 for components of the mixture corresponding to Formula (I-b).
- Compounds of Formula (I) include Ring A between linker L1 and linker L2. Ring A may be optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl. In certain embodiments, Ring A is optionally substituted carbocyclyl. In certain embodiments, Ring A is optionally substituted heterocyclyl. In certain embodiments, Ring A is optionally substituted aryl. In certain embodiments, Ring A is optionally substituted heteroaryl. In certain embodiments, Ring A is optionally substituted phenyl. In certain embodiments, Ring A is phenyl substituted with only L1 and L2. In certain embodiments, Ring A is optionally substituted cyclohexyl. In certain embodiments, Ring A is optionally substituted piperidinyl. In certain embodiments, Ring A is optionally substituted piperizinyl. In certain embodiments, Ring A is optionally substituted pyridinyl. In certain embodiments, Ring A is optionally substituted pyrimidinyl.
- In certain embodiments, linkers L1 and L2 are attached “ortho” or 1,2 to Ring A. In certain embodiments, linkers L1 and L2 are attached “meta” or 1,3 to Ring A. In certain embodiments, linkers L1 and L2 are attached “para” or 1,4 to ring A.
- In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted. In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted. In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted. In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted, and L1 and L2 may attach to ring A at either indicated position. In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted, and L1 and L2 may attach to ring A at either indicated position. In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted, and L1 and L2 may attach to ring A at either indicated position. In certain embodiments, Ring A is
- wherein each ring atom is optionally substituted, and L1 and L2 may attach to ring A at either indicated position.
- In certain embodiments, Ring A is
- In certain embodiments, Ring A is
- In certain embodiments, Ring A is
- In certain embodiments, Ring A is
- L1 and L2 may attach to ring A at either indicated position. In certain embodiments, Ring A is
- wherein L1 and L2 may attach to ring A at either indicated position. In certain embodiments, Ring A is
- wherein L1 and L2 may attach to ring A at either indicated position. In certain embodiments, Ring A is
- wherein L1 and L2 may attach to ring A at either indicated position.
- Compounds of Formula (I) include linker L2 joining Ring A to Ring B. Linker L2 may be a bond, —C(═O)—, —NRL2—, —C(═O)NRL2—, —NRL2C(═O)—, —O—, or —S— wherein RL2 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protection group. In certain embodiments, L2 is a bond, such that Ring B or R2 is directly attached to Ring A. In certain embodiments, L2 is —NRL2—, wherein RL2 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protection group. In certain embodiments, L2 is —C(═O)NRL2—, wherein RL2 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protection group. In certain embodiments, L2 is —NRL2C(═O)—, wherein RL2 is hydrogen, optionally substituted C1-C6 alkyl, or a nitrogen protection group. In certain embodiments, L2 is —O—. In certain embodiments, L2 is —S—. In certain embodiments, RL2 is hydrogen. In certain embodiments, L2 is —C(═O)—. In certain embodiments, L2 is —NH—. In certain embodiments, L2 is —NHC(═O)—. In certain embodiments, L2 is —C(═O)NH—. In certain embodiments, L2 is —O—. In certain embodiments, L2 is —S—.
- Compounds of Formula (I) include Ring B between linker L2 and group R2. In certain embodiments, linker L2 is a bond, such that Ring B is directly attached to Ring A. Ring B may absent, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl. In certain embodiments, Ring B is absent, such that L2 is directly attached to R2. In certain embodiments, Ring B is absent and linker L2 is a bond, such that Ring A is directly attached to R2. In certain embodiments, Ring B is optionally substituted carbocyclyl. In certain embodiments, Ring B is optionally substituted heterocyclyl. In certain embodiments, Ring B is optionally substituted aryl. In certain embodiments, Ring B is optionally substituted heteroaryl. In certain embodiments, Ring B is optionally substituted phenyl. In certain embodiments, Ring B is optionally substituted cyclohexyl. In certain embodiments, Ring B is optionally substituted piperidinyl. In certain embodiments, Ring B is optionally substituted piperizinyl. In certain embodiments, Ring B is optionally substituted pyridinyl. In certain embodiments, Ring B is optionally substituted pyrimidinyl.
- In certain embodiments, linker L2 and group R2 are attached “ortho” or 1,2 to each other on Ring B. In certain embodiments, linkers L2 and group R2 are attached “meta” or 1,2 to each other on Ring B. In certain embodiments, linkers L2 and R2 are attached “para” or 1,4 to each other on Ring B.
- In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted. In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted. In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted. In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted, and L2 and R2 may attach to Ring B at either indicated position. In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted, and L2 and R2 may attach to Ring B at either indicated position. In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted, and L2 and R2 may attach to Ring B at either indicated position. In certain embodiments, Ring B is
- wherein each ring atom is optionally substituted, and L2 and R2 may attach to Ring B at either indicated position.
- In certain embodiments, Ring B is
- In certain embodiments, Ring B is
- In certain embodiments, Ring B is
- In certain embodiments, Ring B is
- L1 and L2 may attach to Ring B at either indicated position. In certain embodiments, Ring B is
- wherein L2 and R2 may attach to Ring B at either indicated position. In certain embodiments, Ring B is
- wherein L2 and R2 may attach to Ring B at either indicated position. In certain embodiments, Ring B is
- wherein L2 and R2 may attach to Ring B at either indicated position.
- Compounds of Formula (I) include R2 attached to Ring B. In certain embodiments, Ring B is absent, such that R2 is directly attached to linker L2. In certain embodiments, Ring B is absent and L2 is a bond, such that R2 is directly attached to Ring A. In certain embodiments, R2 comprises an electrophilic moiety. In certain embodiments, R2 comprises a Michael acceptor moiety. The electrophilic moiety (e.g., Michael acceptor moiety) may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)) to allow for covalent attachment of the compound to the kinase. In certain embodiments, the electrophilic moiety (e.g., Michael acceptor moiety) may react with a cysteine residue of a kinase (e.g., CDK (e.g., CDK7)). In certain embodiments, the electrophilic moiety (e.g., Michael acceptor moiety) may react with the Cys312 residue of CDK7. In certain embodiments, the covalent attachment is irreversible. In certain embodiments, the covalent attachment is reversible.
- R2 may be any one of Formulae (i-1)-(i-42). In certain embodiments, R2 is of Formula (i-1):
- In certain embodiments, R2 is of Formula (i-2):
- In certain embodiments, R2 is of Formula (i-3):
- In certain embodiments, R2 is of Formula (i-4):
- In certain embodiments, R2 is of Formula (i-5):
- In certain embodiments, R2 is of Formula (i-6)
- In certain embodiments, R2 is of Formula (i-7):
- In certain embodiments, R2 is of Formula (i-8):
- In certain embodiments, R2 is of Formula (i-9):
- In certain embodiments, R2 is of Formula (i-10):
- In certain embodiments, R2 is of Formula (i-11):
- In certain embodiments, R2 is of Formula (i-12):
- In certain embodiments, R2 is of Formula (i-13):
- In certain embodiments, R2 is of Formula (i-14):
- In certain embodiments, R2 is of Formula (i-15):
- In certain embodiments, R2 is of Formula (i-16):
- In certain embodiments, R2 is of Formula (i-17):
- In certain embodiments, R2 is of Formula (i-18):
- In certain embodiments, R2 is of Formula (i-19):
- In certain embodiments, R2 is of Formula (i-20):
- In certain embodiments, R2 is of Formula (i-21):
- In certain embodiments, R2 is of Formula (i-22):
- In certain embodiments, R2 is of Formula (i-23):
- In certain embodiments, R2 is of Formula (i-24):
- In certain embodiments, R2 is of Formula (i-25):
- In certain embodiments, R2 is of Formula (i-26):
- In certain embodiments, R2 is of Formula (i-27):
- In certain embodiments, R2 is of Formula (i-28):
- In certain embodiments, R2 is of Formula (i-29):
- In certain embodiments, R2 is of Formula (i-30):
- In certain embodiments, R2 is of Formula (i-31):
- In certain embodiments, R2 is of Formula (i-32):
- In certain embodiments, R2 is of Formula (i-33):
- In certain embodiments, R2 is of Formula (i-34):
- In certain embodiments, R2 is of Formula (i-35):
- In certain embodiments, R2 is of Formula (i-36):
- In certain embodiments, R2 is of Formula (i-37):
- In certain embodiments, R2 is of Formula (i-38):
- In certain embodiments, R2 is of Formula (i-39):
- In certain embodiments, R2 is of Formula (i-40):
- In certain embodiments, R2 is of Formula (i-41):
- In certain embodiments, R2 is of Formula (i-42):
- In certain embodiments, R2 is of Formula (i-1a):
- In certain embodiments, R2 is of Formula (i-1b):
- In certain embodiments, R2 is of Formula (i-1c):
- In certain embodiments, R2 is of Formula (i-1d):
- In certain embodiments, R2 is of Formula (i-1e):
- In certain embodiments, R2 is of Formula (i-1f):
- In certain embodiments, R2 is of Formula (i-1g):
- In certain embodiments, R2 is of Formula (i-1g):
- In certain embodiments, R2 is
- In certain embodiments, R2 is
- In certain embodiments, R2 is
- In certain embodiments, R2 is
- In certain embodiments, R2 is of Formula (i-1a):
- In certain embodiments, R2 is of Formula (i-1b):
- In certain embodiments, R2 is of Formula (i-1c):
- In certain embodiments, R2 is
- In certain embodiments, R2 is of Formula (i-18a):
- In certain embodiments, R2 is of Formula (i-18b):
- In certain embodiments, R2 is of Formula (i-18c):
- In certain embodiments, R2 is of Formula (i-15a):
- In certain embodiments, R2 is of Formula (i-15b):
- In certain embodiments, R2 is of Formula (i-15c):
- R2 may contain linker L3 or L4. In certain embodiments, L3 is a bond. L3 is an optionally substituted C1-4 hydrocarbon chain. In certain embodiments, L3 is optionally substituted ethyl. In certain embodiments, L3 is optionally substituted alkenyl. In certain embodiments, L3 is an optionally substituted C1-4 hydrocarbon chain, wherein one or more carbon units of the hydrocarbon chain are independently replaced with —C(═O)—, —O—, —S—, —NRL3a—, —NRL3aC(═O)—, —C(═O)NRL3a—, —SC(═O)—, —C(═O)S—, —OC(═O)—, —C(═O)O—, —NRL3aC(═S)—, —C(═S)NRL3a, trans-CRL3b═CRL3b—, cis-CRL3b═CRL3b—, —C≡C—, —S(═O)—, —S(═O)O—, —OS(═O)—, —S(═O)NRL3a—, —NRL3aS(═O)—, —S(═O)2—, —S(═O)2O—, —OS(═O)2—, —S(═O)2NRL3a—, or —NRL3aS(═O)2—. In certain embodiments, L3 is an optionally substituted C1-4 hydrocarbon chain, wherein one carbon unit of the hydrocarbon chain is replaced with —NRL3a— (e.g., —NH—). In certain embodiments, L3 is of the formula: —(CH2)1-4—NRL3a— (e.g., —(CH2)1-4—NH—) or —NRL3a—CH2)1-4— (e.g., —NH—CH2)1-4—). In certain embodiments, L3 is —NRL3a—. In certain embodiments, L3 is —NRL3a(C═O)—. In certain embodiments, L3 is —(C═O)NRL3a—. In certain embodiments, L3 is —NH—. In certain embodiments, L3 is —(C═O)—. In certain embodiments, L3 is —NH(C═O)—. In certain embodiments, L3 is —(C═O)NH—. In certain embodiments, L3 is —O—. In certain embodiments, L3 is —S—. In certain embodiments, L4 is a bond. In certain embodiments, L4 is an optionally substituted C1-4 hydrocarbon chain.
- Linker L3 may contain groups RL3a or RL3b. In certain embodiments, RL3a is hydrogen. In certain embodiments, at least one instance of RL3b is hydrogen. In certain embodiments, each instance of RL3b is hydrogen. In certain embodiments, at least one instance of RL3b is —Cl, —Br, or —I. In certain embodiments, each instance of RL3b is —Cl, —Br, or —I. In certain embodiments, at least one instance of RL3b is —F. In certain embodiments, each instance of RL3b is —F. In certain embodiments, at least one instance of RL3b is optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl. In certain embodiments, two RL3b groups are joined to form an optionally substituted carbocyclic or optionally substituted heterocyclic ring.
- R2 may contain groups RE1, RE2, and/or RE3. In certain embodiments, RE1 is hydrogen. In certain embodiments, RE2 is hydrogen. In certain embodiments, RE3 is hydrogen. In certain embodiments, RE is —Cl, —Br, or —I. In certain embodiments, RE2 is —Cl, —Br, or —I. In certain embodiments, RE3 is —Cl, —Br, or —I. In certain embodiments, RE1 is —F. In certain embodiments, RE2 is —F. In certain embodiments, RE3 is —F. In certain embodiments, RE1 is optionally substituted alkyl (e.g., substituted or unsubstituted C1-6 alkyl). In certain embodiments, RE2 is optionally substituted alkyl (e.g., substituted or unsubstituted C1-6 alkyl). In certain embodiments, RE3 is optionally substituted alkyl (e.g., substituted or unsubstituted C1-6 alkyl). In certain embodiments, RE1 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH2OREE, —CH2N(REE)2, —CH2SREE, —OREE, —N(REE)2, —Si(REE)3, or —SREE. In certain embodiments, RE2 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH2OREE, —CH2N(REE)2, —CH2SREE, —OREE, —N(REE)2, —Si(REE)3, or —SREEIn certain embodiments, RE3 is optionally substituted alkenyl, optionally substituted alkynyl, optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —CH2OREE, —CH2N(REE)2, —CH2SREE, —OREE, —N(REE)2, —Si(REE)3, or —SREE. In certain embodiments, RE1 is —N(REE)2. In certain embodiments, RE2 is —N(REE)2. In certain embodiments, RE3 is —N(REE)2. In certain embodiments, RE1 is —N(CH3)2. In certain embodiments, RE2 is —N(CH3)2. In certain embodiments, RE3 is —N(CH3)2. In certain embodiments, RE1 is —CH2N(REE)2. In certain embodiments, RE2 is —CH2N(REE)2. In certain embodiments, RE3 is —CH2N(REE)2. In certain embodiments, RE1 is —CH2N(CH3)2. In certain embodiments, RE2 is —CH2N(CH3)2. In certain embodiments, RE3 is —CH2N(CH3)2. In certain embodiments, RE1 is —CN. In certain embodiments, RE2 is —CN. In certain embodiments, RE3 is —CN.
- In certain embodiments, RE1 and RE3 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, RE1 and RE3 are joined to form an optionally substituted heterocyclic ring. In certain embodiments, RE2 and RE3 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, RE2 and RE3 are joined to form an optionally substituted heterocyclic ring. In certain embodiments, RE1 and RE2 are joined to form an optionally substituted carbocyclic ring. In certain embodiments, RE1 and RE2 are joined to form an optionally substituted heterocyclic ring.
- R2 may contain group RE, where RE4 is a leaving group. In certain embodiments, RE4 is —Cl, —Br, or —I. In certain embodiments, RE4 is —F. In certain embodiments, RE4 is —OS(═O)RE4a or —OS(═O)2RE4a, wherein RE4a is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In certain embodiments, RE4 is —ORE4a. In certain embodiments, RE4 is —OMs, —OTf, —OTs, —OBs, or 2-nitrobenzenesulfonyloxy. In certain embodiments, RE4 is —ORE4a. In certain embodiments, RE4 is —OMe, —OCF3, or —OPh. In certain embodiments, RE4 is —OC(═O)RE4a. In certain embodiments, RE4 is —OC(═O)Me, —OC(═O)CF3, —OC(═O)Ph, or —OC(═O)Cl. In certain embodiments, RE4 is —OC(═O)ORE4a. In certain embodiments, RE4 is —OC(═O)OMe or —OC(═O)O(t-Bu).
- R2 may contain group RE5, where RE5 is a halogen. In certain embodiments, RE5 is —Cl, —Br, or —I. In certain embodiments, RE5 is —F.
- R2 may contain group RE6. In certain embodiments, RE6 is hydrogen. In certain embodiments, RE6 is substituted or unsubstituted C1-C6 alkyl. In certain embodiments, RE6 is a nitrogen protecting group.
- In certain embodiments, a is 1. In certain embodiments, a is 2.
- In certain embodiments, z is 0. In certain embodiments, z is 1. In certain embodiments, z is 2. In certain embodiments, z is 3, 4, 5, or 6.
- R2 may contain group Y. In certain embodiments, Y is O. In certain embodiments, Y is S. In certain embodiments, Y is NRE7. In certain embodiments, Y is NH.
- In certain embodiments, a compound described herein is of Formula (II):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L2, Ring A, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound of Formula (I) is of Formula (III):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L2, Ring A, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound of Formula (I) is of Formula (IV-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L1, linker L2, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound of Formula (I) is of Formula (IV-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L1, linker L2, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IV-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L1, linker L2, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IV-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L1, linker L2, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IV-e):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker L1, linker L2, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IV-f):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, R2, linker Lt, linker L2, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (V-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (V-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (V-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (V-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker Lt, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker Lt, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L1, linker L2, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-e):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L1, linker L2, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-f):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-g):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L1, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-h):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-i):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-j):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-k):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VI-1):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (VII-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VII-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VII-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VII-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L2, Ring A, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein: R2, linker L, linker L2, and Ring B are as defined for Formula (I); and R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-e):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-f):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-g):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-h):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-i):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-j):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-k):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (VIII-1):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof wherein:
-
- R2, linker L, linker L2, and Ring B are as defined for Formula (I); and
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl.
- In certain embodiments, a compound Formula (I) is of Formula (IX-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, linker L2, Ring A, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IX-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, linker L2, Ring A, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IX-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, linker L2, Ring A, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (IX-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein R1, linker L2, Ring A, and Ring B are as defined for Formula (I).
- In certain embodiments, a compound Formula (I) is of Formula (X-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (X-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (X-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (X-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XI-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XI-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XI-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XI-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- Ra is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XII-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XII-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XII-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XII-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XIII-a):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XIII-b):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XIII-c):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, a compound Formula (I) is of Formula (XIII-d):
- or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, wherein:
-
- linker L2, Ring A, and Ring B are as defined for Formula (I);
- R1a is hydrogen, C1-C6 alkyl, or optionally substituted aryl; and
- each of R1N and R2N is independently hydrogen, C1-C6 alkyl, or a nitrogen protecting group, or R1N and R2N are joined to form an optionally substituted carbocyclic, optionally substituted heterocyclic, optionally substituted aryl, or optionally substituted heteroaryl ring.
- In certain embodiments, the compound according to Formula (I) is a compound listed in Table 1.
-
TABLE 1 Exemplary Compounds of Formula (I) Name Structure Characterization Data Compound 101 (S)-3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6- dimethy1-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO-d6) δ 10.44 (d, J = 4.2 Hz, 1H), 10.04 (s, 1H), 8.33 (s, 1H), 7.96-7.93 (m, 2H), 7.82-7.80 (m, 2H), 7.34-7.32 (m, 2H), 7.26-7.23 (m, 2H), 7.20-7.10 (m, 3H), 6.52-6.46 (m, 1H), 6.35-6.30 (m, 1H), 6.09 (s, 1H), 5.84-5.81 (m, 1H), 4.89- 4.83 (m, 1H), 4.35 (d, J = 19.8 Hz, 2H), 2.64-2.57 (m, 1H), 2.45-2.38 (m, 1H), 2.18 (s, 6H), 1.65 (d, J = 4.2 Hz, 3H), 1.58 (d, J = 4.8 Hz, 3H); MS m/z: 607.4 [M + 1]. Compound 102 (S)-3-((4-(4- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.46 (s, 1H), 10.01 (s, 1H), 8.98-8.89 (br, 1H), 8.25 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.85 (d, J = 8.8 Hz, 2H), 7.64 (d, J = 8.8 Hz, 2H), 7.48-7.42 (m, 4H), 7.38-7.34 (m, 1H), 7.00-6.91 (m, 2H), 6.69 (d, J = 8.8 Hz, 1H), 6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz, 1H), 5.40- 5.35 (m, 1H), 4.48 (d, J = 10.8 Hz, 1H), 4.33 (d, J = 10.8 Hz, 1H), 3.10- 2.95 (m, 2H), 2.93 (d, J = 4.8 Hz, 3H), 2.87 (d, J = 4.8 Hz, 3H), 1.74 (s, 3H), 1.65 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 103 (S)-3-((4-(3- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 11.90-11.70 (br, 1H), 10.26 (s, 1H), 9.98 (s, 1H), 8.22-8.10 (br, 1H), 8.07 (m, 1H), 7.83 (dd, J = 8.0, 1.2 Hz, 1H), 7.57 (d, J = 8.0 Hz, 1H), 7.51 (d, J = 8.8 Hz, 2H), 7.39 (t, J = 8.0 Hz, 1H), 7.27 (d, J = 7.2 Hz, 2H), 7.22 (t, J = 7.2 Hz, 2H), 7.12 (t, J = 7.2 Hz, 1H), 6.39 (dd, J = 17.2, 10.0 Hz, 1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H), 6.03-5.92 (m, 1H), 5.72 (dd, J = 10.0, 2.0 Hz, 1H), 4.60-4.51 (m, 1H), 4.25-4.14 (m, 2H), 2.52 (dd, J = 12.0, 8.8 Hz, 1H), 2.32-2.27 (m, 1H), 2.10 (s, 6H), 1.57 (s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 104 (S)-N-(2- (dimethylamino)-1- phenylethyl)-6,6- dimethyl-3-((3-(4- propionamidobenzamido) phenyl)amino)-4,6- dihydropyrrolo[3,4-c] pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 12.20-11.80 (br, 1H), 10.09 (s, 1H), 9.93 (s, 1H), 8.23 (s, 1H), 7.83 (d, J = 8.0 Hz, 2H), 7.65 (d, J = 8.8 Hz, 2H), 7.50-7.30 (m, 1H), 7.27 (d, J = 6.8 Hz, 2H), 7.18 (t, J = 7.2 Hz, 2H), 7.13-7.09 (m, 3H), 6.59- 6.51 (m, 1H), 6.12 (s, 1H), 4.92-4.80 (m, 1H), 4.29 (s, 2H), 2.30 (q, J = 7.6 Hz, 2H), 2.22 (m, 6H), 1.57 (s, 3H), 1.51 (s, 3H), 1.03 (t, J = 7.6 Hz, 3H); MS m/z: 609.4 [M + 1]. Compound 105 (S)-3-((3-(3- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) 12.10-11.82 (br, 1H), 10.26 (s, 1H), 10.08 (s, 1H), 8.25 (s, 1H), 8.06 (s, 1H), 7.85 (dd, J = 8.4, 1.2 Hz, 1H), 7.55 (d, J = 7.6 Hz, 1H), 7.39 (t, J = 8.0 Hz, 1H), 7.24 (d, J = 7.2 Hz, 2H), 7.15 (t, J = 7.2 Hz, 2H), 7.08 (d, J = 6.4 Hz, 1H), 6.39 (dd, J = 17.2, 10.0 Hz, 1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H), 5.97 (s, 1H), 5.72 (dd, J = 10.0, 2.0 Hz, 1H), 4.76-4.70 (m, 1H), 4.30-4.19 (m, 2H), 2.50-2.44 (m, 1H), 2.29-2.22 (m, 1H), 2.05 (s, 6H), 1.57 (s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 106 3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)ethyl)- 6,6-dimethyl-4,6- dihydropyrrolo[3,4-c] pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.49 (s, 1H), 10.07 (s, 1H), 9.41 (s, 1H), 8.37 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.86 (d, J = 8.8 Hz, 2H), 7.49 (s, 1H), 7.21 (m, 2H), 6.74 (m, 1H), 6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.38 (m, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz, 1H), 4.27 (s, 2H), 3.41 (q, J = 5.6 Hz, 2H), 3.18 (q, J = 5.6 Hz, 2H), 2.86 (s, 3H), 2.85 (s, 3H), 1.71 (s, 6H); MS m/z: 531.4 [M + 1]. Compound 107 4-acrylamido-N-(3- ((6,6-dimethyl-5- (4-methylpiperazine- 1-carbonyl)-1,4,5,6- tetrahydropyrrolo[3, 4-c]pyrazol-3-yl) amino)phenyl) benzamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.49 (s, 1H), 10.08 (s, 1H), 9.68 (s, 1H), 8.44 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.86 (d, J = 8.4 Hz, 2H), 7.62 (s, 1H), 7.23-7.13 (m, 2H), 6.84 (d, J = 7.2 Hz, 1H), 6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz, 1H), 4.43 (s, 2H), 3.40- 3.33 (m, 4H), 3.15-2.97 (m, 4H), 2.82 (s, 3H), 1.70 (s, 6H); MS m/z: 543.4 [M + 1]. Compound 108 3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(1- (dimethylamino) propan-2-yl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.35 (s, 1H), 9.95 (s, 1H), 8.91 (s, 1H), 8.23 (s, 1H), 7.85 (d, J = 8.4 Hz, 2H), 7.72 (d, J = 8.4 Hz, 2H), 7.32 (s, 1H), 7.11-7.05 (m, 2H), 6.57 (m, 1H), 6.40 (dd, J = 16.8, 10.0 Hz, 1H), 6.23 (dd, J = 16.8, 2.0 Hz, 1H), 5.91 (d, J = 8.4 Hz, 1H), 5.74 (dd, J = 10.0, 2.0 Hz, 1H), 4.1 (s, 2H), 4.14-4.07 (m, 1H), 3.05-2.94 (m, 2H), 2.71 (d, J = 4.8 Hz, 3H), 2.69 (d, J = 4.8 Hz, 3H), 1.59 (s, 6H), 1.01 (d, J = 6.4 Hz, 3H), 0.85-0.76 (m, 1H); MS m/z: 545.3 [M + 1]. Compound 109 (S,E)-3-((3-(4-(4- (dimethylamino)but-2- enamido)benzamido) phenyl)amino)-N-(2- hydroxy-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo[3,4-c] pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.68 (s, 1H), 10.13 (s, 1H), 10.01 (s, 1H), 8.43 (s, 1H), 8.03 (d, J = 8.8 Hz, 2H), 7.88 (d, J = 8.8 Hz, 2H), 7.54 (s, 1H), 7.41-7.39 (m, 2H), 7.34-7.30 (m, 2H), 7.27-7.22 (m, 3H), 6.92-6.82 (m, 2H), 6.58 (d, J = 15.6 Hz, 1H), 6.13 (d, J = 8.0 Hz, 1H), 4.85 (q, J = 6.8 Hz, 1H), 4.48 (q, J = 11.2 Hz, 2H), 4.06 (d, J = 7.2 Hz, 2H), 3.63 (d, J = 6.4 Hz, 2H), 2.91 (s, 6H), 2.64 (t, J = 5.6 Hz, 1H), 1.73 (s, 3H), 1.67 (s, 3H); MS m/z: 637.3 [M + 1]. Compound 110 (S)-3-((3- acrylamidophenyl) amino)-N-(2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 9.94 (s, 1H), 8.90 (s, 1H), 8.24 (s, 1H), 7.35-7.27 (m, 4H), 7.24-7.22 (m, 2H), 7.08-7.02 (m, 2H), 6.56-6.52 (m, 2H), 6.38 (dd, J = 16.8, 10.0 Hz, 1H), 6.16 (dd, J = 16.8, 2.0 H, 1H), 5.29-5.22 (m, 1H), 4.31 (q, J = 11.2 Hz, 2H), 3.39-3.34 (m, 1H), 3.28-3.22 (m, 1H), 2.80 (d, J = 4.8 Hz, 1H), 2.73 (d, J = 4.8 Hz, 1H), 1.59 (s, 3H), 1.53 (s, 3H); MS m/z: 488.3 [M + 1]. Compound 111 (S)-3-((4- acrylamidophenyl) amino)-N-(2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 9.86 (s, 1H), 8.91 (s, 1H), 8.13 (s, 1H), 7.49-7.43 (m, 2H), 7.40-7.27 (m, 5H), 7.22 (m, 1H), 6.82 (d, J = 9.2 Hz, 1H), 6.55 (d, J = 9.2 Hz, 1H), 6.34 (dd, J = 16.8, 10.0 Hz, 1H), 6.13 (dd, J = 16.8, 2.0 Hz, 1H), 5.62 (dd, J = 10.0, 2.0 Hz, 1H), 5.29- 5.22 (m, 1H), 4.33 (d, J = 11.2 Hz, 1H), 4.19 (d, J = 11.2 Hz, 1H), 3.42- 3.36 (m, 1H), 3.29-3.23 (m, 1H), 2.81 (d, J = 4.8 Hz, 1H), 2.74 (d, J = 4.8 Hz, 1H), 1.60 (s, 3H), 1.51 (s, 3H); MS m/z: 488.3 [M + 1]. Compound 112 (S)-3-(3-(4- acrylamidobenzamido) benzamido)-N-(2- (dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.97 (s, 1H), 10.53 (s, 1H), 10.40 (s, 1H), 9.04 (s, 1H), 8.62 (m, 1H), 8.04 (d, J = 9.2 Hz, 2H), 7.89 (d, J = 9.2 Hz, 2H), 7.83 (d, J = 7.6 Hz, 1H), 7.57-7.44 (m, 4H), 7.36 (t, J = 7.2 Hz, 1H), 6.83 (d, J = 9.2 Hz, 1H), 6.54 (dd, J = 17.2, 10.0 Hz, 1H), 6.37 (dd, J = 17.2, 2.0 Hz, 1H), 5.88 (dd, J = 10.0, 2.0 Hz, 1H), 5.43- 5.37 (m, 1H), 4.86 (d, J = 12.4 Hz, 1H), 4.64 (d, J = 11.6 Hz, 1H), 2.95 (d, J = 8.4 Hz, 3H), 2.90 (d, J = 8.4 Hz, 3H), 1.74 (s, 3H), 1.66 (s, 3H); MS m/z: 635.3 [M + 1]. Compound 113 3-((R)-1- acryloylpiperidine- 3-carboxamido)-N- ((S)-2-(dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.56 (d, J = 19.8 Hz, 1H), 8.95 (s, 1H), 7.41-7.36 (m, 3H), 7.31-7.27 (m, 1H), 6.87-6.79 (m, 1H), 6.72 (d, J = 9.0 Hz, 1H), 6.08 (d, J = 16.2 Hz, 1H),5.66 (d, J = 10.2 Hz, 1H), 5.32 (m, 1H), 4.69 (m, 1H), 4.47 (m, 2H), 4.03 (m, 2H), 3.53 (t, J = 12.0 Hz, 2H), 3.35-3.30 (m, 1H), 3.18-3.12 (m, 1H), 2.99 (t, J = 13.2 Hz, 1H), 2.85 (d, J = 5.4 Hz, 3H), 2.82 (d, J = 4.8 Hz, 3H), 2.70 (t, J = 12.0 Hz, 1H), 1.95 (m, 1H), 1.73 (m, 1H), 1.62 (s, 3H), 1.53 (s, 3H), 1.33 (m, 1H); MS m/z: 508.3 [M + 1]. Compound 114 3-((S)-1- acryloylpiperidine- 3-carboxamido)- N-((S)-2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.50 (d, J = 15.6 Hz, 1H), 8.90 (s, 1H), 7.37-7.31 (m, 4H), 7.25-7.21 (m, 1H), 6.82-6.72 (m, 1H), 6.66 (d, J = 8.8 Hz, 1H), 6.03 (d, J = 16.4 Hz, 1H), 5.61 (d, J = 10.8 Hz, 1H), 5.27 (m, 1H), 4.62 (m, 1H), 4.43 (m, 2H), 4.07-3.96 (m, 2H), 3.13-3.05 (m, 2H), 2.94 (t, J = 12.0 Hz, 1H), 2.81 (d, J = 5.2 Hz, 3H), 2.77 (d, J = 5.2 Hz, 3H), 2.69-2.57 (m, 1H), 1.89 (m, 1H), 1.67 (m, 1H), 1.57 (s, 3H), 1.49 (s, 3H), 1.29 (m, 1H); MS m/z: 508.3 [M + 1]. Compound 115 3-((1-(4- acrylamidobenzoyl) piperidin-3-yl) amino)-N-((S)-2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.29 (s, 1H), 9.10 (s, 1H), 7.72-7.55 (m, 1H), 7.49-7.26 (m, 7H), 6.73-6.61 (m, 1H), 6.49-6.40 (m, 1H), 6.27-6.24 (m, 1H), 5.77-5.75 (m, 1H), 5.36-5.26 (m, 1H), 4.55-4.50 (m, 1H), 4.30-4.24 (m, 2H), 3.55-3.45 (m, 3H), 3.38-3.32 (m, 2H), 3.28-3.07 (m, 2H), 2.88 (m, 3H), 2.85 (m, 1H), 2.82 (m, 3H), 2.00-1.90 (m, 1H), 1.85-1.70 (m, 1H), 1.65-1.50 (m, 6H), 1.09-1.03 (m, 1H); MS m/z: 599.4 [M + 1]. Compound 116 (S)-3-((1-(4- acrylamidobenzoyl) piperidin-4-yl) amino)-N-(2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR: 600 MHz (DMSO-d6) δ 11.30 (br, 1H), 10.30 (s, 1H), 7.71 (d, J = 9.0 Hz, 2H), 7.36-7.33 (m, 4H), 7.28 (t, J = 7.8 Hz, 2H), 7.18 (t, J = 7.8 Hz, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 5.95 (d, J = 6.0 Hz, 1H), 5.77 (dd, J = 10.2, 2.2 Hz, 1H), 5.33-5.20 (m, 1H), 4.82 (q, J = 7.2 Hz, 1H), 4.26 (q, J = 12.0 Hz, 2H), 3.72-3.58 (m, 1H), 3.16-3.03 (m, 2H), 2.60 (m, 1H), 2.42 (m, 1H), 2.19 (s, 6H), 1.89 (m, 2H), 1.54 (s, 3H), 1.48 (s, 3H), 1.36 (m, 2H); MS m/z: 599.4 [M + 1]. Compound 117 3-(((1R,3S)-3-(4- acrylamidobenzamido) cyclohexyl)amino)- N-((S)-2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethy1-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.35 (d, J = 3.0 Hz, 1H), 9.11 (s, 1H), 8.09 (d, J = 7.8 Hz, 1H), 7.80 (dd, J = 9.0, 2.0 Hz, 2H), 7.71 (dd, J = 9.0, 1.8 Hz, 2H), 7.46- 7.42 (m, 2H), 7.39-7.35 (m, 2H), 7.30-7.28 (m, 1H), 6.68 (t, J = 7.8 Hz, 1H), 6.44 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 5.78 (dd, J = 10.2, 2.2 Hz, 1H), 5.34- 5.30 (m, 1H), 4.52 (t, J = 12.0 Hz, 1H), 4.38 (dd, J = 13.2, 12.0 Hz, 2H), 4.17-4.10 (m, 1H), 3.67 (m, 2H), 3.48 (t, J = 12.0 Hz, 2H), 3.37-3.33 (m, 2H), 2.88 (m, 3H), 2.82 (m, 3H), 1.89-1.80 (m, 2H), 1.71-1.60 (m, 3H), 1.62 (s, 3H), 1.55 (s, 3H), 1.36 (m, 2H); MS m/z: 613.4 [M + 1]. Compound 118 3-(((lR,3R)-3-(4- acrylamidobenzamido) cyclohexyl)amino)- N-((S)-2- (dimethylamino)- 1-phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 11H NMR: 600 MHz (DMSO-d6) δ 11.22 (br, 1H), 10.32 (s, 1H), 8.19 (dd, J = 7.8, 3.0 Hz, 1H), 7.81 (dd, J = 8.4, 3.0 Hz, 2H), 7.70 (dd, J = 8.4, 5.4 Hz, 2H), 7.35 (d, J = 7.8 Hz, 2H), 7.30-7.26 (m, 2H), 7.20- 7.16 (m, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 6.01 (m, 1H), 5.77 (dd, J = 10.2, 2.2 Hz, 1H), 5.25-5.17 (m, 1H), 4.89-4.82 (m, 1H), 4.36-4.27 (m, 2H), 3.90-3.83 (m, 1H), 3.08-3.01 (m, 1H), 2.68- 2.60 (m, 1H), (s, 3H), 2.13-2.08 (m, 1H), 1.92-1.86 (m, 1H), 1.85- 1.79 (m, 1H), 1.78-1.73 (m, 1H), 1.54 (s, 3H), 1.48 (d, J = 5.4 Hz, 3H), 1.42-1.35 (m, 1H), 1.28- 1.19 (m, 2H), 1.11-1.03 (m, 1H); MS m/z: 613.4 [M + 1]. Compound 119 (S)-3-((4-(4- acrylamidobenzamido) cyclohexyl)amino)-N- (2-(dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR: 600 MHz (DMSO-d6) δ 11.30 (br, 1H), 10.32 (s, 1H), 8.11 (d, J = 7.8 Hz, 1H), 7.80 (d, J = 8.4 Hz, 2H), 7.71 (d, J = 8.4 Hz, 2H), 7.37 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (d, J = 16.8 Hz, 1H), 6.13 (m, 1H), 5.78 (d, J = 10.2, Hz, 1H), 5.13-4.94 (m, 2H), 4.35-4.26 (m, 2H), 3.75-3.49 (m, 1H), 3.47 (t, J = 5.4 Hz, 1H), 3.40 (t, J = 5.4 Hz, 1H), 3.07-2.97 (m, 2H), 2.50-2.32 (m, 4H), 1.98 (d, J = 10.8 Hz, 3H), 1.87 (d, J = 10.2 Hz, 3H), 1.77-1.70 (m, 1H), 1.67-1.60 (m, 1H), 1.56 (s, 3H), 1.49 (s, 3H), 1.47- 1.38 (m, 2H), 1.37-1.33 (m, 1H), 1.29-1.17 (m, 4H), 1.15 (t, J = 7.2 Hz, 1H), 0.85-0.76 (m, 1H); MS m/z: 613.4 [M + 1]. Compound 120 Compound 121 Compound 122 Compound 123 Compound 124 Compound 125 Compound 126 Compound 127 - The pharmaceutical compositions described herein may be useful in treating and/or preventing proliferative diseases (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject. The compositions described herein may also be useful for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell. The compositions described herein may also be useful for inducing apoptosis in a cell.
- The present disclosure provides pharmaceutical compositions comprising a compound described herein (e.g., a compound of Formula (I)), or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, and optionally a pharmaceutically acceptable excipient. In certain embodiments, the pharmaceutical composition of the invention comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and optionally a pharmaceutically acceptable excipient. In certain embodiments, a pharmaceutical composition described herein comprises a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient. In certain embodiments, the compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, is provided in an effective amount in the pharmaceutical composition.
- In certain embodiments, the effective amount is a therapeutically effective amount (e.g., amount effective for treating a proliferative disease in a subject in need thereof). In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject in need thereof. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a cell. In certain embodiments, the effective amount is an amount effective for inducing apoptosis in a cell. In certain embodiments, the effective amount is a prophylactically effective amount (e.g., amount effective for preventing a proliferative disease in a subject in need thereof and/or for keeping a subject in need thereof in remission of a proliferative disease).
- In certain embodiments, a protein kinase described herein is a CDK. In certain embodiments, a protein kinase described herein is CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK11, CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19, or CDK20. In certain embodiments, a protein kinase described herein is CDK7. In certain embodiments, a protein kinase described herein is CDK12. In certain embodiments, a protein kinase described herein is CDK13. In certain embodiments, a protein kinase described herein is a Src family kinase. In certain embodiments, a protein kinase described herein is SRC. In certain embodiments, a protein kinase described herein is FGR. In certain embodiments, a protein kinase described herein is BUB1B. In certain embodiments, a protein kinase described herein is CHEK2. In certain embodiments, a protein kinase described herein is HIPK4. In certain embodiments, a protein kinase described herein is PRKCQ. In certain embodiments, a protein kinase described herein is RET. In certain embodiments, a protein kinase described herein is MELK. In certain embodiments, a protein kinase described herein is IRAK1, IRAK4, BMX, or PI3K. In certain embodiments, a protein kinase described herein is ABL, ARG, BLK, CSK, EphB1, EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, or TEC. In certain embodiments, a protein kinase described herein is ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), PDGFRB, SRC, YES, ABL1(H396P)-nonphosphorylated, ABL1(Y253F)-phosphorylated, ABL1-nonphosphorylated, FRK, LYN, ABL1(Q252H)-nonphosphorylated, DDR1, EPHB1, ERBB4, p38-alpha, ABL2, ABL1(Q252H)-phosphorylated, SIK, EPHA8, MEK5, ABL1(E255K)-phosphorylated, ABL1(F317L)-nonphosphorylated, FYN, LCK, EPHA2, ABL1(M351T)-phosphorylated, TXK, EGFR(L858R), EGFR(L861Q), ERBB2, ERBB3, EPHA5, ABL1(F317I)-nonphosphorylated, EGFR(L747-E749del, A750P), CSK, EPHA1, ABL1(F317L)-phosphorylated, BRAF(V600E), EGFR, KIT-autoinhibited, or EGFR(E746-A750del). In certain embodiments, a protein kinase described herein is ABL1(F317L)-nonphosphorylated, ABL1(H396P)-nonphosphorylated, ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), LYN, PDGFRB, SRC, YES, ABL1-nonphosphorylated, ABL1(Y253F)-phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABL1(F317I)-nonphosphorylated, DDR1, EPHA2, ABL1(Q252H)-phosphorylated, MEK5, ABL1(Q252H)-nonphosphorylated, ABL2, FYN, EPHB1, ABL1(E255K)-phosphorylated, ABL1(F317L)-phosphorylated, EPHA1, ABL1(M351T)-phosphorylated, ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q), CSF1R-autoinhibited, BRAF(V600E), BRK, CSK, KIT(D816V), KIT-autoinhibited, EGFR(L747-T751del,Sins), EGFR(L858R), EGFR(L747-E749del, A750P), or CSF1R.
- In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) by at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 98%. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) by not more than 10%, not more than 20%, not more than 30%, not more than 40%, not more than 50%, not more than 60%, not more than 70%, not more than 80%, not more than 90%, not more than 95%, or not more than 98%. In certain embodiments, the effective amount is an amount effective for inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) by a range between a percentage described in this paragraph and another percentage described in this paragraph, inclusive.
- Pharmaceutical compositions described herein can be prepared by any method known in the art of pharmacology. In general, such preparatory methods include bringing the compound described herein (i.e., the “active ingredient”) into association with a carrier or excipient, and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping, and/or packaging the product into a desired single- or multi-dose unit.
- Pharmaceutical compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. A “unit dose” is a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage, such as one-half or one-third of such a dosage.
- Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition described herein will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. The composition may comprise between 0.1% and 100% (w/w) active ingredient.
- Pharmaceutically acceptable excipients used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
- Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, and mixtures thereof.
- Exemplary granulating and/or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose, and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and mixtures thereof.
- Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and Veegum (magnesium aluminum silicate)), long chain amino acid derivatives, high molecular weight alcohols (e.g., stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g., carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g., carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monolaurate (Tween® 20), polyoxyethylene sorbitan (Tween® 60), polyoxyethylene sorbitan monooleate (Tween® 80), sorbitan monopalmitate (Span® 40), sorbitan monostearate (Span® 60), sorbitan tristearate (Span® 65), glyceryl monooleate, sorbitan monooleate (Span® 80), polyoxyethylene esters (e.g., polyoxyethylene monostearate (Myrj© 45), polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol*), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g., Cremophor®), polyoxyethylene ethers, (e.g., polyoxyethylene lauryl ether (Brij© 30)), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic® F-68, poloxamer P-188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, and/or mixtures thereof.
- Exemplary binding agents include starch (e.g., cornstarch and starch paste), gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g., acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum©), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, and/or mixtures thereof.
- Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, antiprotozoan preservatives, alcohol preservatives, acidic preservatives, and other preservatives. In certain embodiments, the preservative is an antioxidant. In other embodiments, the preservative is a chelating agent.
- Exemplary antioxidants include alpha tocopherol, ascorbic acid, ascorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
- Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof. Exemplary antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
- Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
- Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
- Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
- Other preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant® Plus, Phenonip©, methylparaben, Germall® 115, Germaben® II, Neolone®, Kathon®, and Euxyl®.
- Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, and mixtures thereof.
- Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
- Exemplary natural oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary synthetic oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and mixtures thereof.
- Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredients, the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. In certain embodiments for parenteral administration, the conjugates described herein are mixed with solubilizing agents such as Cremophor®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and mixtures thereof.
- Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation can be a sterile injectable solution, suspension, or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or di-glycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables.
- The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- In order to prolong the effect of a drug, it is often desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution, which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form may be accomplished by dissolving or suspending the drug in an oil vehicle.
- Compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing the conjugates described herein with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol, or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or (a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, (b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, (c) humectants such as glycerol, (d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, (e) solution retarding agents such as paraffin, (f) absorption accelerators such as quaternary ammonium compounds, (g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, (h) absorbents such as kaolin and bentonite clay, and (i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets, and pills, the dosage form may include a buffering agent.
- Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the art of pharmacology. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of encapsulating compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- The active ingredient can be in a micro-encapsulated form with one or more excipients as noted above. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings, and other coatings well known in the pharmaceutical formulating art. In such solid dosage forms the active ingredient can be admixed with at least one inert diluent such as sucrose, lactose, or starch. Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose. In the case of capsules, tablets and pills, the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of encapsulating agents which can be used include polymeric substances and waxes.
- Dosage forms for topical and/or transdermal administration of a compound described herein may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants, and/or patches. Generally, the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier or excipient and/or any needed preservatives and/or buffers as can be required. Additionally, the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body. Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium. Alternatively or additionally, the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.
- Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices. Intradermal compositions can be administered by devices which limit the effective penetration length of a needle into the skin. Alternatively or additionally, conventional syringes can be used in the classical mantoux method of intradermal administration. Jet injection devices which deliver liquid formulations to the dermis via a liquid jet injector and/or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable. Ballistic powder/particle delivery devices which use compressed gas to accelerate the compound in powder form through the outer layers of the skin to the dermis are suitable.
- Formulations suitable for topical administration include, but are not limited to, liquid and/or semi-liquid preparations such as liniments, lotions, oil-in-water and/or water-in-oil emulsions such as creams, ointments, and/or pastes, and/or solutions and/or suspensions. Topically administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
- A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers, or from about 1 to about 6 nanometers. Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and/or using a self-propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container. Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers. Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
- Low boiling propellants generally include liquid propellants having a boiling point of below 65° F. at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition. The propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
- Pharmaceutical compositions described herein formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension. Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate. The droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.
- Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition described herein. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered by rapid inhalation through the nasal passage from a container of the powder held close to the nares.
- Formulations for nasal administration may, for example, comprise from about as little as 0.1% (w/w) to as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein. A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient. Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
- A pharmaceutical composition described herein can be prepared, packaged, and/or sold in a formulation for ophthalmic administration. Such formulations may, for example, be in the form of eye drops including, for example, a 0.1-1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid carrier or excipient. Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein. Other opthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are also contemplated as being within the scope of this disclosure.
- Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation.
- The compounds provided herein are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions described herein will be decided by a physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the disease being treated and the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex, and diet of the subject; the time of administration, route of administration, and rate of excretion of the specific active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.
- The compounds and compositions provided herein can be administered by any route, including enteral (e.g., oral), parenteral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol. Specifically contemplated routes are oral administration, intravenous administration (e.g., systemic intravenous injection), regional administration via blood and/or lymph supply, and/or direct administration to an affected site. In general, the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), and/or the condition of the subject (e.g., whether the subject is able to tolerate oral administration). In certain embodiments, the compound or pharmaceutical composition described herein is suitable for topical administration to the eye of a subject.
- The exact amount of a compound required to achieve an effective amount will vary from subject to subject, depending, for example, on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound, mode of administration, and the like. An effective amount may be included in a single dose (e.g., single oral dose) or multiple doses (e.g., multiple oral doses). In certain embodiments, when multiple doses are administered to a subject or applied to a biological sample, tissue, or cell, any two doses of the multiple doses include different or substantially the same amounts of a compound described herein. In certain embodiments, when multiple doses are administered to a subject or applied to a biological sample, tissue, or cell, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses a day, two doses a day, one dose a day, one dose every other day, one dose every third day, one dose every week, one dose every two weeks, one dose every three weeks, or one dose every four weeks. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is one dose per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is two doses per day. In certain embodiments, the frequency of administering the multiple doses to the subject or applying the multiple doses to the tissue or cell is three doses per day. In certain embodiments, when multiple doses are administered to a subject or applied to a biological sample, tissue, or cell, the duration between the first dose and last dose of the multiple doses is one day, two days, four days, one week, two weeks, three weeks, one month, two months, three months, four months, six months, nine months, one year, two years, three years, four years, five years, seven years, ten years, fifteen years, twenty years, or the lifetime of the subject, biological sample, tissue, or cell. In certain embodiments, the duration between the first dose and last dose of the multiple doses is three months, six months, or one year. In certain embodiments, the duration between the first dose and last dose of the multiple doses is the lifetime of the subject, biological sample, tissue, or cell. In certain embodiments, a dose (e.g., a single dose, or any dose of multiple doses) described herein includes independently between 0.1 μg and 1 μg, between 0.001 mg and 0.01 mg, between 0.01 mg and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg and 3 mg, between 3 mg and 10 mg, between 10 mg and 30 mg, between 30 mg and 100 mg, between 100 mg and 300 mg, between 300 mg and 1,000 mg, or between 1 g and 10 g, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 1 mg and 3 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 3 mg and 10 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 10 mg and 30 mg, inclusive, of a compound described herein. In certain embodiments, a dose described herein includes independently between 30 mg and 100 mg, inclusive, of a compound described herein.
- Dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult. The amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.
- A compound or composition, as described herein, can be administered in combination with one or more additional pharmaceutical agents (e.g., therapeutically and/or prophylactically active agents) useful in treating and/or preventing a proliferative disease. The compounds or compositions can be administered in combination with additional pharmaceutical agents that improve their activity (e.g., activity (e.g., potency and/or efficacy) in treating a proliferative disease in a subject in need thereof, in preventing a proliferative disease in a subject in need thereof, and/or in inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7) in a subject, biological sample, tissue, or cell), improve bioavailability, improve safety, reduce drug resistance, reduce and/or modify metabolism, inhibit excretion, and/or modify distribution in a subject, biological sample, tissue, or cell. It will also be appreciated that the therapy employed may achieve a desired effect for the same disorder, and/or it may achieve different effects. In certain embodiments, a pharmaceutical composition described herein including a compound described herein and an additional pharmaceutical agent shows a synergistic effect that is absent in a pharmaceutical composition including one of the compound and the additional pharmaceutical agent, but not both.
- The compound or composition can be administered concurrently with, prior to, or subsequent to one or more additional pharmaceutical agents, which may be useful as, e.g., combination therapies in treating and/or preventing a proliferative disease. Pharmaceutical agents include therapeutically active agents. Pharmaceutical agents also include prophylactically active agents. Pharmaceutical agents include small organic molecules such as drug compounds (e.g., compounds approved for human or veterinary use by the U.S. Food and Drug Administration as provided in the Code of Federal Regulations (CFR)), peptides, proteins, carbohydrates, monosaccharides, oligosaccharides, polysaccharides, nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides or proteins, small molecules linked to proteins, glycoproteins, steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides, oligonucleotides, antisense oligonucleotides, lipids, hormones, vitamins, and cells. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in treating a proliferative disease. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in preventing a proliferative disease. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent useful in inducing apoptosis in a cell. In certain embodiments, the additional pharmaceutical agent is a pharmaceutical agent approved by a regulatory agency (e.g., the US FDA) for treating and/or preventing a proliferative disease. Each additional pharmaceutical agent may be administered at a dose and/or on a time schedule determined for that pharmaceutical agent. The additional pharmaceutical agent(s) may also be administered together with each other and/or with the compound or composition described herein in a single dose or administered separately in different doses. The particular combination to employ in a regimen will take into account compatibility of the compound described herein with the additional pharmaceutical agent(s) and/or the desired therapeutic and/or prophylactic effect to be achieved. In general, it is expected that the additional pharmaceutical agent(s) in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- In certain embodiments, the additional pharmaceutical agent is an anti-proliferative agent (e.g., anti-cancer agent). In certain embodiments, the additional pharmaceutical agent is an anti-leukemia agent. In certain embodiments, the additional pharmaceutical agent is ABITREXATE (methotrexate), ADE, Adriamycin RDF (doxorubicin hydrochloride), Ambochlorin (chlorambucil), ARRANON (nelarabine), ARZERRA (ofatumumab), BOSULIF (bosutinib), BUSULFEX (busulfan), CAMPATH (alemtuzumab), CERUBIDINE (daunorubicin hydrochloride), CLAFEN (cyclophosphamide), CLOFAREX (clofarabine), CLOLAR (clofarabine), CVP, CYTOSAR-U (cytarabine), CYTOXAN (cyclophosphamide), ERWINAZE (Asparaginase Erwinia Chrysanthemi), FLUDARA (fludarabine phosphate), FOLEX (methotrexate), FOLEX PFS (methotrexate), GAZYVA (obinutuzumab), GLEEVEC (imatinib mesylate), Hyper-CVAD, ICLUSIG (ponatinib hydrochloride), IMBRUVICA (ibrutinib), LEUKERAN (chlorambucil), LINFOLIZIN (chlorambucil), MARQIBO (vincristine sulfate liposome), METHOTREXATE LPF (methorexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate), mitoxantrone hydrochloride, MUSTARGEN (mechlorethamine hydrochloride), MYLERAN (busulfan), NEOSAR (cyclophosphamide), ONCASPAR (Pegaspargase), PURINETHOL (mercaptopurine), PURIXAN (mercaptopurine), Rubidomycin (daunorubicin hydrochloride), SPRYCEL (dasatinib), SYNRIBO (omacetaxine mepesuccinate), TARABINE PFS (cytarabine), TASIGNA (nilotinib), TREANDA (bendamustine hydrochloride), TRISENOX (arsenic trioxide), VINCASAR PFS (vincristine sulfate), ZYDELIG (idelalisib), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is an anti-lymphoma agent. In certain embodiments, the additional pharmaceutical agent is ABITREXATE (methotrexate), ABVD, ABVE, ABVE-PC, ADCETRIS (brentuximab vedotin), ADRIAMYCIN PFS (doxorubicin hydrochloride), ADRIAMYCIN RDF (doxorubicin hydrochloride), AMBOCHLORIN (chlorambucil), AMBOCLORIN (chlorambucil), ARRANON (nelarabine), BEACOPP, BECENUM (carmustine), BELEODAQ (belinostat), BEXXAR (tositumomab and iodine 1131 tositumomab), BICNU (carmustine), BLENOXANE (bleomycin), CARMUBRIS (carmustine), CHOP, CLAFEN (cyclophosphamide), COPP, COPP-ABV, CVP, CYTOXAN (cyclophosphamide), DEPOCYT (liposomal cytarabine), DTIC-DOME (dacarbazine), EPOCH, FOLEX (methotrexate), FOLEX PFS (methotrexate), FOLOTYN (pralatrexate), HYPER-CVAD, ICE, IMBRUVICA (ibrutinib), INTRON A (recombinant interferon alfa-2b), ISTODAX (romidepsin), LEUKERAN (chlorambucil), LINFOLIZIN (chlorambucil), Lomustine, MATULANE (procarbazine hydrochloride), METHOTREXATE LPF (methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate), MOPP, MOZOBIL (plerixafor), MUSTARGEN (mechlorethamine hydrochloride), NEOSAR (cyclophosphamide), OEPA, ONTAK (denileukin diftitox), OPPA, R-CHOP, REVLIMID (lenalidomide), RITUXAN (rituximab), STANFORD V, TREANDA (bendamustine hydrochloride), VAMP, VELBAN (vinblastine sulfate), VELCADE (bortezomib), VELSAR (vinblastine sulfate), VINCASAR PFS (vincristine sulfate), ZEVALIN (ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is an anti-myelodysplasia agent. In certain embodiments, the additional pharmaceutical agent is REVLIMID (lenalidomide), DACOGEN (decitabine), VIDAZA (azacitidine), CYTOSAR-U (cytarabine), IDAMYCIN (idarubicin), CERUBIDINE (daunorubicin), or a combination thereof.
- In certain embodiments, the additional pharmaceutical agent is an anti-macroglobulinemia agent.
- In certain embodiments, the additional pharmaceutical agent is LEUKERAN (chlorambucil), NEOSAR (cyclophosphamide), FLUDARA (fludarabine), LEUSTATIN (cladribine), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is ABITREXATE (methotrexate), ABRAXANE (paclitaxel albumin-stabilized nanoparticle formulation), AC, AC-T, ADE, ADRIAMYCIN PFS (doxorubicin hydrochloride), ADRUCIL (fluorouracil), AFINITOR (everolimus), AFINITOR DISPERZ (everolimus), ALDARA (imiquimod), ALIMTA (pemetrexed disodium), AREDIA (pamidronate disodium), ARIMIDEX (anastrozole), AROMASIN (exemestane), AVASTIN (bevacizumab), BECENUM (carmustine), BEP, BICNU (carmustine), BLENOXANE (bleomycin), CAF, CAMPTOSAR (irinotecan hydrochloride), CAPOX, CAPRELSA (vandetanib), CARBOPLATIN-TAXOL, CARMUBRIS (carmustine), CASODEX (bicalutamide), CEENU (lomustine), CERUBIDINE (daunorubicin hydrochloride), CERVARIX (recombinant HPV bivalent vaccine), CLAFEN (cyclophosphamide), CMF, COMETRIQ (cabozantinib-s-malate), COSMEGEN (dactinomycin), CYFOS (ifosfamide), CYRAMZA (ramucirumab), CYTOSAR-U (cytarabine), CYTOXAN (cyclophosphamide), DACOGEN (decitabine), DEGARELIX, DOXIL (doxorubicin hydrochloride liposome), DOXORUBICIN HYDROCHLORIDE, DOX-SL (doxorubicin hydrochloride liposome), DTIC-DOME (dacarbazine), EFUDEX (fluorouracil), ELLENCE (epirubicin hydrochloride), ELOXATIN (oxaliplatin), ERBITUX (cetuximab), ERIVEDGE (vismodegib), ETOPOPHOS (etoposide phosphate), EVACET (doxorubicin hydrochloride liposome), FARESTON (toremifene), FASLODEX (fulvestrant), FEC, FEMARA (letrozole), FLUOROPLEX (fluorouracil), FOLEX (methotrexate), FOLEX PFS (methotrexate), FOLFIRI, FOLFIRI-BEVACIZUMAB, FOLFIRI-CETUXIMAB, FOLFIRINOX, FOLFOX, FU-LV, GARDASIL (recombinant human papillomavirus (HPV) quadrivalent vaccine), GEMCITABINE-CISPLATIN, GEMCITABINE-OXALIPLATIN, GEMZAR (gemcitabine hydrochloride), GILOTRIF (afatinib dimaleate), GLEEVEC (imatinib mesylate), GLIADEL (carmustine implant), GLIADEL WAFER (carmustine implant), HERCEPTIN (trastuzumab), HYCAMTIN (topotecan hydrochloride), IFEX (ifosfamide), IFOSFAMIDUM (ifosfamide), INLYTA (axitinib), INTRON A (recombinant interferon alfa-2b), IRESSA (gefitinib), IXEMPRA (ixabepilone), JAKAFI (ruxolitinib phosphate), JEVTANA (cabazitaxel), KADCYLA (ado-trastuzumab emtansine), KEYTRUDA (pembrolizumab), KYPROLIS (carfilzomib), LIPODOX (doxorubicin hydrochloride liposome), LUPRON (leuprolide acetate), LUPRON DEPOT (leuprolide acetate), LUPRON DEPOT-3 MONTH (leuprolide acetate), LUPRON DEPOT-4 MONTH (leuprolide acetate), LUPRON DEPOT-PED (leuprolide acetate), MEGACE (megestrol acetate), MEKINIST (trametinib), METHAZOLASTONE (temozolomide), METHOTREXATE LPF (methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate), MITOXANTRONE HYDROCHLORIDE, MITOZYTREX (mitomycin c), MOZOBIL (plerixafor), MUSTARGEN (mechlorethamine hydrochloride), MUTAMYCIN (mitomycin c), MYLOSAR (azacitidine), NAVELBINE (vinorelbine tartrate), NEOSAR (cyclophosphamide), NEXAVAR (sorafenib tosylate), NOLVADEX (tamoxifen citrate), NOVALDEX (tamoxifen citrate), OFF, PAD, PARAPLAT (carboplatin), PARAPLATIN (carboplatin), PEG-INTRON (peginterferon alfa-2b), PEMETREXED DISODIUM, PERJETA (pertuzumab), PLATINOL (cisplatin), PLATINOL-AQ (cisplatin), POMALYST (pomalidomide), prednisone, PROLEUKIN (aldesleukin), PROLIA (denosumab), PROVENGE (sipuleucel-t), REVLIMID (lenalidomide), RUBIDOMYCIN (daunorubicin hydrochloride), SPRYCEL (dasatinib), STIVARGA (regorafenib), SUTENT (sunitinib malate), SYLATRON (peginterferon alfa-2b), SYLVANT (siltuximab), SYNOVIR (thalidomide), TAC, TAFINLAR (dabrafenib), TARABINE PFS (cytarabine), TARCEVA (erlotinib hydrochloride), TASIGNA (nilotinib), TAXOL (paclitaxel), TAXOTERE (docetaxel), TEMODAR (temozolomide), THALOMID (thalidomide), TOPOSAR (etoposide), TORISEL (temsirolimus), TPF, TRISENOX (arsenic trioxide), TYKERB (lapatinib ditosylate), VECTIBIX (panitumumab), VEIP, VELBAN (vinblastine sulfate), VELCADE (bortezomib), VELSAR (vinblastine sulfate), VEPESID (etoposide), VIADUR (leuprolide acetate), VIDAZA (azacitidine), VINCASAR PFS (vincristine sulfate), VOTRIENT (pazopanib hydrochloride), WELLCOVORIN (leucovorin calcium), XALKORI (crizotinib), XELODA (capecitabine), XELOX, XGEVA (denosumab), XOFIGO (radium 223 dichloride), XTANDI (enzalutamide), YERVOY (ipilimumab), ZALTRAP (ziv-aflibercept), ZELBORAF (vemurafenib), ZOLADEX (goserelin acetate), ZOMETA (zoledronic acid), ZYKADIA (ceritinib), ZYTIGA (abiraterone acetate), or a combination thereof. In certain embodiments, the additional pharmaceutical agent is a protein kinase inhibitor (e.g., tyrosine protein kinase inhibitor). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a Src family kinase. In certain embodiments, the additional pharmaceutical agent is a CDK inhibitor. In certain embodiments, the additional pharmaceutical agent is a CDK7 inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of IRAK1, IRAK4, BMX, and PI3K. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of BUB1B, CDK2, CDK9, CHEK2, FGR, HIPK4, PRKCQ, RET, SRC, or MELK. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL, ARG, BLK, CSK, EphB1, EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, and TEC. In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), PDGFRB, SRC, YES, ABL1(H396P)-nonphosphorylated, ABL1(Y253F)-phosphorylated, ABL1-nonphosphorylated, FRK, LYN, ABL1(Q252H)-nonphosphorylated, DDR1, EPHB1, ERBB4, p38-alpha, ABL2, ABL1(Q252H)-phosphorylated, SIK, EPHA8, MEK5, ABL1(E255K)-phosphorylated, ABL1(F317L)-nonphosphorylated, FYN, LCK, EPHA2, ABL1(M351T)-phosphorylated, TXK, EGFR(L858R), EGFR(L861Q), ERBB2, ERBB3, EPHA5, ABL1(F317I)-nonphosphorylated, EGFR(L747-E749del, A750P), CSK, EPHA1, ABL1(F317L)-phosphorylated, BRAF(V600E), EGFR, KIT-autoinhibited, and EGFR(E746-A750del). In certain embodiments, the additional pharmaceutical agent is an inhibitor of one or more protein kinases selected from the group consisting of ABL1(F317L)-nonphosphorylated, ABL1(H396P)-nonphosphorylated, ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4, JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), LYN, PDGFRB, SRC, YES, ABL1-nonphosphorylated, ABL1(Y253F)-phosphorylated, ERBB3, FGR, FRK, p38-alpha, ABL1(F317I)-nonphosphorylated, DDR1, EPHA2, ABL1(Q252H)-phosphorylated, MEK5, ABL1(Q252H)-nonphosphorylated, ABL2, FYN, EPHB1, ABL1(E255K)-phosphorylated, ABL1(F317L)-phosphorylated, EPHA1, ABL1(M351T)-phosphorylated, ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q), CSF1R-autoinhibited, BRAF(V600E), BRK, CSK, KIT(D816V), KIT-autoinhibited, EGFR(L747-T751del,Sins), EGFR(L858R), EGFR(L747-E749del, A750P), and CSF1R. In certain embodiments, the additional pharmaceutical agent is an anti-angiogenesis agent, anti-inflammatory agent, immunosuppressant, anti-bacterial agent, anti-viral agent, cardiovascular agent, cholesterol-lowering agent, anti-diabetic agent, anti-allergic agent, pain-relieving agent, or a combination thereof. In certain embodiments, the compounds described herein or pharmaceutical compositions can be administered in combination with an anti-cancer therapy including, but not limited to, transplantation (e.g., bone marrow transplantation, stem cell transplantation), surgery, radiation therapy, immunotherapy, and chemotherapy.
- Also encompassed by the disclosure are kits (e.g., pharmaceutical packs). The kits provided may comprise a pharmaceutical composition or compound described herein and a container (e.g., a vial, ampule, bottle, syringe, and/or dispenser package, or other suitable container). In some embodiments, provided kits may optionally further include a second container comprising a pharmaceutical excipient for dilution or suspension of a pharmaceutical composition or compound described herein. In some embodiments, the pharmaceutical composition or compound described herein provided in the first container and the second container are combined to form one unit dosage form.
- The present invention also provides methods for the treatment or prevention of a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases).
- The compounds described herein may:
-
- exhibit kinase inhibitory activity,
- exhibit the ability to inhibit cyclin-dependent kinase (CDK),
- exhibit the ability to inhibit cyclin-dependent kinase 7 (CDK7),
- exhibit the ability to inhibit cyclin-dependent kinase 7 (CDK7), without inhibiting another cyclin-dependent kinase (CDK),
- exhibit a therapeutic effect and/or preventative effect in the treatment of cancers,
- exhibit a therapeutic effect and/or preventative effect in the treatment of Myc-dependent cancers, and/or
- exhibit a therapeutic profile (e.g., optimum safety and curative effect) that is superior to existing chemotherapeutic agents.
- Without wishing to be bound by any particular theory, the compounds described herein may be able to bind (e.g., covalently modify) a protein kinase described herein. In certain embodiments, the R2 group of a compound described herein may be able to bind (e.g., covalently modify) to the protein kinase. In certain embodiments, the R2 group of a compound described herein may be able to covalently bind a cysteine residue of the protein kinase. In certain embodiments, the R2 group of a compound described herein may be able to covalently bind Cys312 residue of CDK7.
- In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a subject, the methods comprising administering to the subject an effective amount (e.g., therapeutically effective amount) of a compound, or pharmaceutical composition thereof, as described herein.
- In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a biological sample, the methods comprising contacting the biological sample with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
- In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a tissue, the methods comprising contacting the tissue with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
- In another aspect, the present disclosure provides methods of inhibiting the activity of a protein kinase in a cell, the methods comprising contacting the cell with an effective amount of a compound, or pharmaceutical composition thereof, as described herein.
- In certain embodiments, the subject being treated is a mammal. In certain embodiments, the subject is a human. In certain embodiments, the subject is a domesticated animal, such as a dog, cat, cow, pig, horse, sheep, or goat. In certain embodiments, the subject is a companion animal such as a dog or cat. In certain embodiments, the subject is a livestock animal such as a cow, pig, horse, sheep, or goat. In certain embodiments, the subject is a zoo animal. In another embodiment, the subject is a research animal such as a rodent, dog, or non-human primate. In certain embodiments, the subject is a non-human transgenic animal such as a transgenic mouse or transgenic pig.
- In certain embodiments, a biological sample described herein is bone marrow, lymph node, spleen, or blood.
- In certain embodiments, a cell described herein is in vitro. In certain embodiments, a cell described herein is ex vivo. In certain embodiments, a cell described herein is in vivo. In certain embodiments, a cell described herein is a malignant cell (e.g., malignant blood cell). In certain embodiments, a cell described herein is a malignant hematopoietic stem cell (e.g., malignant myeloid cell or malignant lymphoid cell). In certain embodiments, a cell described herein is a malignant lymphocyte (e.g., malignant T-cell or malignant B-cell). In certain embodiments, a cell described herein is a malignant red blood cell, malignant white blood cell, or malignant platelet. In certain embodiments, a cell described herein is a malignant neutrophil, malignant macrophage, or malignant plasma cell.
- The proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a kinase, such as cyclin-dependent kinase (CDK). The process of eukaryotic cell division may be broadly divided into a series of sequential phases termed G1, S, G2, and M. Correct progression through the various phases of the cell cycle has been shown to be critically dependent upon the spatial and temporal regulation of a family of proteins known as cyclin dependent kinases (CDKs) and a diverse set of their cognate protein partners termed cyclins. CDKs are CDCl2 (also known as CDK1) homologous serine-threonine kinase proteins that are able to utilize ATP as a substrate in the phosphorylation of diverse polypeptides in a sequence-dependent context. Cyclins are a family of proteins characterized by a homology region, containing approximately 100 amino acids, termed the “cyclin box” which is used in binding to, and defining selectivity for, specific CDK partner proteins.
- Modulation of the expression levels, degradation rates, protein levels, and activity levels of various CDKs and cyclins throughout the cell cycle leads to the cyclical formation of a series of CDK/cyclin complexes, in which the CDKs are enzymatically active. The formation of these complexes controls passage through discrete cell cycle checkpoints and thereby enables the process of cell division to continue. Failure to satisfy the prerequisite biochemical criteria at a given cell cycle checkpoint, i.e., failure to form a required CDK/cyclin complex, can lead to cell cycle arrest and/or cellular apoptosis. Aberrant cellular proliferation can often be attributed to loss of correct cell cycle control. Inhibition of CDK enzymatic activity therefore provides a means by which abnormally dividing cells can have their division arrested and/or be killed. The diversity of CDKs, and CDK complexes, and their critical roles in mediating the cell cycle, provides a broad spectrum of potential therapeutic targets selected on the basis of a defined biochemical rationale.
- CDK7, a member of the CDK family, was originally isolated as the catalytic subunit of the trimeric CDK-activating kinase (CAK) complex. This complex, consisting of CDK7, cyclin H, and MAT1, is responsible for activation of the mitotic promoting factor in vitro. The discovery that CDK7 was also a component of the basal transcription repair factor IIH (TFIIH) implicated a dual role for CDK7 in transcription as part of TFIIH and in the control of the cell cycle as the trimeric CAK complex. TFIIH is a multi-subunit protein complex identified as a factor required for RNA polymerase II (RNAP II)-catalyzed transcription, and subsequently this complex was found to play a key role in nucleotide excision repair. CDK7 is a component of at least three complexes, i.e., the trimeric CAK complex, the quaternary complex with the XPD (or ERCC2, a protein involved in transcription-coupled nucleotide excision repair), and the nine-subunit TFIIH complex. The two functions of CDK7 in CAK and CTD phosphorylation support critical facets of cellular proliferation, cell cycling, and transcription. Overexpression of CDK7 may inhibit apoptosis, promote transcription and cell proliferation, and/or disrupt DNA repair, and therefore, cause proliferative diseases. In certain embodiments, the proliferative disease to be treated or prevented using the compounds described herein may be associated with overexpression of a CDK (e.g., CDK7).
- A proliferative disease may be associated with aberrant activity of a CDK (e.g., CDK7). Aberrant activity of a CDK (e.g., CDK7) may be an elevated and/or an inappropriate activity of the CDK. Deregulation of cell cycle progression is a characteristic of a proliferative disease, and a majority of proliferative diseases have abnormalities in some component of CDK (e.g., CDK7) activity, frequently through elevated and/or inappropriate CDK activation. Inhibition of the catalytic activity of CDK7 would be expected to inhibit cell cycle progression by blocking the phosphorylation of cell cycle CDKs, and would additionally inhibit transcription of effectors of cell division. In certain embodiments, CDK7 is not overexpressed, and the activity of CDK7 is elevated and/or inappropriate. In certain other embodiments, CDK7 is overexpressed, and the activity of CDK7 is elevated and/or inappropriate. The compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may inhibit the activity of CDK7 and be useful in treating and/or preventing proliferative diseases.
- A proliferative disease may also be associated with inhibition of apoptosis of a cell in a biological sample or subject. All types of biological samples described herein or known in the art are contemplated as being within the scope of the invention. Apoptosis is the process of programmed cell death. Inhibition of apoptosis may result in uncontrolled cell proliferation and, therefore, may cause proliferative diseases. The cell cycle CDKs (CDK1, 2, 4, and 6) are activated by phosphorylation by CDK7/cyclin H (also called CAK). Inhibition of CDK7 would therefore result in cell-cycle arrest at multiple points in the cell cycle due to failure to activate the cell cycle CDKs. CDK 7 activates transcription by phosphorylating the CTD of RNAP II. Inhibition of CTD phosphorylation has been shown to inhibit transcription and reduce expression of short lived proteins, including those involved in apoptosis regulation. It is appreciated in the art that stalling of RNA polymerase may activate p53 (also known as protein 53 or tumor protein 53, a tumor suppressor protein that is encoded in humans by the TP53 gene), leading to apoptosis. Thus, inhibition of the activity of CDK7 are expected to cause cytotoxicity by inducing apoptosis. The compounds described herein, and pharmaceutically acceptable salts, solvates, hydrates, polymorphs, co-crystals, tautomers, stereoisomers, isotopically labeled derivatives, prodrugs, and compositions thereof, may induce apoptosis, and therefore, be useful in treating and/or preventing proliferative diseases.
- In certain embodiments, the proliferative disease to be treated or prevented using the compounds described herein is cancer. All types of cancers disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the proliferative disease is a cancer associated with dependence on BCL-2 anti-apoptotic proteins (e.g., MCL-1 and/or XIAP). In certain embodiments, the proliferative disease is a cancer associated with overexpression of MYC (a gene that codes for a transcription factor). In certain embodiments, the cancer is a MYC-dependent cancer. In certain embodiments, the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is a blood cancer. In certain embodiments, the proliferative disease is a hematological malignancy. In certain embodiments, the proliferative disease is leukemia. In certain embodiments, the proliferative disease is chronic lymphocytic leukemia (CLL). In certain embodiments, the proliferative disease is acute lymphoblastic leukemia (ALL). In certain embodiments, the proliferative disease is T-cell acute lymphoblastic leukemia (T-ALL). In certain embodiments, the proliferative disease is chronic myelogenous leukemia (CML). In certain embodiments, the proliferative disease is acute myelogenous leukemia (AML). In certain embodiments, the proliferative disease is acute monocytic leukemia (AMoL). In certain embodiments, the proliferative disease is lymphoma. In some embodiments, the proliferative disease is Burkitt's lymphoma. In certain embodiments, the proliferative disease is a Hodgkin's lymphoma. In certain embodiments, the proliferative disease is a non-Hodgkin's lymphoma. In certain embodiments, the proliferative disease is multiple myeloma. In certain embodiments, the proliferative disease is melanoma. In certain embodiments, the proliferative disease is colorectal cancer. In certain embodiments, the proliferative disease is breast cancer. In certain embodiments, the proliferative disease is triple-negative breast cancer (TNBC). In certain embodiments, the proliferative disease is a bone cancer. In certain embodiments, the proliferative disease is osteosarcoma. In certain embodiments, the proliferative disease is Ewing's sarcoma. In some embodiments, the proliferative disease is a brain cancer. In some embodiments, the proliferative disease is neuroblastoma. In some embodiments, the proliferative disease is a lung cancer. In some embodiments, the proliferative disease is small cell lung cancer (SCLC). In some embodiments, the proliferative disease is non-small cell lung cancer. In some embodiments, the proliferative disease is a benign neoplasm. All types of benign neoplasms disclosed herein or known in the art are contemplated as being within the scope of the invention. In some embodiments, the proliferative disease is associated with angiogenesis. All types of angiogenesis disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the proliferative disease is an inflammatory disease. All types of inflammatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention. In certain embodiments, the inflammatory disease is rheumatoid arthritis. In some embodiments, the proliferative disease is an autoinflammatory disease. All types of autoinflammatory diseases disclosed herein or known in the art are contemplated as being within the scope of the invention. In some embodiments, the proliferative disease is an autoimmune disease. All types of autoimmune diseases disclosed herein or known in the art are contemplated as being within the scope of the invention.
- Another aspect of the invention relates to methods of inhibiting the activity of a kinase in a biological sample or subject. In certain embodiments, the kinase is CDK. In certain embodiments, the kinase is CDK7. In certain embodiments, the activity of the kinase is aberrant activity of the kinase. In certain embodiments, the inhibition of the activity of the kinase is irreversible. In other embodiments, the inhibition of the activity of the kinase is reversible. In certain embodiments, the methods of inhibiting the activity of the kinase include attaching a compound described herein to the kinase.
- Also provided in the present invention are methods of inhibiting transcription of genes in a biological sample or subject. Genes which may have their transcription inhibited by the compounds herein include MYC, KLF2, E2F2, CDK6, CCND3, E2F3, HNRPDL, TET1, and IL7R.
- The present invention also provides methods of inhibiting cell growth in a biological sample or subject.
- In still another aspect, the present invention provides methods of inducing apoptosis of a cell in a biological sample or a subject.
- In certain embodiments, the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled derivative, or prodrug thereof, or a pharmaceutical composition thereof. In certain embodiments, the methods described herein include administering to a subject or contacting a biological sample with an effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, or a pharmaceutical composition thereof. In certain embodiments, the compound is contacted with a biological sample. In certain embodiments, the compound is administered to a subject. In certain embodiments, the compound is administered in combination with one or more additional pharmaceutical agents described herein. The additional pharmaceutical agent may be an anti-proliferative agent. In certain embodiments, the additional pharmaceutical agent is an anti-cancer agent. The additional pharmaceutical agent may also be a kinase inhibitor. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a CDK. In certain embodiments, the additional pharmaceutical agent is an inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of CDK7. In certain embodiments, the additional pharmaceutical agent is an inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is a selective inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is a nonselective inhibitor of another CDK. In certain embodiments, the additional pharmaceutical agent is flavopiridol, triptolide, SNS-032 (BMS-387032), PHA-767491, PHA-793887, BS-181, (S)—CR8, (R)—CR8, or NU6140. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a mitogen-activated protein kinase (MAPK). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a glycogen synthase kinase 3 (GSK3). In certain embodiments, the additional pharmaceutical agent is an inhibitor of an AGC kinase. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a calmodulin-dependent kinase (CaM Kinase). In certain embodiments, the additional pharmaceutical agent is an inhibitor of a casein kinase 1. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a STE kinase. In certain embodiments, the additional pharmaceutical agent is an inhibitor of a tyrosine kinase.
- In some embodiments, the additional pharmaceutical agent is a topoisomerase inhibitor, a MCL1 inhibitor, a BCL-2 inhibitor, a BCL-xL inhibitor, a BRD4 inhibitor, a CDK9 inhibitor, a Jumonji histone demethylase inhibitor, or a DNA damage inducer. In some embodiments, the additional pharmaceutical agent is etoposide, obatoclax, navitoclax, JQ1, 4-(((5′-chloro-2′-(((1R,4R)-4-(((R)-1-methoxypropan-2-yl)amino)cyclohexyl)amino)-[2,4′-bipyridin]-6-yl)amino)methyl)tetrahydro-2H-pyran-4-carbonitrile, JIB04, or cisplatin. In some embodiments, the additional pharmaceutical agent is etoposide, obatoclax, or navitoclax, and the disease to be treated is breast cancer, e.g., triple-negative breast cancer, HER2 positive breast cancer, ER-positive breast cancer, or ER/PR-positive breast cancer. In some embodiments, the additional pharmaceutical agent is etoposide, JIB04, or cisplatin, and the disease to be treated is Ewing's sarcoma. In some embodiments, the additional pharmaceutical agent is JQ1 or NVP2, and the disease to be treated is leukemia, e.g., acute myelogenous leukemia, myeloblastic leukemia, promyelocytic leukemia, myelomonocytic leukemia, monocytic leukemia, monoblastic leukemia, or megakaryoblastic leukemia. In certain embodiments, a pharmaceutical composition described herein further comprises a combination of the additional pharmaceutical agents described herein.
- The inventive compounds or compositions may synergistically augment inhibition of CDK7 induced by the additional pharmaceutical agent(s) in the biological sample or subject. Thus, the combination of the inventive compounds or compositions and the additional pharmaceutical agent(s) may be useful in treating proliferative diseases resistant to a treatment using the additional pharmaceutical agent(s) without the inventive compounds or compositions.
- In some embodiments, the activity of a protein kinase is non-selectively inhibited by the compounds or pharmaceutical compositions described herein. In some embodiments, the activity of a protein kinase described herein is selectively inhibited by the compounds or pharmaceutical compositions described herein, compared to the activity of a different protein (e.g., a different protein kinase). In certain embodiments, the activity of CDK (e.g., CDK7) is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different protein. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of a different CDK protein. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK13. In certain embodiments, the activity of CDK7 is selectively inhibited by a compound or pharmaceutical composition described herein, compared to the activity of CDK12 and the activity of CDK13.
- The selectivity of a compound or pharmaceutical composition described herein in inhibiting the activity of a protein kinase over a different protein (e.g., a different protein kinase) may be measured by the quotient of the IC50 value of the compound or pharmaceutical composition in inhibiting the activity of the different protein over the IC50 value of the compound or pharmaceutical composition in inhibiting the activity of the protein kinase. The selectivity of a compound or pharmaceutical composition described herein for a protein kinase over a different protein may also be measured by the quotient of the Kd value of an adduct of the compound or pharmaceutical composition and the different protein over the Kd value of an adduct of the compound or pharmaceutical composition and the protein kinase. In certain embodiments, the selectivity is at least 2-fold, at least 3-fold, at least 5-fold, at least 10-fold, at least 30-fold, at least 100-fold, at least 300-fold, at least 1,000-fold, at least 3,000-fold, at least 10,000-fold, at least 30,000-fold, or at least 100,000-fold. In certain embodiments, the selectivity is not more than 100,000-fold, not more than 10,000-fold, not more than 1,000-fold, not more than 100-fold, not more than 10-fold, or not more than 2-fold. Combinations of the above-referenced ranges (e.g., at least 2-fold and not more than 10,000-fold) are also within the scope of the disclosure.
- In certain embodiments, a kit described herein includes a first container comprising a compound or pharmaceutical composition described herein. In certain embodiments, a kit described herein is useful in treating a proliferative disease (e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer, colorectal cancer), benign neoplasms, diseases associated with angiogenesis, inflammatory diseases, autoinflammatory diseases, and autoimmune diseases) in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell.
- In certain embodiments, a kit described herein further includes instructions for using the compound or pharmaceutical composition included in the kit. A kit described herein may also include information as required by a regulatory agency such as the U.S. Food and Drug Administration (FDA). In certain embodiments, the information included in the kits is prescribing information. In certain embodiments, the kits and instructions provide for treating a proliferative disease in a subject in need thereof, preventing a proliferative disease in a subject in need thereof, inhibiting the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological sample, tissue, or cell, and/or inducing apoptosis in a cell. A kit described herein may include one or more additional pharmaceutical agents described herein as a separate composition.
- In order that the invention described herein may be more fully understood, the following examples are set forth. The synthetic and biological examples described in this application are offered to illustrate the compounds, pharmaceutical compositions, and methods provided herein and are not to be construed in any way as limiting their scope.
- The compounds provided herein can be prepared from readily available starting materials using the following general methods and procedures. Reactions were monitored by thin layer chromatography (TLC) with 0.25 mm E. Merck pre-coated silica gel plates (60 F254) and Waters LCMS system (Waters 2489 UV/Visible Detector, Waters 3100 Mass, Waters 515 HPLC pump, Waters 2545 Binary Gradient Module, Waters Reagent Manager, Waters 2767 Sample Manager) using SunFire™ C18 column (4.6×50 mm, 5 m particle size): solvent gradient=95% A at 0 min, 0% A at 5 min; solvent A=0.5% TFA in Water; solvent B=Methanol; flow rate: 1.5 mL/min. Purification of reaction products was carried out by flash chromatography using CombiFlash® Rf with Teledyne Isco RediSep® Rf High Performance Gold or Silicycle SiliaSep™ High Performance columns (4 g, 12 g, 24 g, 40 g, 80 g or 120 g) or by Waters preparative HPLC system with a C18 column: solvent gradient=100% A at 0 min, 0% A at 15 min; solvent A=0.5% TFA in Water; solvent B=Methanol; flow rate: 20 mL/min. The purity of all compounds was over 95% and was analyzed with Waters LCMS system. 1H NMR and 13C NMR spectra were obtained using a Varian Inova-600 or 400 MHz spectrometer. Chemical shifts are reported relative to chloroform (6=7.24) for 1H NMR or dimethyl sulfoxide (6=2.50) for 1H NMR and dimethyl sulfoxide (δ=39.51) for 13C NMR. Data are reported as (br=broad, s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet).
- The synthesis of
Compound 101 follows Synthetic Scheme 1. The syntheses of Compounds 102 to 111 (presented in Table 2) follow a corresponding method. -
- To a solution of tert-butyl 3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate (1.0 g, 3.95 mmol) and TEA (0.6 g, 0.82 mL, 5.93 mmol) in THF (10 mL) was added ethyl chloroformate (0.43 g, 0.38 mL, 3.95 mmol) dropwise at 0° C. The mixture was stirred at 0° C. for 1 h. The solvent was evaporated and the residue was partitioned with EtOAc and sat. NaHCO3. The organic layer was washed with water and brine, dried (Na2SO4). This was concentrated to give 5-(tert-butyl) ethyl 3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as an off white solid (1.28 g, 100%). LC/MS (ESI) m/z=325.3 (M+H)+.
-
- To a suspension of 5-(tert-butyl) ethyl 3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (500 mg, 1.54 mmol), (3-nitrophenyl)boronic acid (514 mg, 3.08 mmol), and Cu(OAc)2 (420 mg, 2.31 mmol) in DCM (10 mL) was added TEA (311 mg, 0.43 mL, 3.08 mmol). The mixture was stirred at room temperature overnight. Solvent was evaporated and the crude was purified by flash column chromatography on silica gel (EtOAc/hexane, 0-70%) to give 5-(tert-butyl) ethyl 6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (240 mg, 35%). LC/MS (ESI) m/z=446.4 (M+H)+.
-
- To a solution of 5-(tert-butyl) ethyl 6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (120 mg, 0.27 mmol) in EtOAc (2 mL) and pyridine (0.2 mL) was added SnCl2.2H2O (305 mg, 1.35 mmol). The mixture was stirred at 70° C. overnight. The mixture was diluted with CHC3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (MeOH/DCM, 0-10%) to give 5-(tert-butyl) ethyl 3-((3-aminophenyl)amino)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (99 mg, 88%). LC/MS (ESI) m/z=416.4 (M+H)+.
-
- To a solution of 5-(tert-butyl) ethyl 3-((3-aminophenyl)amino)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (99 mg, 0.24 mmol) and DIEA (62 mg, 84 μL, 0.48 mmol) in DCM (2 mL) was added 4-nitrobenzoyl chloride (53 mg, 0.29 mmol) at 0° C. The reaction was stirred at room temperature for 2 h and concentrated. The crude was purified by flash column chromatography on silica gel (MeOH/DCM, 0-5%) to give 5-(tert-butyl) ethyl 6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (129 mg, 95%). LC/MS (ESI) m/z=565.4 (M+H)+.
-
- To a solution of 5-(tert-butyl) 1- or 2-ethyl 6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (129 mg, 0.23 mmol) in DCM (1 mL) was added TFA (1 mL). The reaction was stirred at room temperature for 1 h and concentrated to give ethyl 6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a TFA salt, which was used directly without further purification. LC/MS (ESI) m/z=464.4 (M+H)+.
-
- To a mixture of ethyl 6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (TFA salt, 0.23 mmol) in DCM (2 mL) was added DIEA (148 mg, 0.2 mL, 1.15 mmol) at 0° C., followed by (S)-2-isocyanato-N,N-dimethyl-2-phenylethan-1-amine HCl salt (62 mg, 0.27 mmol). The solution was stirred at 0° C. for 1 h and diluted with CHC3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (1.75 M NH3 in MeOH/DCM, 0-10%) to give ethyl (S)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a yellow solid (134 mg, 89% over 2 steps). LC/MS (ESI) m/z=655.4 (M+H)+.
-
- To a solution of ethyl (S)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (134 mg, 0.20 mmol) in EtOAc (2 mL) was added SnCl2.2H2O (226 mg, 1.0 mmol). The mixture was stirred at 70° C. for 2 h and diluted with CHC3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (1.75 M NH3 in MeOH/DCM, 0-10%) to give ethyl (S)-3-((3-(4-aminobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a yellow solid (112 mg, 90%). LC/MS (ESI) m/z=625.4 (M+H)+.
-
- To a mixture of ethyl (S)-3-((3-(4-aminobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (20 mg, 0.032 mmol) in THF (1 mL) and sat. NaHCO3(1 mL) was added acryloyl chloride (5.8 mg, 0.064 mmol) dropwise at 0° C. The mixture was stirred at 0° C. for 10 min and diluted with CHCl3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude ethyl (S)-3-((3-(4-acrylamidobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate was dissolved in i-PrOH (1 mL) and LiOH (1 M, 1 mL) was added. After stirred at room temperature for 10 min, the mixture was diluted with CHCl3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by reverse phase preparative HPLC (MeOH/H2O, 0-100%) to give (S)-3-((3-(4-acrylamidobenzamido)phenyl)amino)-N-(2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide as a white solid (10.5 mg, 54%). 1H NMR: 600 MHz (DMSO-d6) δ 10.44 (d, J=4.2 Hz, 1H), 10.04 (s, 1H), 8.33 (s, 1H), 7.96-7.93 (m, 2H), 7.82-7.80 (m, 2H), 7.34-7.32 (m, 2H), 7.26-7.23 (m, 2H), 7.20-7.10 (m, 3H), 6.52-6.46 (m, 1H), 6.35-6.30 (m, 1H), 6.09 (s, 1H), 5.84-5.81 (m, 1H), 4.89-4.83 (m, 1H), 4.35 (d, J=19.8 Hz, 2H), 2.64-2.57 (m, 1H), 2.45-2.38 (m, 1H), 2.18 (s, 6H), 1.65 (d, J=4.2 Hz, 3H), 1.58 (d, J=4.8 Hz, 3H); MS m/z: 607.4 [M+1].
-
TABLE 2 The following compounds were produced by using the corresponding starting compounds according to a method similar to that described in Example 1: Name Structure Characterization Data Compound 102 (S)-3-((4-(4- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.46 (s, 1H), 10.01 (s, 1H), 8.98-8.89 (br, 1H), 8.25 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.85 (d, J = 8.8 Hz, 2H), 7.64 (d, J = 8.8 Hz, 2H), 7.48-7.42 (m, 4H), 7.38- 7.34 (m, 1H), 7.00-6.91 (m, 2H), 6.69 (d, J = 8.8 Hz, 1H), 6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz, 1H), 5.40-5.35 (m, 1H), 4.48 (d, J = 10.8 Hz, 1H), 4.33 (d, J = 10.8 Hz, 1H), 3.10-2.95 (m, 2H), 2.93 (d, J = 4.8 Hz, 3H), 2.87 (d, J = 4.8 Hz, 3H), 1.74 (s, 3H), 1.65 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 103 (S)-3-((4-(3- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 11.90-11.70 (br, 1H), 10.26 (s, 1H), 9.98 (s, 1H), 8.22-8.10 (br, 1H), 8.07 (m, 1H), 7.83 (dd, J = 8.0, 1.2 Hz, 1H), 7.57 (d, J = 8.0 Hz, 1H), 7.51 (d, J = 8.8 Hz, 2H), 7.39 (t, J = 8.0 Hz, 1H), 7.27 (d, J = 7.2 Hz, 2H), 7.22 (t, J = 7.2 Hz, 2H), 7.12 (t, J = 7.2 Hz, 1H), 6.39 (dd, J = 17.2, 10.0 Hz, 1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H), 6.03-5.92 (m, 1H), 5.72 (dd, J = 10.0, 2.0 Hz, 1H), 4.60-4.51 (m, 1H), 4.25-4.14 (m, 2H), 2.52 (dd, J = 12.0, 8.8 Hz, 1H), 2.32-2.27 (m, 1H), 2.10 (s, 6H), 1.57 (s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 104 (S)-N-(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-3- ((3-(4- propionamidobenzamido) phenyl)amino)-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 12.20-11.80 (br, 1H), 10.09 (s, 1H), 9.93 (s, 1H), 8.23 (s, 1H), 7.83 (d, J = 8.0 Hz, 2H), 7.65 (d, J = 8.8 Hz, 2H), 7.50-7.30 (m, 1H), 7.27 (d, J = 6.8 Hz, 2H), 7.18 (t, J = 7.2 Hz, 2H), 7.13-7.09 (m, 3H), 6.59-6.51 (m, 1H), 6.12 (s, 1H), 4.92-4.80 (m, 1H), 4.29 (s, 2H), 2.30 (q, J = 7.6 Hz, 2H), 2.22 (m, 6H), 1.57 (s, 3H), 1.51 (s, 3H), 1.03 (t, J = 7.6 Hz, 3H); MS m/z: 609.4 [M + 1]. Compound 105 (S)-3-((3-(3- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 12.10-11.82 (br, 1H), 10.26 (s, 1H), 10.08 (s, 1H), 8.25 (s, 1H), 8.06 (s, 1H), 7.85 (dd, J = 8.4, 1.2 Hz, 1H), 7.55 (d, J = 7.6 Hz, 1H), 7.39 (t, J = 8.0 Hz, 1H), 7.24 (d, J = 7.2 Hz, 2H), 7.15 (t, J = 7.2 Hz, 2H), 7.08 (d, J = 6.4 Hz, 1H), 6.39 (dd, J = 17.2, 10.0 Hz, 1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H), 5.97 (s, 1H), 5.72 (dd, J = 10.0, 2.0 Hz, 1H), 4.76- 4.70 (m, 1H), 4.30-4.19 (m, 2H), 2.50-2.44 (m, 1H), 2.29- 2.22 (m, 1H), 2.05 (s, 6H), 1.57 (s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 106 3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)ethyl)-6,6- dimethyl-4,6- dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.49 (s, 1H), 10.07 (s, 1H), 9.41 (s, 1H), 8.37 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.86 (d, J = 8.8 Hz, 2H), 7.49 (s, 1H), 7.21 (m, 2H), 6.74 (m, 1H), 6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.38 (m, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz, 1H), 4.27 (s, 2H), 3.41 (q, J = 5.6 Hz, 2H), 3.18 (q, J = 5.6 Hz, 2H), 2.86 (s, 3H), 2.85 (s, 3H), 1.71 (s, 6H); MS m/z: 531.4 [M + 1]. Compound 107 4-acrylamido-N-(3-((6,6- dimethyl-5-(4- methylpiperazine-1- carbonyl)-1,4,5,6- tetrahydropyrrolo[3,4- c]pyrazol-3- yl)amino)phenyl)benzamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.49 (s, 1H), 10.08 (s, 1H), 9.68 (s, 1H), 8.44 (s, 1H), 7.99 (s, J = 8.8 Hz, 2H), 7.86 (d, J = 8.4 Hz, 2H), 7.62 (s, 1H), 7.23-7.13 (m, 2H), 6.84 (d, J = 7.2 Hz, 1H), 6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz, 1H), 4.43 (s, 2H), 3.40- 3.33 (m, 4H), 3.15-2.97 (m, 4H), 2.82 (s, 3H), 1.70 (s, 6H); MS m/z: 543.4 [M + 1]. Compound 108 3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(1- (dimethylamino)propan-2- yl)-6,6-dimethyl-4,6- dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.35 (s, 1H), 9.95 (s, 1H), 8.91 (s, 1H), 8.23 (s, 1H), 7.85 (d, J = 8.4 Hz, 2H), 7.72 (d, J = 8.4 Hz, 2H), 7.32 (s, 1H), 7.11-7.05 (m, 2H), 6.57 (m, 1H), 6.40 (dd, J = 16.8, 10.0 Hz, 1H), 6.23 (dd, J = 16.8, 2.0 Hz, 1H), 5.91 (d, J = 8.4 Hz, 1H), 5.74 (dd, J = 10.0, 2.0 Hz, 1H), 4.18 (s, 2H), 4.14-4.07 (m, 1H), 3.05-2.94 (m, 2H), 2.71 (d, J = 4.8 Hz, 3H), 2.69 (d, J = 4.8 Hz, 3H), 1.59 (s, 6H), 1.01 (d, J = 6.4 Hz, 3H), 0.85-0.76 (m, 1H); MS m/z: 545.3 [M + 1]. Compound 109 (S,E)-3-((3-(4-(4- (dimethylamino)but-2- enamido)benzamido)phenyl) amino)-N-(2-hydroxy-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.68 (s, 1H), 10.13 (s, 1H), 10.01 (s, 1H), 8.43 (s, 1H), 8.03 (d, J = 8.8 Hz, 2H), 7.88 (d, J = 8.8 Hz, 2H), 7.54 (s, 1H), 7.41-7.39 (m, 2H), 7.34-7.30 (m, 2H), 7.27-7.22 (m, 3H), 6.92-6.82 (m, 2H), 6.58 (d, J = 15.6 Hz, 1H), 6.13 (d, J = 8.0 Hz, 1H), 4.85 (q, J = 6.8 Hz, 1H), 4.48 (q, J = 11.2 Hz, 2H), 4.06 (d, J = 7.2 Hz, 2H), 3.63 (d, J = 6.4 Hz, 2H), 2.91 (s, 6H), 2.64 (t, J = 5.6 Hz, 1H), 1.73 (s, 3H), 1.67 (s, 3H); MS m/z: 637.3 [M + 1]. Compound 110 (S)-3-((3- acrylamidophenyl)amino)- N-(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 9.94 (s, 1H), 8.90 (s, 1H), 8.24 (s, 1H), 7.35-7.27 (m, 4H), 7.24-7.22 (m, 2H), 7.08-7.02 (m, 2H), 6.56-6.52 (m, 2H), 6.38 (dd, J = 16.8, 10.0 Hz, 1H), 6.16 (dd, J = 16.8, 2.0 Hz, 1H), 5.67 (dd, J = 10.0, 2.0 Hz, 1H), 5.29-5.22 (m, 1H), 4.31 (q, J = 11.2 Hz, 2H), 3.39-3.34 (m, 1H), 3.28- 3.22 (m, 1H), 2.80 (d, J = 4.8 Hz, 1H), 2.73 (d, J = 4.8 Hz, 1H), 1.59 (s, 3H), 1.53 (s, 3H); MS m/z: 488.3 [M + 1]. Compound 111 (S)-3-((4- acrylamidophenyl)amino)- N-(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 9.86 (s, 1H), 8.91 (s, 1H), 8.13 (s, 1H), 7.49-7.43 (m, 2H), 7.40-7.27 (m, 5H), 7.22 (m, 1H), 6.82 (d, J = 9.2 Hz, 1H), 6.55 (d, J = 9.2 Hz, 1H), 6.34 (dd, J = 16.8, 10.0 Hz, 1H), 6.13 (dd, J = 16.8, 2.0 Hz, 1H), 5.62 (dd, J = 10.0, 2.0 Hz, 1H), 5.29-5.22 (m, 1H), 4.33 (d, J = 11.2 Hz, 1H), 4.19 (d, J = 11.2 Hz, 1H), 3.42-3.36 (m, 1H), 3.29-3.23 (m, 1H), 2.81 (d, J = 4.8 Hz, 1H), 2.74 (d, J = 4.8 Hz, 1H), 1.60 (s, 3H), 1.51 (s, 3H); MS m/z: 488.3 [M + 1]. - The synthesis of Compound 112 follows Synthetic Scheme 2. The syntheses of Compounds 120, and 214 to 217 (presented in Table 3) follow a corresponding method.
-
- To a solution of 5-(tert-butyl) ethyl 3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (100 mg, 0.31 mmol) and DIEA (79 mg, 0.11 mL, 0.62 mmol) in DCM (2 mL) was added 3-nitrobenzoyl chloride (87 mg, 0.47 mmol). The reaction was stirred at room temperature for 2 h and concentrated. The crude was purified by flash column chromatography on silica gel (EtOAc/hexanes, 0-70%) to give 5-(tert-Butyl) ethyl 6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (110 mg, 75%). LC/MS (ESI) m/z=474.4 (M+H)+.
-
- Following the previously described synthetic procedure of
Compound 101 from 5-(tert-butyl) ethyl 6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate, (S)-3-(3-(4-acrylamidobenzamido)benzamido)-N-(2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide was obtained as a white solid. 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.97 (s, 1H), 10.53 (s, 1H), 10.40 (s, 1H), 9.04 (s, 1H), 8.62 (m, 1H), 8.04 (d, J=9.2 Hz, 2H), 7.89 (d, J=9.2 Hz, 2H), 7.83 (d, J=7.6 Hz, 1H), 7.57-7.44 (m, 4H), 7.36 (t, J=7.2 Hz, 1H), 6.83 (d, J=9.2 Hz, 1H), 6.54 (dd, J=17.2, 10.0 Hz, 1H), 6.37 (dd, J=17.2, 2.0 Hz, 1H), 5.88 (dd, J=10.0, 2.0 Hz, 1H), 5.43-5.37 (m, 1H), 4.86 (d, J=12.4 Hz, 1H), 4.64 (d, J=11.6 Hz, 1H), 2.95 (d, J=8.4 Hz, 3H), 2.90 (d, J=8.4 Hz, 3H), 1.74 (s, 3H), 1.66 (s, 3H); MS m/z: 635.3 [M+1]. -
TABLE 3 The following compounds were produced using the corresponding starting compounds according to a method similar to that described for the synthesis of Compound 112: Name Structure Characterization Data Compound 120. (S)-3-(3- acrylamidobenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.77 (s, 1H), 10.19 (s, 1H), 8.86 (s, 1H), 8.32 (s, 1H), 7.60 (m, 1H), 7.54 (m, 1H), 7.28 (m, 4H), 7.15 (m, 1H), 6.62 (m, 1H), 6.31 (m, 1H), 6.14 (m, 1H), 5.64 (m, 1H), 5.19 (m, 1H), 4.64 (m, 1H), 4.42 (m, 1H), 3.41 (m, 1H), 3.19 (m, 1H), 2.73 (m, 3H), 2.69 (m, 3H), 1.53 (s, 3H), 1.44 (s, 3H); MS m/z: 516.3 [M + 1]. Compound 214. (S)-3-(4- acrylamidobenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 10.80 (s, 1H), 10.43 (s, 1H), 8.98 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.78 (d, J = 8.8 Hz, 2H), 7.71 (d, J = 7.6 Hz, 2H), 7.38 (t, J = 7.0 Hz, 2H), 7.28 (t, J = 7.0 Hz, 1H), 6.75 (d, J = 9.4 Hz, 1H), 6.45 (dd, J = 17.0, 10.0 Hz, 1H), 6.29 (dd, J = 16.4, 2.4 Hz, 1H), 5.80 (dd, J = 10.0, 1.8 Hz, 1H), 5.33 (m, 1H), 4.75 (d, J = 11.7 Hz, 1H), 4.53 (d, J = 11.7 Hz, 1H), 3.53 (m, 1H), 3.33 (m, 1H), 2.86 (d, J = 4.7 Hz, 3H), 2.82 (d, J = 5.3 Hz, 3H), 1.65 (d, 3H), 1.57 (s, 3H); MS m/z: 516.3 [M + 1]. Compound 215. (S)-N-(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-3- (4- propionamidobenzamido)- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.38 (s, 1H), 10.71 (s, 1H), 10.12 (s, 1H), 7.95 (m, 2H), 7.69 (m, 2H), 7.35 (d, J = 7.0 Hz, 2H), 7.28 (t, J = 7.6 Hz, 2H), 7.18 (d, J = 7.6 Hz, 1H), 6.25 (m, 1H), 4.87 (m, 1H), 4.52 (m, 2H), 2.68 (m, 1H), 2.41 (m, 1H), 2.34 (q, J = 7.6 Hz, 2H), 2.20 (m, 6H), 1.62 (m, 3H), 1.55 (s, 3H), 1.08 (t, J = 7.6 Hz, 1H); MS m/z: 518.3 [M + 1]. Compound 216. (S)-3-(4-acrylamido-2- methoxybenzamido)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (a mixture of rotamers): 600 MHz (DMSO- d6) δ 12.41, 12.32 (s, 1H), 10.49, 10.45 (s, 1H), 10.29, 10.09 (s, 1H), 8.97 (br, 1H), 7.86 (m, 1H), 7.63 (m, 1H), 7.38 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.44 (dd, J = 17.0, 10.0 Hz, 1H), 6.30 (dd, J = 17.0, 1.2 Hz, 1H), 5.81 (d, J = 11.7 Hz, 1H), 5.05 (br, 1H), 4.63 (m, 1H), 4.57 (m, 1H), 3.95 (m, 3H), 2.70-2.20 (m, 6H), 1.64, 1.60 (s, 3H), 1.56, 1.52 (s, 3H); MS m/z: 546.3 [M + 1]. Compound 217. (S)-3-(4-acrylamido-3- methoxybenzamido)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.44 (s, 1H), 10.87 (s, 1H), 9.55 (s, 1H), 8.26 (m, 1H), 7.72 (s, 1H), 7.65 (m, 1H), 7.38 (m, 2H), 7.32 (m, 2H), 7.23 (m, 1H), 6.76 (dd, J = 17.0, 10.0 Hz, 1H), 6.46 (br, 1H), 6.25 (dd, J = 17.0, 1.8 Hz, 1H), 5.75 (d, J = 10.0 Hz, 1H), 5.07 (br, 1H), 4.63 (m, 1H), 4.56 (m, 1H), 3.94 (s, 3H), 2.79-2.06 (m, 6H), 1.64 (s, 3H), 1.57 (s, 3H); MS m/z: 546.3 [M + 1]. - The synthesis of Compounds 113 follows Synthetic Scheme 3. The synthesis of Compounds 114, 123, 221, and 222 (presented in Table 4) follows a corresponding method.
-
- To a solution of 5-(tert-butyl) ethyl 3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (100 mg, 0.31 mmol), (R)-1-((benzyloxy)carbonyl)piperidine-3-carboxylic acid (122 mg, 0.47 mmol), and DIEA (120 mg, 0.16 mL, 0.93 mmol) in DMF (2 mL) was HATU (236 mg, 0.62 mmol). The mixture was stirred at room temperature overnight and diluted with ethyl acetate and sat. NaHCO3. The organic layer was washed with water and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (EtOAc/hexanes, 0-70%) to give 5-(tert-butyl) ethyl (R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (65 mg, 37%). LC/MS (ESI) m/z=570.4 (M+H)+.
-
- To a solution of 5-(tert-butyl) ethyl (R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (65 mg, 0.115 mmol) in DCM (1 mL) was added TFA (1 mL). The reaction was stirred at room temperature for 1 h and concentrated to give ethyl (R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a TFA salt, which was used directly without further purification. LC/MS (ESI) m/z=470.4 (M+H)+.
- To a mixture of (R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (TFA salt, 0.115 mmol) in DCM (1 mL) was added DIEA (74 mg, 0.1 mL, 0.57 mmol) at 0° C., followed by (S)-2-isocyanato-N,N-dimethyl-2-phenylethan-1-amine HCl salt (31 mg, 0.14 mmol). The solution was stirred at 0° C. for 1 h and diluted with CHC3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (1.75 M NH3 in MeOH/DCM, 0-10%) to give ethyl 3-((R)-1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a yellow solid (53 mg, 70% over 2 steps). LC/MS (ESI) m/z=660.4 (M+H)+.
-
- A mixture of ethyl 3-((R)-1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (53 mg, 0.081 mmol) and 10% Pd/C (10 mg) in MeOH (5 mL) was degassed. The mixture was stirred under H2 (1 atm) at room temperature overnight. The reaction was filtered through Celite® and concentrated to give N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-3-((R)-piperidine-3-carboxamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide as a clear wax (28 mg, 78%). LC/MS (ESI) m/z: 454.4 (M+H)+.
-
- To a mixture of N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-3-((R)-piperidine-3-carboxamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide (20 mg, 0.044 mmol) in THF (1 mL) and sat. NaHCO3(1 mL) was added acryloyl chloride (12 mg, 0.13 mmol) dropwise at 0° C. The mixture was stirred at 0° C. for 10 min and diluted with CHCl3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was dissolved in i-PrOH (1 mL) and LiOH (1 M, 1 mL) was added. After stirred at room temperature for 10 min, the mixture was diluted with CHC3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by reverse phase preparative HPLC (MeOH/H2O, 0-100%) to give 3-((R)-1-acryloylpiperidine-3-carboxamido)-N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide TFA salt as a white solid (11 mg, 42%). 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.56 (d, J=19.8 Hz, 1H), 8.95 (s, 1H), 7.41-7.36 (m, 3H), 7.31-7.27 (m, 1H), 6.87-6.79 (m, 1H), 6.72 (d, J=9.0 Hz, 1H), 6.08 (d, J=16.2 Hz, 1H), 5.66 (d, J=10.2 Hz, 1H), 5.32 (m, 1H), 4.69 (m, 1H), 4.47 (m, 2H), 4.03 (m, 2H), 3.53 (t, J=12.0 Hz, 2H), 3.35-3.30 (m, 1H), 3.18-3.12 (m, 1H), 2.99 (t, J=13.2 Hz, 1H), 2.85 (d, J=5.4 Hz, 3H), 2.82 (d, J=4.8 Hz, 3H), 2.70 (t, J=12.0 Hz, 1H), 1.95 (m, 1H), 1.73 (m, 1H), 1.62 (s, 3H), 1.53 (s, 3H), 1.33 (m, 1H); MS m/z: 508.3 [M+1].
-
- 3-((S)-1-Acryloylpiperidine-3-carboxamido)-N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide was prepared by using the corresponding starting compounds according to a method similar to that described for Compound 113. 1H NMR (TFA salt): 400 MHz (DMSO-d6) δ 10.50 (d, J=15.6 Hz, 1H), 8.90 (s, 1H), 7.37-7.31 (m, 4H), 7.25-7.21 (m, 1H), 6.82-6.72 (m, 1H), 6.66 (d, J=8.8 Hz, 1H), 6.03 (d, J=16.4 Hz, 1H), 5.61 (d, J=10.8 Hz, 1H), 5.27 (m, 1H), 4.62 (m, 1H), 4.43 (m, 2H), 4.07-3.96 (m, 2H), 3.13-3.05 (m, 2H), 2.94 (t, J=12.0 Hz, 1H), 2.81 (d, J=5.2 Hz, 3H), 2.77 (d, J=5.2 Hz, 3H), 2.69-2.57 (m, 1H), 1.89 (m, 1H), 1.67 (m, 1H), 1.57 (s, 3H), 1.49 (s, 3H), 1.29 (m, 1H); MS m/z: 508.3 [M+1].
-
TABLE 4 The following compounds were produced using the corresponding starting compounds according to a method similar to that described for the synthesis of Compound 113: Name Structure Characterization Data Compound 123. (S)-3-(1-acryloylpiperidine- 4-carboxamido)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.45 (s, 1H), 8.93 (s, 1H), 7.35 (m, 3H), 7.25 (t, J = 7.0 Hz, 1H), 6.76 (dd, J = 16.4, 10.6 Hz, 1H), 6.67 (d, J = 9.4 Hz, 1H), 6.04 (dd, J = 16.4, 2.4 Hz, 1H), 5.62 (dd, J = 10.6, 2.4 Hz, 1H), 5.28 (td, J = 12.3, 3.5 Hz, 1H), 4.64 (d, J = 11.7 Hz, 1H), 4.43 (d, J = 12.3 Hz, 1H), 4.39 (d, J = 12.3 Hz, 1H), 4.05 (d, J = 14.1 Hz, 1H), 3.49 (t, J = 12.3 Hz, 1H), 3.29 (m, 1H), 3.04 (t, J = 12.9 Hz, 1H), 2.81 (d, J = 4.7 Hz, 3H), 2.79 (d, J = 4.7 Hz, 3H), 2.82 (m, 2H), 1.77 (m, 2H), 1.58 (s, 3H), 1.50 (s, 3H), 1.42 (m, 2H); MS m/z: 508.3 [M + 1]. Compound 221. 3-((1s,4R)-4- acrylamidocyclohexane-1- carboxamido)-N-((S)-2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.26 (s, 1H), 10.27 (s, 1H), 7.92 (s, 1H), 7.37 (m, 2H), 7.32 (m, 2H), 7.23 (m, 1H), 6.32 (dd, J = 17.0, 10.6 Hz, 1H), 6.06 (dd, J = 17.0, 2.4 Hz, 1H), 5.54 (dd, J = 10.0, 2.4 Hz, 1H), 4.56 (m, 1H), 4.48 (m, 1H), 3.86 (m, 1H), 2.43 (m, 2H), 1.76 (m, 4H), 1.60 (s, 3H), 1.57 (m, 2H), 1.53 (s, 3H); MS m/z: 522.3 [M + 1]. Compound 222. 3-((1r,4S)-4- acrylamidocyclohexane-1- carboxamido)-N-((S)-2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.24 (s, 1H), 10.31 (s, 1H), 7.97 (d, J = 7.6 Hz, 1H), 7.36 (d, J = 7.0 Hz, 2H), 7.29 (t, J = 7.6 Hz, 2H), 7.20 (t, J = 7.6 Hz, 1H), 6.34 (m, 1H), 6.16 (dd, J = 17.2, 10.0 Hz, 1H), 6.05 (dd, J = 17.0, 2.4 Hz, 1H), 5.55 (dd, J = 10.0, 2.4 Hz, 1H), 4.94 (m, 1H), 4.48 (m, 2H), 3.55 (m, 1H), 2.32 (m, 6H), 1.84 (m, 4H), 1.59 (s, 3H), 1.51 (s, 3H), 1.48 (m, 2H), 1.21 (m, 2H); MS m/z: 522.3 [M + 1]. - The synthesis of Compounds 115 follows Synthetic Scheme 4. The syntheses of Compounds 116 to 119, and Compounds 228 to 232 (presented in Table 5) follow a corresponding method.
-
- To a solution of tert-butyl 3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate (50 mg, 0.20 mmol) in THF (1 mL) was added 1-(4-nitrobenzoyl)piperidin-3-one (49 mg, 0.20 mmol), followed by AcOH (5 drops) and Na(OAc)3BH (127 mg, 0.60 mmol). The mixture was stirred at room temperature O/N and diluted with EtOAc and sat. NaHCO3. The organic layer was washed with water and brine, dried (Na2SO4), and concentrated. The crude was purified by reverse phase preparative HPLC (MeOH/H2O, 0-100%) to give tert-butyl 6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate as a TFA salt (48 mg, 40%). LC/MS (ESI) m/z: 485.4 (M+H)+.
-
- To a solution of tert-butyl 6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate TFA salt (48 mg, 0.08 mmol) in THF (2 mL) was added DIEA (31 mg, 42 μL, 0.24 mmol) at 0° C. Benzyl chloroformate (14 mg, 0.08 mmol) was added dropwise and stirred at 0° C. for 1 h. The reaction was diluted with EtOAc and sat. NaHCO3. The organic layer was washed with water and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (EtOAc/hexanes, 0-70%) to give 1-benzyl 5-(tert-butyl) 6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (28 mg, 56%). LC/MS (ESI) m/z: 619.4 (M+H)+.
-
- To a solution of 1-benzyl 5-(tert-butyl) 6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (28 mg, 0.045 mmol) in DCM (1 mL) was added TFA (1 mL). The reaction was stirred at room temperature for 1 h and concentrated to give benzyl 6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a TFA salt, which was used directly without further purification. LC/MS (ESI) m/z=519.4 (M+H)+.
- To a mixture of benzyl 6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (TFA salt, 0.045 mmol) in DCM (1 mL) was added DIEA (29 mg, 39 μL, 0.22 mmol) at 0° C., followed by (S)-2-isocyanato-N,N-dimethyl-2-phenylethan-1-amine HCl salt (12 mg, 0.054 mmol). The solution was stirred at 0° C. for 1 h and diluted with CHC3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by flash column chromatography on silica gel (1.75 M NH3 in MeOH/DCM, 0-10%) to give benzyl 5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (24 mg, 77% over 2 steps). LC/MS (ESI) m/z=709.4 (M+H)+.
-
- A mixture of benzyl 5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (24 mg, 0.034 mmol) and 10% Pd/C (5 mg) in MeOH (5 mL) was degassed. The mixture was stirred under H2 (1 atm) at room temperature for 6 h. The reaction was filtered through Celite® and concentrated to give 3-((1-(4-aminobenzoyl)piperidin-3-yl)amino)-N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide as a clear wax (18 mg, 70%). LC/MS (ESI) m/z: 545.4 (M+H)+.
-
- To a mixture of 3-((1-(4-aminobenzoyl)piperidin-3-yl)amino)-N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide (18 mg, 0.033 mmol) in THF (1 mL) and sat. NaHCO3(1 mL) was added acryloyl chloride (9.0 mg, 0.099 mmol) dropwise at 0° C. The mixture was stirred at 0° C. for 10 min and diluted with CHCl3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was dissolved in i-PrOH (1 mL) and LiGH (1 M, 1 mL) was added. After stirred at room temperature for 10 min, the mixture was diluted with CHCl3/i-PrOH (v/v 4:1) and washed with sat. NaHCO3 and brine, dried (Na2SO4), and concentrated. The crude was purified by reverse phase preparative HPLC (MeOH/H2O, 0-100%) to give 3-((1-(4-acrylamidobenzoyl)piperidin-3-yl)amino)-N—((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide TFA salt as a white solid (10.5 mg, 45%). 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.29 (s, 1H), 9.10 (s, 1H), 7.72-7.55 (m, 1H), 7.49-7.26 (m, 7H), 6.73-6.61 (m, 1H), 6.49-6.40 (m, 1H), 6.27-6.24 (m, 1H), 5.77-5.75 (m, 1H), 5.36-5.26 (m, 1H), 4.55-4.50 (m, 1H), 4.30-4.24 (m, 2H), 3.55-3.45 (m, 3H), 3.38-3.32 (m, 2H), 3.28-3.07 (m, 2H), 2.88 (m, 3H), 2.85 (m, 1H), 2.82 (m, 3H), 2.00-1.90 (m, 1H), 1.85-1.70 (m, 1H), 1.65-1.50 (m, 6H), 1.09-1.03 (m, 1H); MS m/z: 599.4 [M+1].
-
TABLE 5 The following compounds were produced using the corresponding starting compounds according to a method similar to that described for the synthesis of Compound 115: Name Structure Characterization Data Compound 116 (S)-3-((1-(4- acrylamidobenzoyl) piperidin-4-yl)amino)- N-(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.30 (br, 1H), 10.30 (s, 1H), 7.71 (d, J = 9.0 Hz, 2H), 7.36-7.33 (m, 4H), 7.28 (t, J = 7.8 Hz, 2H), 7.18 (t, J = 7.8 Hz, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 5.95 (d, J = 6.0 Hz, 1H), 5.77 (dd, J = 10.2, 2.2 Hz, 1H), 5.33-5.20 (m, 1H), 4.82 (q, J = 7.2 Hz, 1H), 4.26 (q, J = 12.0 Hz, 2H), 3.72-3.58 (m, 1H), 3.16-3.03 (m, 2H), 2.60 (m, 1H), 2.42 (m, 1H), 2.19 (s, 6H), 1.89 (m, 2H), 1.54 (s, 3H), 1.48 (s, 3H), 1.36 (m, 2H); MS m/z: 599.4 [M + 1]. Compound 117 3-(((1R,3S)-3-(4- acrylamidobenzamido) cyclohexyl)amino)-N-((S)- 2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (TFA salt): 600 MHz (DMSO-d6) δ 10.35 (d, J = 3.0 Hz, 1H), 9.11 (s, 1H), 8.09 (d, J = 7.8 Hz, 1H), 7.80 (dd, J = 9.0, 2.0 Hz, 2H), 7.71 (dd, J = 9.0, 1.8 Hz, 2H), 7.46-7.42 (m, 2H), 7.39-7.35 (m, 2H), 7.30- 7.28 (m, 1H), 6.68 (t, J = 7.8 Hz, 1H), 6.44 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 5.78 (dd, J = 10.2, 2.2 Hz, 1H), 5.34-5.30 (m, 1H), 4.52 (t, J = 12.0 Hz, 1H), 4.38 (dd, J = 13.2, 12.0 Hz, 2H), 4.17-4.10 (m, 1H), 3.67 (m, 2H), 3.48 (t, J = 12.0 Hz, 2H), 3.37-3.33 (m, 2H), 2.88 (m, 3H), 2.82 (m, 3H), 1.89-1.80 (m, 2H), 1.71-1.60 (m, 3H), 1.62 (s, 3H), 1.55 (s, 3H), 1.36 (m, 2H); MS m/z: 613.4 [M + 1]. Compound 118 3-(((1R,3R)-3-(4- acrylamidobenzamido) cyclohexyl)amino)-N-((S)- 2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.22 (br, 1H), 10.32 (s, 1H), 8.19 (dd, J = 7.8, 3.0 Hz, 1H), 7.81 (dd, J = 8.4, 3.0 Hz, 2H), 7.70 (dd, J = 8.4, 5.4 Hz, 2H), 7.35 (d, J = 7.8 Hz, 2H), 7.30-7.26 (m, 2H), 7.20-7.16 (m, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 6.01 (m, 1H), 5.77 (dd, J = 10.2, 2.2 Hz, 1H), 5.25-5.17 (m, 1H), 4.89- 4.82 (m, 1H), 4.36-4.27 (m, 2H), 3.90-3.83 (m, 1H), 3.08- 3.01 (m, 1H), 2.68-2.60 (m, 1H), 2.50-2.42 (m, 1H), 2.21 (s, 3H), 2.19 (s, 3H), 2.13-2.08 (m, 1H), 1.92-1.86 (m, 1H), 1.85-1.79 (m, 1H), 1.78-1.73 (m, 1H), 1.54 (s, 3H), 1.48 (d, J = 5.4 Hz, 3H), 1.42-1.35 (m, 1H), 1.28-1.19 (m, 2H), 1.11- 1.03 (m, 1H); MS m/z: 613.4 [M + 1]. Compound 119 (S)-3-((4-(4- acrylamidobenzamido) cyclohexyl)amino)-N-2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.30 (br, 1H), 10.32 (s, 1H), 8.11 (d, J = 7.8 Hz, 1H), 7.80 (d, J = 8.4 Hz, 2H), 7.71 (d, J = 8.4 Hz, 2H), 7.37 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (d, J = 16.8 Hz, 1H), 6.13 (m, 1H), 5.78 (d, J = 10.2, Hz, 1H), 5.13-4.94 (m, 2H), 4.35-4.26 (m, 2H), 3.75- 3.49 (m, 1H), 3.47 (t, J = 5.4 Hz, 1H), 3.40 (t, J = 5.4 Hz, 1H), 3.07-2.97 (m, 2H), 2.50- 2.32 (m, 4H), 1.98 (d, J = 10.8 Hz, 3H), 1.87 (d, J = 10.2 Hz, 3H), 1.77-1.70 (m, 1H), 1.67- 1.60 (m, 1H), 1.56 (s, 3H), 1.49 (s, 3H), 1.47-1.38 (m, 2H), 1.37-1.33 (m, 1H), 1.29-1.17 (m, 4H), 1.15 (t, J = 7.2 Hz, 1H), 0.85-0.76 (m, 1H); MS m/z: 613.4 [M + 1]. Compound 228. 3-(((1R,3S)-3- acrylamidocyclohexyl) amino)-N-((S)- 2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.24 (br, 1H), 9.01 (br, 1H), 8.07 (m, 1H), 7.40 (m, 2H), 7.35 (m, 2H), 7.26 (m, 1H), 6.52 (br, 1H), 6.17 (ddd, J = 17.0, 10.0, 1.2 Hz, 1H), 6.05 (ddd, J = 17.0, 7.0, 1.8 Hz, 1H), 5.55 (ddd, J = 10.0, 7.6, 2.4 Hz, 1H), 5.20 (m, 1H), 4.42 (m, 1H), 4.31 (m, 1H), 3.69 (m, 1H), 2.98 (m, 1H), 2.76 (m, 6H), 2.03 (m, 1H), 1.87 (m, 1H), 1.76 (m, 2H), 1.56 (s, 3H), 1.48 (s, 3H), 1.32 (m, 1H), 1.08 (m, 2H); MS m/z: 494.4 [M + 1]. Compound 229. 3-(((1R,3R)-3- acrylamidocyclohexyl) amino)-N-((S)- 2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.13 (br, 1H), 9.00 (br, 1H), 7.96 (m, 1H), 7.40 (t, J = 7.6 Hz, 2H), 7.36 (t, J = 7.0 Hz, 2H), 7.27 (t, J = 7.0 Hz, 1H), 6.52 (br, 1H), 6.25 (ddd, J = 17.0, 10.6, 7.0 Hz, 1H), 6.04 (ddd, J = 17.0, 3.5, 2.4 Hz, 1H), 5.53 (ddd, J = 10.0, 10.0, 2.4 Hz, 1H), 5.27 (m, 1H), 4.43 (m, 1H), 4.30 (t, J = 11.2 Hz, 1H), 4.01 (m, 1H), 3.50 (m, 1H), 2.78 (m, 6H), 1.74 (m, 2H), 1.61 (m, 1H), 1.57 (s, 3H), 1.52 (m, 3H), 1.48 (s, 3H), 1.22 (m, 2H); MS m/z: 494.4 [M + 1]. Compound 230. (S)-3-((4- acrylamidocyclohexyl) amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR (mixture of diastereomers): 600 MHz (DMSO-d6) δ 11.28 (br, 1H), 9.04 (s, 1H), 7.94 (dd, J = 18.8, 7.6 Hz, 1H), 7.41 (d, J = 7.6 Hz, 2H), 7.36 (t, J = 7.0 Hz, 2H), 7.27 (t, J = 7.6 Hz, 1H), 6.58 (br, 1H), 6.28 (dd, J = 17.0, 10.6 Hz, 1H for one isomer), 6.20 (dd, J = 17.0, 10.0 Hz, 1H for another isomer), 6.05 (ddd, J = 17.0 4.7, 2.4 Hz, 1H), 5.54 (dd, J = 10.0, 2.4 Hz, 1H), 5.29 (br, 1H), 4.42 (dd, J = 23.5, 10.0 Hz, 1H), 4.29 (dd, J = 27.0, 11.2 Hz, 1H), 3.72 (m, 1H), 3.55 (m, 1H), 3.20 (m, 1H), 2.97 (m, 1H), 2.81 (m, 6H), 1.94 (m, 1H), 1.83 (m, 1H), 1.61 (m, 2H), 1.57 (s, 3H), 1.49 (s, 3H for one isomer), 1.48 (s, 3H for another isomer), 1.23 (m, 2H); MS m/z: 494.4 [M + 1]. Compound 231. (S)-3-((1- acryloylpiperidin- 4-yl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.30 (br, 1H), 7.34 (d, J = 7.6 Hz, 2H), 7.29 (t, J = 7.0 Hz, 2H), 7.19 (t, J = 7.0 Hz, 1H), 6.81 (dd, J = 17.0, 10.6 Hz, 1H), 6.08 (dd, J = 17.0, 2.9 Hz, 1H), 5.98 (br, 1H), 5.65 (dd, J = 10.0, 2.4 Hz, 1H), 4.86 (m, 1H), 4.27 (m, 2H), 4.20 (d, J = 13.0 Hz, 1H), 3.95 (d, J = 13.5 Hz, 1H), 3.19 (t, J = 12.3 Hz, 1H), 2.91 (t, J = 11.2 Hz, 1H), 2.22 (m, 6H), 1.88 (m, 2H), 1.55 (s, 3H), 1.48 (s, 3H), 1.28 (m, 2H); MS m/z: 480.3 [M + 1]. Compound 232. 3-((1- acryloylpiperidin- 3-yl)amino)-N-((S)-2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 11.29 (br, 1H), 7.33 (m, 2H), 7.28 (m, 2H), 7.19 (m, 1H), 6.81 (m, 1H), 6.63 (dd, J = 16.4, 10.6 Hz, 1H), 6.10 (dd, J = 15.9, 5.9 Hz, 1H), 6.02 (d, J = 17.0 Hz, 1H), 5.96 (m, 1H), 5.66 (d, J = 9.4 Hz, 1H), 5.56 (dd, J = 18.8, 12.3 Hz, 1H), 5.31 (m, 1H), 4.84 (m, 1H), 4.36 (m, 1H), 4.25 (m, 2H), 4.01 (m, 1H), 3.86 (m, 2H), 3.19 (m, 1H), 3.06 (m, 1H), 2.64 (m, 2H), 2.20 (m, 6H), 1.95 (m, 1H), 1.73 (m, 1H), 1.55 (s, 3H), 1.48 (d, J = 5.9 Hz, 3H), 1.43 (m, 2H); MS m/z: 480.3 [M + 1]. - The synthesis of Compound 233 follows
Synthetic Scheme 5. The syntheses of Compounds 234-240 (presented in Table 6) follow a corresponding method. -
TABLE 6 The following compounds were produced using the corresponding starting compounds according to a method similar to that described for the synthesis of Compound 233: Name Structure Characterization Data Compound 233. (S)-3′-(4- acrylamidobenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-1′,4′-dihydro- 5′H-spiro[cyclopropane- 1,6′-pyrrolo[3,4-c]pyrazole]- 5′-carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.16 (br, 1H), 10.79 (s, 1H), 10.44 (s, 1H), 8.00 (m, 2H), 7.79 (m, 2H), 7.36 (m, 2H), 7.30 (m, 2H), 7.21 (m, 1H), 6.46 (dd, J = 17.0, 10.0 Hz, 1H), 6.29 (dd, J = 17.0, 1.8 Hz, 1H), 5.80 (dd, J = 10.0, 1.8 Hz, 1H), 4.89 (m, 1H), 4.70 (m, 2H), 2.27 (m, 6H), 2.05 (m, 1H), 1.99 (m, 1H), 0.82 (m, 4H); MS m/z: 514.3 [M + 1]. Compound 234. (R)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1- phenylethyl)-6-isopropyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.42 (br, 1H), 10.77 (s, 1H), 10.45 (s, 1H), 8.00 (d, J = 8.2 Hz, 2H), 7.79 (d, J = 8.2 Hz, 2H), 7.38 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.60 (br, 1H), 6.47 (dd, J = 17.0, 10.0 Hz, 1H), 6.29 (dd, J = 17.0, 2.4 Hz, 1H), 5.79 (dd, J = 10.6, 1.8 Hz, 1H), 4.83 (m, 1H), 4.54 (m, 2H), 2.33 (m, 6H), 0.98 (d, J = 5.3 Hz, 3H), 0.84 (m, 1H), 0.49 (d, J = 6.5 Hz, 3H); MS m/z: 530.3 [M + 1]. Compound 235. (S)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1- phenylethyl)-6-isopropyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 600 MHz (DMSO- d6) δ 12.40 (br, 1H), 10.76 (s, 1H), 10.44 (s, 1H), 8.00 (d, J = 7.6 Hz, 2H), 7.78 (d, J = 7.6 Hz, 2H), 7.35 (m, 2H), 7.30 (m, 2H), 7.20 (m, 1H), 6.56 (br, 1H), 6.47 (dd. J = 17.0, 10.0 Hz, 1H), 6.29 (dd, J = 17.0, 1.8 Hz, 1H), 5.80 (dd, J = 10.0, 1.8 Hz, 1H), 4.97 (m, 1H), 4.79 (m, 1H), 4.53 (m, 2H), 2.37 (m, 6H), 1.00 (m, 3H), 0.84 (m, 1H), 0.55 (d, J = 7.0 Hz, 3H); MS m/z: 530.3 [M + 1]. Compound 236. (S)-3′-(4- acrylamidobenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-1′,4′-dihydro-5′H- spiro[cyclohexane-1,6′- pyrrolo[3,4-c]pyrazole]-5′- carboxamide 1H NMR: 500 MHz (DMSO-d6) δ 12.40 (br, 1H), 10.83 (s, 1H), 10.48 (s, 1H), 8.06 (d, J = 8.5 Hz, 2H), 7.86 (d, J = 8.5 Hz, 2H), 7.42 (d, J = 7.3 Hz, 2H), 7.35 (t, J = 7.3 Hz, 2H), 7.25 (t, J = 7.3 Hz, 1H), 6.53 (dd, J = 17.0, 10.0 Hz, 1H), 6.37 (dd, J = 17.0, 1.8 Hz, 1H), 6.27 (m, 1H), 5.88 (dd, J = 10.0, 1.8 Hz, 1H), 4.92 (m, 1H), 4.59 (m, 2H), 2.87 (m, 1H), 2.74 (m, 2H), 2.46 (m, 1H), 2.25 (s, 6H), 1.69 (m, 4H), 1.53 (m, 2H), 1.42 (m, 2H), 1.29 (s, 6H), 1.21 (m, 2H), 0.91 (m, 2H); MS m/z: 556.3 [M + 1]. Compound 237. (R)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6- dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (a mixture of two rotamers): 500 MHz (DMSO-d6) δ 12.33, 12.14 (s, 1H), 10.84, 10.73 (s, 1H), 10.35 (s, 1H), 7.95 (m, 2H), 7.73 (m, 2H), 7.23 (m, 9H), 7.10 (t, J = 7.3 Hz, 1H), 6.40 (dd, J = 17.1, 10.1 Hz, 1H), 6.24 (dd, J = 16.8, 1.8 Hz, 1H), 5.93 (m, 1H), 5.74 (dd, J = 10.1, 1.8 Hz, 1H), 4.73 (m, 1H), 4.61 (m, 2H), 2.21 (m, 1H), 1.99 (m, 6H); MS m/z: 564.3 [M + 1]. Compound 238. (R)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6- dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR: 500 MHz (DMSO-d6) δ 12.33 (s, 1H), 10.75 (s, 1H), 10.35 (s, 1H), 7.95 (m, 2H), 7.73 (m, 2H), 7.21 (m, 10H), 6.40 (dd, J = 17.1, 10.0 Hz, 1H), 6.24 (dd, J = 17.1, 1.8 Hz, 1H), 5.87 (m, 1H), 5.75 (dd, J = 10.1, 1.8 Hz, 1H), 4.72 (m, 2H), 4.61 (m, 1H), 2.57 (m, 1H), 2.31 (m, 1H), 2.11 (s, 6H); MS m/z: 564.3 [M + 1]. Compound 239. (S)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6- dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR (a mixture of two rotamers): 500 MHz (DMSO-d6) δ 12.34, 12.10 (s, 1H), 10.74 (s, 1H), 10.35 (s, 1H), 7.95 (m, 2H), 7.73 (m, 2H), 7.20 (m, 10H), 6.40 (dd, J = 17.1, 10.1 Hz, 1H), 6.24 (dd, J = 17.1, 1.8 Hz, 1H), 5.93 (m, 1H), 5.74 (dd, J = 10.1, 1.8 Hz, 1H), 4.73 (m, 1H), 4.61 (m, 2H), 2.23 (m, 1H), 2.00 (m, 6H); MS m/z: 564.3 [M + 1]. Compound 240. (S)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6- dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide 1H NMR: 500 MHz (DMSO-d6) δ 12.37 (s, 1H), 10.77 (s, 1H), 10.42 (s, 1H), 7.96 (m, 2H), 7.75 (m, 2H), 7.20 (m, 10H), 6.43 (dd, J = 17.1, 10.1 Hz, 1H), 6.24 (dd, J = 17.1, 1.8 Hz, 1H), 5.90 (m, 1H), 5.75 (dd, J = 10.1, 1.8 Hz, 1H), 4.42 (m, 6H), 1.19 (m, 1H); MS m/z: 564.3 [M + 1]. - The synthesis of Compound 241 follows Synthetic Scheme 6. The syntheses of Compounds 242-247 (presented in Table 7) follow a corresponding method.
-
- To a solution of 5-(tert-butyl) ethyl 6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (500 mg, 1.05 mmol) in i-PrOH (5 mL) was added 1 M NaOH aqueous solution (5 mL). The mixture was stirred at rt for 30 min and extracted with CHCl3/i-PrOH (v:v 4:1). The crude was purified by flash column chromatography on silica gel (1.75 M NH3 in MeOH/DCM, 0-15%) to give t-butyl 6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate as a yellow solid (394 mg, 93%). LC/MS (ESI) m/z: 402.4 (M+H)+.
-
- A solution of t-butyl 6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate (394 mg, 0.98 mmol) and methyl iodide (697 mg, 0.31 mL, 4.91 mmol) in THF (5 mL) was stirred at 80° C. overnight. The mixture was cooled and extracted with EtOAc and washed with sat. NaHCO3 and brine. The crude was purified by reverse phase preparative HPLC (MeOH/H2O, 0-100%) to give t-butyl 1,6,6-trimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate (123 mg, 30%) and t-butyl 2,6,6-trimethyl-3-(3-nitrobenzamido)-2,6-dihydropyrrolo[3,4-c]pyrazole-5(4H)-carboxylate (108 mg, 26%) as white solids. LC/MS (ESI) m/z: 416.4 (M+H)+.
-
- Following the previous described procedure starting with t-butyl 1,6,6-trimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate, (S)-3-(3-acrylamidobenzamido)-N-(2-(dimethylamino)-1-phenylethyl)-1,6,6-trimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide was obtained as a white solid. 1H NMR: 500 MHz (DMSO-d6) δ 10.70 (s, 1H), 10.34 (s, 1H), 7.94 (d, J=8.9 Hz, 2H), 7.71 (d, J=8.9 Hz, 2H), 7.31 (d, J=7.3 Hz, 2H), 7.23 (t, J=7.6 Hz, 2H), 7.13 (t, J=7.3 Hz, 1H), 6.40 (dd, J=17.1, 10.1 Hz, 1H), 6.24 (dd, J=17.1, 1.8 Hz, 1H), 6.21 (m, 1H), 5.74 (dd, J=10.1, 1.8 Hz, 1H), 4.81 (q, J=7.3 Hz, 1H), 4.45 (dd, J=15.9, 11.9 Hz, 1H), 3.65 (s, 3H), 2.60 (m, 1H), 2.33 (m, 1H), 2.13 (s, 6H), 1.64 (s, 3H), 1.56 (s, 3H); MS m/z: 530.3 [M+1].
-
TABLE 7 The following compounds were produced using the corresponding starting compounds according to a method similar to that described for the synthesis of Compound 241: Name Structure Characterization Data Compound 242. (S)-3-(4- acrylamidobenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-2,6,6- trimethyl-2,6- dihydropyrrolo[3,4- c]pyrazole-5(4H)- carboxamide 1H NMR: 500 MHz (DMSO- d6) δ 10.40 (s, 1H), 10.22 (s, 1H), 7.93 (d, J = 8.9 Hz, 2H), 7.77 (d, J = 8.9 Hz, 2H), 7.28 (d, J = 7.3 Hz, 2H), 7.22 (t, J = 7.6 Hz, 2H), 7.12 (t, J = 7.3 Hz, 1H), 6.41 (dd, J = 17.1, 10.1 Hz, 1H), 6.24 (dd, J = 17.1, 1.8 Hz, 1H), 6.14 (d, J = 7.3 Hz, 1H), 5.75 (dd, J = 10.1, 1.8 Hz, 1H), 4.81 (q, J = 7.9 Hz, 1H), 4.34 (dd, J = 15.3, 12.5 Hz, 1H), 3.67 (s, 3H), 2.57 (m, 1H), 2.30 (m, 1H), 2.12 (s, 6H), 1.53 (s, 3H), 1.46 (s, 3H); MS m/z: 530.3 [M + 1]. Compound 243. (S)-3-(4-acrylamido-2- methoxybenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-1,6,6- trimethyl-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 500 MHz (DMSO- d6) δ 10.40 (s, 1H), 10.01 (s, 1H), 7.79 (d, J = 8.5 Hz, 1H), 7.58 (dd, J = 1.5 Hz, 1H), 7.32 (m, 2H), 7.25 (t, J = 7.3 Hz, 2H), 7.16 (t, J = 7.3 Hz, 1H), 6.40 (dd, J = 17.1, 10.1 Hz, 1H), 6.37 (br, 1H), 6.25 (dd, J = 16.8, 1.8 Hz, 1H), 5.76 (dd, J = 10.1, 1.8 Hz, 1H), 4.92 (m, 1H), 4.49 (m, 2H), 3.89 (s, 3H), 3.64 (s, 3H), 2.30 (m, 6H), 1.64 (s, 3H), 1.57 (s, 3H); MS m/z: 560.3 [M + 1]. Compound 244. (S)-3-(4-acrylamido-2- methoxybenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-2,6,6- trimethyl-2,6- dihydropyrrolo[3,4- c]pyrazole-5(4H)- carboxamide 1H NMR: 500 MHz (DMSO- d6) δ 10.52 (s, 1H), 10.01 (s, 1H), 7.79 (d, J = 8.5 Hz, 1H), 7.65 (dd, J = 1.8 Hz, 1H), 7.31 (d, J = 8.5 Hz, 2H), 7.24 (t, J = 7.6 Hz, 2H), 7.14 (t, J = 7.3 Hz, 1H), 6.43 (dd, J = 16.8, 10.1 Hz, 1H), 6.25 (br, 1H), 6.25 (dd, J = 16.8, 1.8 Hz, 1H), 5.76 (dd, J = 10.1, 1.8 Hz, 1H), 4.89 (m, 1H), 4.41 (m, 2H), 3.90 (d, 3H), 3.67 (s, 3H), 2.23 (m, 6H), 1.54 (s, 3H), 1.46 (s, 3H); MS m/z: 560.3 [M + 1]. Compound 245. 3-(4- acrylamidobenzamido)- N-(1- (dimethylamino)propan-2- yl)-1,6,6-trimethyl-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 500 MHz (DMSO- d6) δ 10.68 (s, 1H), 10.33 (s, 1H), 7.93 (d, J = 8.9 Hz, 2H), 7.71 (d, J = 8.9 Hz, 2H), 6.39 (dd, J = 17.1, 10.1 Hz, 1H), 6.23 (dd, J = 17.1, 10.1 Hz, 1H), 5.74 (dd, J = 10.1, 1.8 Hz, 1H), 5.64 (d, J = 7.9 Hz, 1H), 4.33 (dd, J = 21.7, 11.9 Hz, 2H), 3.74 (m, 1H), 3.66 (s, 3H), 2.20 (dd, J = 11.9, 7.0 Hz, 1H), 2.10 (m, 1H), 2.08 (s, 6H), 1.64 (s, 6H), 1.00 (d, J = 6.4 Hz, 3H); MS m/z: 530.3 [M + 1]. Compound 246. (S)-2-(dimethylamino)-1- phenylethyl 3-(4- acrylamidobenzamido)- 1,6,6-trimethyl-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxylate 1H NMR (a mixture of two rotamers): 500 MHz (DMSO- d6) δ 10.74, 10.70 (s, 1H), 10.33, 10.32 (s, 1H), 7.93 (m, 2H), 7.69 (m, 2H), 7.32 (m, 4H), 7.23 (m, 1H), 6.39 (m, 1H), 6.23 (m, 1H), 5.75 (m, 1H), 4.56 (dd, J = 15.3, 13.4 Hz, 2H), 4.40, 4.31 (d, J = 13.4 Hz, 1H), 3.68, 3.67 (s, 3H), 2.73 (m, 1H), 2.45 (m, 1H), 2.17, 2.15 (s, 6H), 1.73, 1.55 (s, 3H), 1.64 (s, 3H); MS m/z: 531.3 [M + 1]. Compound 247. (S)-N-(2-(dimethylamino)- 1-phenylethyl)-1,6,6- trimethyl-3-(4- propionamidobenzamido)- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide 1H NMR: 500 MHz (DMSO- d6) δ 10.79 (s, 1H), 10.18 (s, 1H), 8.03 (d, J = 8.9 Hz, 2H), 7.76 (d, J = 8.9 Hz, 2H), 7.43 (d, J = 7.3 Hz, 2H), 7.35 (t, J = 7.3 Hz, 2H), 7.25 (t, J = 7.3 Hz, 1H), 6.34 (d, J = 7.3 Hz, 1H), 4.93 (q, J = 7.9 Hz, 1H), 4.56 (dd, J = 16.5, 11.9 Hz, 2H), 3.78 (s, 3H), 2.72 (m, 1H), 2.45 (m, 1H), 2.42 (q, J = 7.6 Hz, 2H), 2.25 (s, 6H), 1.77 (s, 3H), 1.69 (s, 3H), 1.16 (t, J = 7.3 Hz, 3H); MS m/z: 532.4 [M + 1]. - Compounds of the invention were assayed for activity against a variety of different kinases. Exemplary results are presented as calculated IC50 values (Table A1 & A2). In Table A1 and A2 “A” represents a calculated IC50 value of less than 100 nM; “B” represents a calculated IC50 value of greater than or equal to 100 nM and less than 1 μM; and “C” represents a calculated IC50 value of 1 μM or greater. The co-factors used for each kinase in the assays were as follows: CDK7: cyclin H and MNAT1; CDK2: cyclin A; CDK9: cyclin K.
-
TABLE A1 Calculated IC50 values of exemplary compounds of the invention against CDK7. Compound No. CDK7 IC50 101 A 102 A 103 A 104 A 105 A 106 B 107 A 108 A 109 A 110 A 111 B 112 A 113 A 114 A 115 A 116 A 117 A 118 A 119 A 120 A 123 A 214 A 215 A 216 A 217 A 222 A 231 A 232 A 233 A 234 A 235 C 236 B 237 C 238 C 239 C 240 C 241 A 242 C 243 C 244 C 245 C 246 B -
TABLE A2 Calculated IC50 values of exemplary compounds of the invention against various kinases. Compound No. Kinase 101 106 CDK2 C CDK9 C CHEK2 A FGR A HIPK4 B PRKCQ A RET A SRC A MELK B B - Exemplary compounds of the invention were tested at different concentrations. Cells were plated in 96-well plates at the following seeding densities: Jurkat T-cell acute lymphoblastic leukemia 25,000 cells/well; HCT116 colorectal carcinoma 8,000 cells/well; Kelly neuroblastoma 4,000 cells/well. The cells were treated with various concentration of compounds (ranging from 1 nM to 10 μM). DMSO solvent with no compound served as a control. Following incubation for 72 hours, cell survival following treatment with exemplary compounds described herein was assessed by CellTiter-Glo® Luminescent cell viability assay (Promega). IC50 values were determined using GRAPHPAD PRISM 6 software. Exemplary results are shown in Table A3, wherein “A” represents a calculated IC50 value of less than 500 nM; “B” represents a calculated IC50 value of greater than or equal to 500 nM and less than 5000 μM; and “C” represents a calculated IC50 value of 5000 μM or greater
-
TABLE A3 Calculated IC50 values of exemplary compounds of the invention against cancer cells. Jurkat T-cell acute Compound lymphoblastic HCT116 colorectal Kelly No. leukemia carcinoma neuroblastoma 101 A A B 102 C 104 B B 106 C 107 B 112 B - CAK complex (Millipore cat #14-476) in 40 mM Hepes pH 7.4, 150 mM NaCl, 5% glycerol and 1 mM DTT with protease and phosphatase inhibitors was incubated with a 10-fold molar excess of
Compound 101 for 6 hrs at 37° C. Proteins were resolved by SDS-PAGE, bands corresponding to CDK7 were digested in-gel with trypsin, and peptides analyzed by nano LC-MS using an Orbitrap XL mass spectrometer (ThermoFisher Scientific, San Jose, Calif.). Efficiency of labeling was estimated from the reduction in signal of the Cys312 containing peptide YFSNRPGPTPGCQLPRPNCPVETLK compared to DMSO control. Signals from CDK7 peptides VPFLPGDSDLDQLTR and LDFLGEGQFATVYK were used for normalization. SeeFIG. 1 for the total ion chromatograms (TIC) and extracted ion chromatograms (EIC) of the CDK7 peptides treated with DMSO (A-D) or Compound 101 (E-H). The labeled peptide was detected by mass spectrometry, as shown in the spectrum ofFIG. 2 . The signal at m/z 687.7498 corresponds to YFSNRPGPTPGCQLPRPNCPVETLK, labeled withCompound 101 at Cys312. - In the claims articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
- Furthermore, the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements and/or features, certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein. It is also noted that the terms “comprising” and “containing” are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.
- This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present invention that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the invention can be excluded from any claim, for any reason, whether or not related to the existence of prior art.
- Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present invention, as defined in the following claims.
Claims (29)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/034,822 US20220024929A9 (en) | 2014-12-23 | 2020-09-28 | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201462096040P | 2014-12-23 | 2014-12-23 | |
PCT/US2015/000297 WO2016105528A2 (en) | 2014-12-23 | 2015-12-23 | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
US201715538763A | 2017-06-22 | 2017-06-22 | |
US17/034,822 US20220024929A9 (en) | 2014-12-23 | 2020-09-28 | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2015/000297 Division WO2016105528A2 (en) | 2014-12-23 | 2015-12-23 | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
US15/538,763 Division US10870651B2 (en) | 2014-12-23 | 2015-12-23 | Inhibitors of cyclin-dependent kinase 7 (CDK7) |
Publications (2)
Publication Number | Publication Date |
---|---|
US20210115051A1 US20210115051A1 (en) | 2021-04-22 |
US20220024929A9 true US20220024929A9 (en) | 2022-01-27 |
Family
ID=56151614
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/538,763 Active 2036-05-27 US10870651B2 (en) | 2014-12-23 | 2015-12-23 | Inhibitors of cyclin-dependent kinase 7 (CDK7) |
US17/034,822 Pending US20220024929A9 (en) | 2014-12-23 | 2020-09-28 | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/538,763 Active 2036-05-27 US10870651B2 (en) | 2014-12-23 | 2015-12-23 | Inhibitors of cyclin-dependent kinase 7 (CDK7) |
Country Status (7)
Country | Link |
---|---|
US (2) | US10870651B2 (en) |
EP (1) | EP3236959A4 (en) |
JP (1) | JP6854762B2 (en) |
AU (1) | AU2015371251B2 (en) |
CA (1) | CA2972239A1 (en) |
HK (1) | HK1245260A1 (en) |
WO (1) | WO2016105528A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11826365B2 (en) | 2009-12-29 | 2023-11-28 | Dana-Farber Cancer Institute, Inc. | Type II raf kinase inhibitors |
Families Citing this family (27)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2013074986A1 (en) | 2011-11-17 | 2013-05-23 | Dana-Farber Cancer Institute, Inc. | Inhibitors of c-jun-n-terminal kinase (jnk) |
WO2014063068A1 (en) | 2012-10-18 | 2014-04-24 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
US9758522B2 (en) | 2012-10-19 | 2017-09-12 | Dana-Farber Cancer Institute, Inc. | Hydrophobically tagged small molecules as inducers of protein degradation |
US10000483B2 (en) | 2012-10-19 | 2018-06-19 | Dana-Farber Cancer Institute, Inc. | Bone marrow on X chromosome kinase (BMX) inhibitors and uses thereof |
CA2927917C (en) | 2013-10-18 | 2022-08-09 | Syros Pharmaceuticals, Inc. | Heteroaromatic compounds useful for the treatment of proliferative diseases |
AU2014337044A1 (en) | 2013-10-18 | 2016-05-05 | Dana-Farber Cancer Institute, Inc. | Polycyclic inhibitors of cyclin-dependent kinase 7 (CDK7) |
AU2015240518A1 (en) * | 2014-04-05 | 2016-10-20 | Syros Pharmaceuticals, Inc. | Inhibitors of cyclin-dependent kinase 7 (CDK7) |
US9862688B2 (en) | 2014-04-23 | 2018-01-09 | Dana-Farber Cancer Institute, Inc. | Hydrophobically tagged janus kinase inhibitors and uses thereof |
WO2015164614A1 (en) | 2014-04-23 | 2015-10-29 | Dana-Farber Cancer Institute, Inc. | Janus kinase inhibitors and uses thereof |
WO2016105528A2 (en) | 2014-12-23 | 2016-06-30 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
AU2016243529B2 (en) | 2015-03-27 | 2021-03-25 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinases |
CN113773257A (en) | 2015-06-04 | 2021-12-10 | 奥瑞基尼探索技术有限公司 | Substituted heterocyclic derivatives as CDK inhibitors |
US10702527B2 (en) | 2015-06-12 | 2020-07-07 | Dana-Farber Cancer Institute, Inc. | Combination therapy of transcription inhibitors and kinase inhibitors |
AU2016319125B2 (en) | 2015-09-09 | 2021-04-08 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinases |
JP7299837B2 (en) * | 2016-12-23 | 2023-06-28 | アクイナ ファーマシューティカルズ, インコーポレイテッド | Compounds, compositions and methods of use |
US10913983B2 (en) | 2017-07-18 | 2021-02-09 | University Of South Carolina | Sensitivity markers and uses for CDK7 inhibitors in breast cancers |
EP3787629A4 (en) | 2018-05-02 | 2022-01-05 | Kinnate Biopharma Inc. | Inhibitors of cyclin-dependent kinases |
CA3104131A1 (en) | 2018-06-29 | 2020-01-02 | Kinnate Biopharma Inc. | Inhibitors of cyclin-dependent kinases |
JPWO2020100944A1 (en) * | 2018-11-14 | 2021-10-07 | 宇部興産株式会社 | Dihydropyrrolopyrazole derivative |
AU2019413694A1 (en) * | 2018-12-28 | 2021-06-10 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinase 7 and uses thereof |
JP2022541644A (en) * | 2019-07-23 | 2022-09-26 | ダナ-ファーバー キャンサー インスティテュート, インコーポレイテッド | Inhibitors of cyclin-dependent kinase 7 and their uses |
WO2021026109A1 (en) * | 2019-08-05 | 2021-02-11 | Dana-Farber Cancer Institute, Inc. | Degraders of cyclin-dependent kinase 7 (cdk7) and uses thereof |
IL292519A (en) * | 2019-10-29 | 2022-06-01 | Syros Pharmaceuticals Inc | Methods of treating cancer in biomarker-identified patients with inhibitors of cyclin-dependent kinase 7 (cdk7) |
EP4081527A4 (en) * | 2019-12-24 | 2024-01-10 | Dana Farber Cancer Inst Inc | The combination of cyclin dependent kinase 7 inhibitor and immunotherapy for treatment of cancer |
CN116194103A (en) | 2020-09-25 | 2023-05-30 | 詹森药业有限公司 | Cyclin dependent kinase 7 (CDK 7) non-covalent inhibitors |
WO2023109876A1 (en) * | 2021-12-16 | 2023-06-22 | Edigene Therapeutics (Beijing) Inc. | Biomarkers for colorectal cancer treatment |
WO2023227125A1 (en) * | 2022-05-26 | 2023-11-30 | 杭州德睿智药科技有限公司 | New fused-heterocyclic compound as cdk inhibitor and use thereof |
Family Cites Families (254)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB796524A (en) | 1956-03-21 | 1958-06-11 | Hickson & Welch Ltd | Improvements in or relating to optical whitening agents |
US4231938A (en) | 1979-06-15 | 1980-11-04 | Merck & Co., Inc. | Hypocholesteremic fermentation products and process of preparation |
US4270537A (en) | 1979-11-19 | 1981-06-02 | Romaine Richard A | Automatic hypodermic syringe |
WO1984002131A1 (en) | 1982-11-22 | 1984-06-07 | Sandoz Ag | Analogs of mevalolactone and derivatives thereof, processes for their production, pharmaceutical compositions containing them and their use as pharmaceuticals |
US4828991A (en) | 1984-01-31 | 1989-05-09 | Akzo N.V. | Tumor specific monoclonal antibodies |
US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
CA1283827C (en) | 1986-12-18 | 1991-05-07 | Giorgio Cirelli | Appliance for injection of liquid formulations |
GB8704027D0 (en) | 1987-02-20 | 1987-03-25 | Owen Mumford Ltd | Syringe needle combination |
US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
US4940460A (en) | 1987-06-19 | 1990-07-10 | Bioject, Inc. | Patient-fillable and non-invasive hypodermic injection device assembly |
US4885314A (en) | 1987-06-29 | 1989-12-05 | Merck & Co., Inc. | Novel HMG-CoA reductase inhibitors |
US4782084A (en) | 1987-06-29 | 1988-11-01 | Merck & Co., Inc. | HMG-COA reductase inhibitors |
US5339163A (en) | 1988-03-16 | 1994-08-16 | Canon Kabushiki Kaisha | Automatic exposure control device using plural image plane detection areas |
FR2638359A1 (en) | 1988-11-03 | 1990-05-04 | Tino Dalto | SYRINGE GUIDE WITH ADJUSTMENT OF DEPTH DEPTH OF NEEDLE IN SKIN |
US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
US5420245A (en) | 1990-04-18 | 1995-05-30 | Board Of Regents, The University Of Texas | Tetrapeptide-based inhibitors of farnesyl transferase |
US5190521A (en) | 1990-08-22 | 1993-03-02 | Tecnol Medical Products, Inc. | Apparatus and method for raising a skin wheal and anesthetizing skin |
US5527288A (en) | 1990-12-13 | 1996-06-18 | Elan Medical Technologies Limited | Intradermal drug delivery device and method for intradermal delivery of drugs |
US5747469A (en) | 1991-03-06 | 1998-05-05 | Board Of Regents, The University Of Texas System | Methods and compositions comprising DNA damaging agents and p53 |
GB9118204D0 (en) | 1991-08-23 | 1991-10-09 | Weston Terence E | Needle-less injector |
SE9102652D0 (en) | 1991-09-13 | 1991-09-13 | Kabi Pharmacia Ab | INJECTION NEEDLE ARRANGEMENT |
US5328483A (en) | 1992-02-27 | 1994-07-12 | Jacoby Richard M | Intradermal injection device with medication and needle guard |
US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
US5569189A (en) | 1992-09-28 | 1996-10-29 | Equidyne Systems, Inc. | hypodermic jet injector |
US5334144A (en) | 1992-10-30 | 1994-08-02 | Becton, Dickinson And Company | Single use disposable needleless injector |
CA2111902A1 (en) | 1992-12-21 | 1994-06-22 | Jack Beuford Campbell | Antitumor compositions and methods of treatment |
WO1994019357A1 (en) | 1993-02-23 | 1994-09-01 | Merrell Dow Pharmaceuticals Inc. | Farnesyl:protein transferase inhibitors as anticancer agents |
CA2118985A1 (en) | 1993-04-02 | 1994-10-03 | Dinesh V. Patel | Heterocyclic inhibitors of farnesyl protein transferase |
AU6909194A (en) | 1993-05-14 | 1994-12-12 | Board Of Regents, The University Of Texas System | Preparation of n-cyanodithioimino-carbonates and 3-mercapto-5-amino-1h-1,2,4-triazole |
US5602098A (en) | 1993-05-18 | 1997-02-11 | University Of Pittsburgh | Inhibition of farnesyltransferase |
US5728830A (en) | 1993-09-22 | 1998-03-17 | Kyowa Hakko Kogyo Co., Ltd. | Farnesyltransferase inhibitor |
IL111235A (en) | 1993-10-15 | 2001-03-19 | Schering Plough Corp | Pharmaceutical compositions for inhibition of g-protein function and for treatment of proliferative diseases containing tricyclic compounds some such compounds and process for preparing part of them |
US5719148A (en) | 1993-10-15 | 1998-02-17 | Schering Corporation | Tricyclic amide and urea compounds useful for inhibition of g-protein function and for treatment of proliferative diseases |
DK0723538T3 (en) | 1993-10-15 | 2002-03-18 | Schering Corp | Tricyclic carbamate compounds useful for inhibition of G protein function and for the treatment of proliferative diseases |
US5661152A (en) | 1993-10-15 | 1997-08-26 | Schering Corporation | Tricyclic sulfonamide compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
US5721236A (en) | 1993-10-15 | 1998-02-24 | Schering Corporation | Tricyclic carbamate compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
AU698960B2 (en) | 1993-10-15 | 1998-11-12 | Schering Corporation | Tricyclic sulfonamide compounds useful for inhibition of g-protein function and for treatment of proliferative diseases |
CA2173590A1 (en) | 1993-10-25 | 1995-05-04 | Gary Louis Bolton | Substituted tetra- and pentapeptide inhibitors of protein:farnesyl transferase |
DK0677039T3 (en) | 1993-11-04 | 1999-09-27 | Abbott Lab | Cyclobutane derivatives such as squalene synthetase and protein farnesyl transferase inhibitors |
US5783593A (en) | 1993-11-04 | 1998-07-21 | Abbott Laboratories | Inhibitors of squalene synthetase and protein farnesyltransferase |
WO1995012612A1 (en) | 1993-11-05 | 1995-05-11 | Warner-Lambert Company | Substituted di- and tripeptide inhibitors of protein:farnesyl transferase |
US5484799A (en) | 1993-12-09 | 1996-01-16 | Abbott Laboratories | Antifungal dorrigocin derivatives |
WO1995024176A1 (en) | 1994-03-07 | 1995-09-14 | Bioject, Inc. | Ampule filling device |
US5466220A (en) | 1994-03-08 | 1995-11-14 | Bioject, Inc. | Drug vial mixing and transfer device |
EP0750609A4 (en) | 1994-03-15 | 1997-09-24 | Eisai Co Ltd | Isoprenyl transferase inhibitors |
US6312699B1 (en) | 1994-03-28 | 2001-11-06 | Uab Research Foundation | Ligands added to adenovirus fiber |
RU95104898A (en) | 1994-03-31 | 1996-12-27 | Бристоль-Мейерз Сквибб Компани (US) | Imedazole containing inhibitors of ferneside proteintansferase, and method of treatment diseases related therewith |
US5523430A (en) | 1994-04-14 | 1996-06-04 | Bristol-Myers Squibb Company | Protein farnesyl transferase inhibitors |
US5510510A (en) | 1994-05-10 | 1996-04-23 | Bristol-Meyers Squibb Company | Inhibitors of farnesyl protein transferase |
US5563255A (en) | 1994-05-31 | 1996-10-08 | Isis Pharmaceuticals, Inc. | Antisense oligonucleotide modulation of raf gene expression |
BR9508187A (en) | 1994-06-10 | 1997-08-12 | Rhone Poulenc Rorer Sa | Pharmaceutical products and composition |
US5571792A (en) | 1994-06-30 | 1996-11-05 | Warner-Lambert Company | Histidine and homohistidine derivatives as inhibitors of protein farnesyltransferase |
DE69514367T2 (en) | 1994-08-11 | 2000-07-27 | Banyu Pharma Co Ltd | SUBSTITUTED AMID DERIVATIVES |
CA2155448A1 (en) | 1994-08-11 | 1996-02-12 | Katerina Leftheris | Inhibitors of farnesyl protein transferase |
EP0805154A1 (en) | 1994-08-12 | 1997-11-05 | Banyu Pharmaceutical Co., Ltd. | N,n-disubstituted amic acid derivative |
JPH10510261A (en) | 1994-12-09 | 1998-10-06 | ワーナー−ランバート・カンパニー | Protein: substituted tetra- and pentapeptide inhibitors of farnesyltransferase |
US5599302A (en) | 1995-01-09 | 1997-02-04 | Medi-Ject Corporation | Medical injection system and method, gas spring thereof and launching device using gas spring |
JP3929069B2 (en) | 1995-01-12 | 2007-06-13 | ユニバーシティ オブ ピッツバーグ | Inhibitors of prenyltransferase |
FR2729390A1 (en) | 1995-01-18 | 1996-07-19 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
FR2730491B1 (en) | 1995-02-09 | 1997-03-14 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
FR2730492B1 (en) | 1995-02-09 | 1997-03-14 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
US5700806A (en) | 1995-03-24 | 1997-12-23 | Schering Corporation | Tricyclic amide and urea compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
US5684013A (en) | 1995-03-24 | 1997-11-04 | Schering Corporation | Tricyclic compounds useful for inhibition of g-protein function and for treatment of proliferative diseases |
IL117580A0 (en) | 1995-03-29 | 1996-07-23 | Merck & Co Inc | Inhibitors of farnesyl-protein transferase and pharmaceutical compositions containing them |
US5891872A (en) | 1995-04-07 | 1999-04-06 | Schering Corporation | Tricyclic compounds |
IL117798A (en) | 1995-04-07 | 2001-11-25 | Schering Plough Corp | Tricyclic compounds useful for inhibition of g-protein function and for treatment of proliferative diseases and pharmaceutical compositions comprising them |
AU5432696A (en) | 1995-04-07 | 1996-10-23 | Pharmacopeia, Inc. | Carbonyl-piperazinyl and piperidinil compounds which inhibit farnesyl protein transferase |
US5712280A (en) | 1995-04-07 | 1998-01-27 | Schering Corporation | Tricyclic compounds useful for inhibition of G-protein function and for treatment of proliferative diseases |
US5831115A (en) | 1995-04-21 | 1998-11-03 | Abbott Laboratories | Inhibitors of squalene synthase and protein farnesyltransferase |
IL118101A0 (en) | 1995-05-03 | 1996-09-12 | Abbott Lab | Inhibitors of farnesyltransferase |
WO1997000252A1 (en) | 1995-06-16 | 1997-01-03 | Warner-Lambert Company | Tricyclic inhibitors of protein farnesyltransferase |
FR2736641B1 (en) | 1995-07-10 | 1997-08-22 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
FR2736638B1 (en) | 1995-07-12 | 1997-08-22 | Rhone Poulenc Rorer Sa | NOVEL FARNESYL TRANSFERASE INHIBITORS, THEIR PREPARATION AND THE PHARMACEUTICAL COMPOSITIONS CONTAINING THEM |
CH690163A5 (en) | 1995-07-28 | 2000-05-31 | Symphar Sa | Derivatives substituted gem-diphosphonates useful as anti-cancer. |
ATE236161T1 (en) | 1995-11-01 | 2003-04-15 | Novartis Pharma Gmbh | PURINE DERIVATIVES AND PROCESS FOR THEIR PRODUCTION |
CA2235986C (en) | 1995-11-06 | 2006-09-12 | University Of Pittsburgh | Inhibitors of protein isoprenyl transferases |
WO1997018813A1 (en) | 1995-11-22 | 1997-05-29 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
DE69620445T2 (en) | 1995-12-08 | 2002-12-12 | Janssen Pharmaceutica Nv | (IMIDAZOL-5-YL) METHYL-2-CHINOLINO DERIVATIVES AS A FARNESYL PROTEIN TRANSFERASE INHIBITOR |
DK1019392T3 (en) | 1995-12-22 | 2006-03-20 | Schering Corp | Tricyclic amides useful for inhibiting G protein function and for treating proliferative diseases |
US5893397A (en) | 1996-01-12 | 1999-04-13 | Bioject Inc. | Medication vial/syringe liquid-transfer apparatus |
WO1997026246A1 (en) | 1996-01-16 | 1997-07-24 | Warner-Lambert Company | Substituted histidine inhibitors of protein farnesyltransferase |
US6673927B2 (en) | 1996-02-16 | 2004-01-06 | Societe De Conseils De Recherches Et D'applications Scientifiques, S.A.S. | Farnesyl transferase inhibitors |
WO1997038665A2 (en) | 1996-04-03 | 1997-10-23 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
PL330120A1 (en) | 1996-05-22 | 1999-04-26 | Warner Lambert Co | Farnesilic protein transferase inhibitors |
AU709409B2 (en) | 1996-07-15 | 1999-08-26 | Bristol-Myers Squibb Company | Thiadioxobenzodiazepine inhibitors of farnesyl protein transferase |
US5866702A (en) | 1996-08-02 | 1999-02-02 | Cv Therapeutics, Incorporation | Purine inhibitors of cyclin dependent kinase 2 |
CA2276081A1 (en) | 1996-12-30 | 1998-07-09 | Lekhanh O. Tran | Inhibitors of farnesyl-protein transferase |
WO1998029119A1 (en) | 1996-12-30 | 1998-07-09 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
US5993412A (en) | 1997-05-19 | 1999-11-30 | Bioject, Inc. | Injection apparatus |
US6214852B1 (en) | 1998-10-21 | 2001-04-10 | Bristol-Myers Squibb Company | N-[5-[[[5-alkyl-2-oxazolyl]methyl]thio]-2-thiazolyl]-carboxamide inhibitors of cyclin dependent kinases |
JP2002536968A (en) | 1999-01-29 | 2002-11-05 | イムクローン システムズ インコーポレイティド | Antibodies specific for KDR and uses thereof |
GB9903762D0 (en) | 1999-02-18 | 1999-04-14 | Novartis Ag | Organic compounds |
GB9904387D0 (en) | 1999-02-25 | 1999-04-21 | Pharmacia & Upjohn Spa | Antitumour synergistic composition |
WO2000061186A1 (en) | 1999-04-08 | 2000-10-19 | Arch Development Corporation | Use of anti-vegf antibody to enhance radiation in cancer therapy |
PE20010306A1 (en) | 1999-07-02 | 2001-03-29 | Agouron Pharma | INDAZOLE COMPOUNDS AND PHARMACEUTICAL COMPOSITIONS CONTAINING THEM USEFUL FOR THE INHIBITION OF PROTEIN KINASE |
US6921763B2 (en) | 1999-09-17 | 2005-07-26 | Abbott Laboratories | Pyrazolopyrimidines as therapeutic agents |
CZ2002936A3 (en) | 1999-09-17 | 2002-10-16 | Abbott Gmbh & Co. Kg | Pyrazolopyrimidines functioning as therapeutic preparations |
HU229824B1 (en) | 2000-08-10 | 2014-08-28 | Pfizer Italia Srl | Bicyclo-pyrazoles active as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them |
DE60138140D1 (en) | 2000-10-31 | 2009-05-07 | Aventis Pharma Inc | ACYL AND SULFONYL DERIVATIVES OF 6,9-DISUBSTITUTED 2- (TRANS-1,4-DIAMINOCYCLOHEXYL) -PURINES AND THEIR USE AS ANTIPROLIFERATIVE AGENTS |
US7429599B2 (en) | 2000-12-06 | 2008-09-30 | Signal Pharmaceuticals, Llc | Methods for treating or preventing an inflammatory or metabolic condition or inhibiting JNK |
ES2272567T3 (en) | 2000-12-21 | 2007-05-01 | Vertex Pharmaceuticals Incorporated | PIRAZOL COMPOUNDS USED AS PROTEIN KINASE INHIBITORS. |
FR2818642B1 (en) | 2000-12-26 | 2005-07-15 | Hoechst Marion Roussel Inc | NOVEL DERIVATIVES OF PURINE, PROCESS FOR PREPARING THEM, THEIR USE AS MEDICAMENTS, PHARMACEUTICAL COMPOSITIONS AND THEIR NEW USE |
MXPA03008560A (en) | 2001-03-22 | 2004-06-30 | Abbot Gmbh & Co Kg | Single-stage pfc + ballast control circuit/general purpose power converter. |
US6949544B2 (en) | 2001-03-29 | 2005-09-27 | Vertex Pharmaceuticals Incorporated | Inhibitors of c-Jun N-terminal kinases (JNK) and other protein kinases |
WO2002080952A2 (en) | 2001-04-09 | 2002-10-17 | Lorantis Limited | Therapeutic use and identification of modulators of a hedgehog signalling pathway or one of its target pathways |
US6881737B2 (en) | 2001-04-11 | 2005-04-19 | Amgen Inc. | Substituted triazinyl acrylamide derivatives and methods of use |
ES2274035T3 (en) | 2001-06-01 | 2007-05-16 | Vertex Pharmaceuticals Incorporated | USEFUL TIAZOL COMPOUNDS AS PROTEIN QUINASE INHIBITORS. |
US6825190B2 (en) | 2001-06-15 | 2004-11-30 | Vertex Pharmaceuticals Incorporated | Protein kinase inhibitors and uses thereof |
US7115617B2 (en) | 2001-08-22 | 2006-10-03 | Amgen Inc. | Amino-substituted pyrimidinyl derivatives and methods of use |
US6939874B2 (en) | 2001-08-22 | 2005-09-06 | Amgen Inc. | Substituted pyrimidinyl derivatives and methods of use |
WO2003026665A1 (en) | 2001-09-26 | 2003-04-03 | Bayer Pharmaceuticals Corporation | 2-phenylamino-4-(5-pyrazolylamino)-pyrimidine derivatives as kinase inhibitors, in particular, src kinase inhibitors |
AU2002353186A1 (en) | 2001-12-19 | 2003-06-30 | Smithkline Beecham P.L.C. | (1-h-indazol-3-yl) -amide derivatives as gsk-3 inhibitors |
FR2836915B1 (en) | 2002-03-11 | 2008-01-11 | Aventis Pharma Sa | AMINOINDAZOLE DERIVATIVES, PREPARATION METHOD AND INTERMEDIATES THEREOF AS MEDICAMENTS AND PHARMACEUTICAL COMPOSITIONS COMPRISING THE SAME |
WO2003095448A1 (en) | 2002-05-06 | 2003-11-20 | Bayer Pharmaceuticals Corporation | Pyridinyl amino pyrimidine derivatives useful for treating hyper-proliferative disorders |
EP1506176B1 (en) | 2002-05-17 | 2013-04-24 | Pfizer Italia S.r.l. | Aminoindazole derivatives active as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them |
WO2004005283A1 (en) | 2002-07-09 | 2004-01-15 | Vertex Pharmaceuticals Incorporated | Imidazoles, oxazoles and thiazoles with protein kinase inhibiting activities |
TWI329112B (en) | 2002-07-19 | 2010-08-21 | Bristol Myers Squibb Co | Novel inhibitors of kinases |
GB0217757D0 (en) | 2002-07-31 | 2002-09-11 | Glaxo Group Ltd | Novel compounds |
DE10239042A1 (en) | 2002-08-21 | 2004-03-04 | Schering Ag | New fused macrocyclic pyrimidine derivatives, useful as e.g. cyclin-dependent kinase inhibitors for treating e.g. cancer, autoimmune, cardiovascular or neurodegenerative diseases or viral infections |
US7119200B2 (en) | 2002-09-04 | 2006-10-10 | Schering Corporation | Pyrazolopyrimidines as cyclin dependent kinase inhibitors |
CN1880317B (en) | 2002-09-04 | 2012-10-10 | 先灵公司 | Novel pyrazolopyrimidines as cyclin dependent kinase inhibitors |
ATE362474T1 (en) | 2002-09-04 | 2007-06-15 | Schering Corp | PYRAZOLO(1,5-A)PYRIMIDINES AS INHIBITORS OF CYCLIN-DEPENDENT KINASES |
US7205308B2 (en) | 2002-09-04 | 2007-04-17 | Schering Corporation | Trisubstituted 7-aminopyrazolopyrimidines as cyclin dependent kinase inhibitors |
EP1537116B1 (en) | 2002-09-04 | 2010-06-02 | Schering Corporation | Pyrazolopyrimidines suitable for the treatment of cancer diseases |
US20050250837A1 (en) | 2002-10-18 | 2005-11-10 | D Mello Santosh R | Use of C-Raf inhibitors for the treatment of neurodegenerative diseases |
DE50304983D1 (en) | 2002-10-28 | 2006-10-19 | Bayer Healthcare Ag | HETEROARYLOXY-SUBSTITUTED PHENYLAMINOPYRIMIDINES AS RHO-KINASEINHIBITORS |
UA81790C2 (en) | 2002-12-19 | 2008-02-11 | Фармация Италия С.П.А. | Substituted derivatives of pyrolopyrazol as kinaze inhibitors |
FR2850022B1 (en) | 2003-01-22 | 2006-09-08 | Centre Nat Rech Scient | NOVEL USE OF MIFEPRISTONE AND ITS DERIVATIVES AS MODULATORS OF THE HEDGEHOG PROTEIN SIGNALING PATH AND ITS APPLICATIONS |
US7169771B2 (en) | 2003-02-06 | 2007-01-30 | Bristol-Myers Squibb Company | Thiazolyl-based compounds useful as kinase inhibitors |
BRPI0407618A (en) | 2003-02-21 | 2006-02-21 | Pfizer | cycloalkyl-substituted amino thiazole derivatives containing n and pharmaceutical compositions for inhibiting cell proliferation and methods for their use |
KR20050115252A (en) | 2003-02-28 | 2005-12-07 | 데이진 화-마 가부시키가이샤 | Pyrazolo[1,5-a]pyrimidine derivatives |
GB0304665D0 (en) | 2003-02-28 | 2003-04-02 | Teijin Ltd | Compounds |
GB0305142D0 (en) | 2003-03-06 | 2003-04-09 | Eisai London Res Lab Ltd | Synthesis |
GB0305559D0 (en) | 2003-03-11 | 2003-04-16 | Teijin Ltd | Compounds |
JP2006522125A (en) | 2003-03-25 | 2006-09-28 | バーテックス ファーマシューティカルズ インコーポレイテッド | Thiazoles useful as protein kinase inhibitors |
EP1608652A1 (en) | 2003-03-31 | 2005-12-28 | Vernalis (Cambridge) Limited | Pyrazolopyrimidine compounds and their use in medicine |
US20050008640A1 (en) | 2003-04-23 | 2005-01-13 | Wendy Waegell | Method of treating transplant rejection |
SI1638941T1 (en) | 2003-05-22 | 2010-11-30 | Abbott Lab | Indazole, benzisoxazole, and benzisothiazole kinase inhibitors |
SE0301906D0 (en) | 2003-06-26 | 2003-06-26 | Astrazeneca Ab | New compounds |
PL1651612T3 (en) | 2003-07-22 | 2012-09-28 | Astex Therapeutics Ltd | 3,4-disubstituted 1h-pyrazole compounds and their use as cyclin dependent kinases (cdk) and glycogen synthase kinase-3 (gsk-3) modulators |
US7442698B2 (en) | 2003-07-24 | 2008-10-28 | Amgen Inc. | Substituted heterocyclic compounds and methods of use |
CN1860118A (en) | 2003-07-29 | 2006-11-08 | Irm责任有限公司 | Compounds and compositions as protein kinase inhibitors |
MXPA06001759A (en) | 2003-08-15 | 2006-05-12 | Novartis Ag | 2, 4-pyrimidinediamines useful in the treatment of neoplastic diseases, inflammatory and immune system disorders. |
WO2005037845A1 (en) | 2003-10-17 | 2005-04-28 | Rigel Pharmaceuticals, Inc. | Benzothiazole and thiazole[5,5-b] pyridine compositions and their use as ubiquitin ligase inhibitors |
WO2005037797A1 (en) | 2003-10-21 | 2005-04-28 | Pharmacia Corporation | Substituted pyrazole urea compounds for the treatment of inflammation |
DE10357510A1 (en) | 2003-12-09 | 2005-07-07 | Bayer Healthcare Ag | Heteroaryl-substituted benzenes |
US20070281907A1 (en) | 2003-12-22 | 2007-12-06 | Watkins William J | Kinase Inhibitor Phosphonate Conjugates |
WO2005095418A1 (en) | 2004-04-02 | 2005-10-13 | Novartis Ag | Sulfonamide-thiazolpyridine derivatives as glucokinase activators useful the treatment of type 2 diabetes |
DE102004017438A1 (en) | 2004-04-08 | 2005-11-03 | Bayer Healthcare Ag | Hetaryloxy-substituted phenylaminopyrimidines |
DE102004020570A1 (en) | 2004-04-27 | 2005-11-24 | Bayer Healthcare Ag | Substituted phenylaminopyrimidines |
GB0411791D0 (en) | 2004-05-26 | 2004-06-30 | Cyclacel Ltd | Compounds |
FR2871158A1 (en) | 2004-06-04 | 2005-12-09 | Aventis Pharma Sa | SUBSTITUTED INDAZOLES, COMPOSITIONS CONTAINING SAME, METHOD OF MANUFACTURE AND USE |
CN1960988B (en) | 2004-06-10 | 2012-01-25 | Irm责任有限公司 | Compounds and compositions as protein kinase inhibitors |
DE102004028862A1 (en) | 2004-06-15 | 2005-12-29 | Merck Patent Gmbh | 3-aminoindazoles |
EP1789399A1 (en) | 2004-08-31 | 2007-05-30 | AstraZeneca AB | Quinazolinone derivatives and their use as b-raf inhibitors |
WO2006031806A2 (en) | 2004-09-10 | 2006-03-23 | Atherogenics, Inc. | 2-thiopyrimidinones as therapeutic agents |
CN101083992A (en) | 2004-09-20 | 2007-12-05 | 泽农医药公司 | Pyridazine derivatives for inhibiting human stearoyl-coa-desaturase |
US20080207616A1 (en) | 2004-10-15 | 2008-08-28 | Astrazeneca Ab | Quinoxalines as B Baf Inhhibitors |
US7632854B2 (en) | 2004-11-17 | 2009-12-15 | Pfizer Italia S.R.L. | Aminoindazole derivatives active as kinase inhibitors, process for their preparation and pharmaceutical compositions comprising them |
WO2006074057A2 (en) | 2004-12-30 | 2006-07-13 | Exelixis, Inc. | Pyrimidine derivatives as kinase modulators and method of use |
BRPI0607307A2 (en) | 2005-01-26 | 2009-08-25 | Irm Llc | compounds and compositions as protein kinase inhibitors |
TW200639163A (en) | 2005-02-04 | 2006-11-16 | Genentech Inc | RAF inhibitor compounds and methods |
JPWO2006085685A1 (en) | 2005-02-09 | 2008-06-26 | 武田薬品工業株式会社 | Pyrazole compounds |
WO2006124731A2 (en) | 2005-05-12 | 2006-11-23 | Irm Llc | Compounds and compositions as protein kinase inhibitors |
US20080300267A1 (en) | 2005-05-16 | 2008-12-04 | Barun Okram | Compounds and Compositions as Protein Kinase Inhibitors |
PE20070100A1 (en) | 2005-06-22 | 2007-03-10 | Plexxikon Inc | PIRROLO [2,3-b] PYRIDINE DERIVATIVES AS KINE MODULATORS |
CA2619365A1 (en) | 2005-08-22 | 2007-03-01 | Amgen Inc. | Pyrazolopyridine and pyrazolopyrimidine compounds useful as kinase enzymes modulators |
US7880004B2 (en) | 2005-09-15 | 2011-02-01 | Bristol-Myers Squibb Company | Met kinase inhibitors |
GT200600429A (en) | 2005-09-30 | 2007-04-30 | ORGANIC COMPOUNDS | |
EP1935890B1 (en) | 2005-09-30 | 2016-03-16 | Msd K.K. | 2-heteroaryl-substituted indole derivative |
GB0520955D0 (en) | 2005-10-14 | 2005-11-23 | Cyclacel Ltd | Compound |
US8247556B2 (en) | 2005-10-21 | 2012-08-21 | Amgen Inc. | Method for preparing 6-substituted-7-aza-indoles |
GEP20104974B (en) * | 2005-12-21 | 2010-04-26 | Pfizer Prod Inc | Carbonylamino pyrrolopyrazoles, protent kinase inhibitors |
MX2008008152A (en) | 2005-12-23 | 2008-09-12 | Ariad Pharma Inc | Bicyclic heteroaryl compounds. |
WO2007129195A2 (en) | 2006-05-04 | 2007-11-15 | Pfizer Products Inc. | 4-pyrimidine-5-amino-pyrazole compounds |
RU2008150419A (en) | 2006-05-22 | 2010-09-20 | Шеринг Корпорейшн (US) | Pyrazole [1,5-a] Pyrimidines as CDK Inhibitors |
EP2029578A1 (en) | 2006-05-26 | 2009-03-04 | AstraZeneca AB | 2-carbocycloamino-4-imidaz0lylpyrimidines as agents for the inhbition of cell proliferation |
SI2530083T1 (en) | 2006-09-22 | 2016-09-30 | Pharmacyclics Llc | Inhibitors of bruton's tyrosine kinase |
ES2367416T3 (en) * | 2006-10-11 | 2011-11-03 | Nerviano Medical Sciences S.R.L. | PIRROLO-PIRAZOL DERIVATIVES REPLACED AS QUINASE INHIBITORS. |
US20080188524A1 (en) | 2006-10-25 | 2008-08-07 | Martin Augustin | Methods of treating pain |
ES2403546T3 (en) | 2006-11-03 | 2013-05-20 | Pharmacyclics, Inc. | Bruton tyrosine kinase activity probe and method of use |
WO2008063888A2 (en) | 2006-11-22 | 2008-05-29 | Plexxikon, Inc. | Compounds modulating c-fms and/or c-kit activity and uses therefor |
CA2670375A1 (en) | 2006-12-08 | 2008-06-12 | F. Hoffmann-La Roche Ag | Substituted pyrimidines and their use as jnk modulators |
AU2007336335B8 (en) | 2006-12-20 | 2014-07-24 | Nerviano Medical Sciences S.R.L. | Indazole derivatives as kinase inhibitors for the treatment of cancer |
JP2010514695A (en) | 2006-12-21 | 2010-05-06 | プレキシコン,インコーポレーテッド | Compounds and methods for kinase regulation and indications therefor |
BRPI0807346B8 (en) * | 2007-02-07 | 2021-05-25 | Pfizer | 3-amino-pyrrolo[3,4-c]pyrazol-5(1h,4h,6h)carbaldehyde derivatives as pkc inhibitors, their use and pharmaceutical composition comprising them |
GEP20135925B (en) | 2007-03-14 | 2013-10-10 | Exelixis Patent Co Llc | Inhibitors of hedgehog pathway |
WO2008124393A1 (en) | 2007-04-04 | 2008-10-16 | Irm Llc | Benzothiazole derivatives and their use as protein kinase inhibitors |
AU2008237660B2 (en) * | 2007-04-12 | 2011-12-22 | Pfizer Inc. | 3-amido-pyrrolo [3, 4-C] pyrazole-5 (1H, 4H, 6H) carbaldehyde derivatives as inhibitors of protein kinase C |
WO2008144253A1 (en) | 2007-05-14 | 2008-11-27 | Irm Llc | Protein kinase inhibitors and methods for using thereof |
CA2689989A1 (en) | 2007-06-04 | 2008-12-11 | Avila Therapeutics, Inc. | Heterocyclic compounds and uses thereof |
CA2688616A1 (en) | 2007-06-05 | 2008-12-11 | Emory University | Selective inhibitors for cyclin-dependent kinases |
EP2183232B1 (en) | 2007-08-02 | 2013-03-06 | Amgen, Inc | Pi3 kinase modulators and methods of use |
US20090054392A1 (en) | 2007-08-20 | 2009-02-26 | Wyeth | Naphthylpyrimidine, naphthylpyrazine and naphthylpyridazine analogs and their use as agonists of the wnt-beta-catenin cellular messaging system |
WO2009032694A1 (en) | 2007-08-28 | 2009-03-12 | Dana Farber Cancer Institute | Amino substituted pyrimidine, pyrollopyridine and pyrazolopyrimidine derivatives useful as kinase inhibitors and in treating proliferative disorders and diseases associated with angiogenesis |
WO2009028655A1 (en) | 2007-08-30 | 2009-03-05 | Takeda Pharmaceutical Company Limited | Heterocyclic compound and use thereof |
WO2009122180A1 (en) | 2008-04-02 | 2009-10-08 | Medical Research Council | Pyrimidine derivatives capable of inhibiting one or more kinases |
GB0806419D0 (en) | 2008-04-09 | 2008-05-14 | Ineos Fluor Holdings Ltd | Process |
US20100197688A1 (en) | 2008-05-29 | 2010-08-05 | Nantermet Philippe G | Epha4 rtk inhibitors for treatment of neurological and neurodegenerative disorders and cancer |
TWI490214B (en) | 2008-05-30 | 2015-07-01 | 艾德克 上野股份有限公司 | Benzene or thiophene derivative and use thereof as vap-1 inhibitor |
AU2009260519A1 (en) | 2008-05-30 | 2009-12-23 | Merck Sharp & Dohme Corp. | Novel substituted azabenzoxazoles |
WO2009152027A1 (en) | 2008-06-12 | 2009-12-17 | Merck & Co., Inc. | 5,7-dihydro-6h-pyrrolo[2,3-d]pyrimidin-6-one derivatives for mark inhibition |
US20110212053A1 (en) | 2008-06-19 | 2011-09-01 | Dapeng Qian | Phosphatidylinositol 3 kinase inhibitors |
JP2011525535A (en) | 2008-06-24 | 2011-09-22 | 武田薬品工業株式会社 | PI3K / mTOR inhibitor |
US8455477B2 (en) | 2008-08-05 | 2013-06-04 | Merck Sharp & Dohme Corp. | Therapeutic compounds |
EP2350053B1 (en) | 2008-10-17 | 2013-12-11 | Whitehead Institute For Biomedical Research | Modulators of MTOR Complexes |
CN101723936B (en) | 2008-10-27 | 2014-01-15 | 上海睿星基因技术有限公司 | Kinase suppressor and pharmaceutical application thereof |
MX2011008444A (en) | 2009-02-12 | 2011-09-06 | Astellas Pharma Inc | Hetero ring derivative. |
US20120071475A1 (en) | 2009-04-27 | 2012-03-22 | Shionogi & Co., Ltd. | Urea derivatives having pi3k-inhibiting activity |
US9908884B2 (en) | 2009-05-05 | 2018-03-06 | Dana-Farber Cancer Institute, Inc. | EGFR inhibitors and methods of treating disorders |
US20110039873A1 (en) | 2009-06-08 | 2011-02-17 | Gaeta Federico C A | SUBSTITUTED PYRAZOLO[1,5-a] PYRIDINE COMPOUNDS HAVING MULTI-TARGET ACTIVITY |
JP6073677B2 (en) | 2009-06-12 | 2017-02-01 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | Fused heterocyclic compounds and their use |
FR2948367A1 (en) | 2009-07-24 | 2011-01-28 | Centre Nat Rech Scient | ACYL-GUANIDINE DERIVATIVES MODULATORS OF THE HEDGEHOG PROTEIN SIGNALING PATHWAY |
AU2010306803A1 (en) | 2009-10-14 | 2012-05-03 | Bristol-Myers Squibb Company | Compounds for the treatment of hepatitis C |
US20110207736A1 (en) | 2009-12-23 | 2011-08-25 | Gatekeeper Pharmaceuticals, Inc. | Compounds that modulate egfr activity and methods for treating or preventing conditions therewith |
EP2937345B1 (en) | 2009-12-29 | 2018-03-21 | Dana-Farber Cancer Institute, Inc. | Type ii raf kinase inhibitors |
WO2011115725A2 (en) | 2010-03-16 | 2011-09-22 | Dana-Farber Cancer Institute, Inc. | Indazole compounds and their uses |
ES2534521T3 (en) | 2010-05-14 | 2015-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and their use in the treatment of neoplasia, inflammatory diseases and other diseases |
JP2013542966A (en) | 2010-11-19 | 2013-11-28 | エフ.ホフマン−ラ ロシュ アーゲー | Pyrazolopyridines and their use as TYK2 inhibitors and their use |
US8546443B2 (en) | 2010-12-21 | 2013-10-01 | Boehringer Ingelheim International Gmbh | Benzylic oxindole pyrimidines |
KR20140047092A (en) | 2011-07-28 | 2014-04-21 | 셀좀 리미티드 | Heterocyclyl pyrimidine analogues as jak inhibitors |
US20150017156A1 (en) | 2011-09-16 | 2015-01-15 | The Ohio State University | Esx-mediated transcription modulators and related methods |
WO2013074986A1 (en) | 2011-11-17 | 2013-05-23 | Dana-Farber Cancer Institute, Inc. | Inhibitors of c-jun-n-terminal kinase (jnk) |
GB201204384D0 (en) | 2012-03-13 | 2012-04-25 | Univ Dundee | Anti-flammatory agents |
WO2013154778A1 (en) | 2012-04-11 | 2013-10-17 | Dana-Farber Cancer Institute, Inc. | Host targeted inhibitors of dengue virus and other viruses |
WO2014063068A1 (en) | 2012-10-18 | 2014-04-24 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
US10000483B2 (en) | 2012-10-19 | 2018-06-19 | Dana-Farber Cancer Institute, Inc. | Bone marrow on X chromosome kinase (BMX) inhibitors and uses thereof |
CN103319483B (en) | 2012-10-19 | 2016-08-03 | 药源药物化学(上海)有限公司 | A kind of preparation method of important intermediate of linagliptin |
US9758522B2 (en) | 2012-10-19 | 2017-09-12 | Dana-Farber Cancer Institute, Inc. | Hydrophobically tagged small molecules as inducers of protein degradation |
TWI621618B (en) | 2013-03-13 | 2018-04-21 | 比利時商健生藥品公司 | Substituted 2-azabicycles and their use as orexin receptor modulators |
US9938279B2 (en) | 2013-04-09 | 2018-04-10 | Energenesis Biomedical Co., Ltd | Method for treating disease or condition susceptible to amelioration by AMPK activators and compounds of formula which are useful to activate AMP-activated protein kinase (AMPK) |
KR20160034379A (en) | 2013-07-25 | 2016-03-29 | 다나-파버 캔서 인스티튜트 인크. | Inhibitors of transcription factors and uses thereof |
CA2927917C (en) | 2013-10-18 | 2022-08-09 | Syros Pharmaceuticals, Inc. | Heteroaromatic compounds useful for the treatment of proliferative diseases |
AU2014337044A1 (en) | 2013-10-18 | 2016-05-05 | Dana-Farber Cancer Institute, Inc. | Polycyclic inhibitors of cyclin-dependent kinase 7 (CDK7) |
US10793571B2 (en) | 2014-01-31 | 2020-10-06 | Dana-Farber Cancer Institute, Inc. | Uses of diazepane derivatives |
RU2673944C2 (en) | 2014-01-31 | 2018-12-03 | Дана-Фарбер Кансер Институт, Инк. | Dihydropteridinone derivatives and uses thereof |
CA2936865A1 (en) | 2014-01-31 | 2015-08-06 | Dana-Farber Cancer Institute, Inc. | Diaminopyrimidine benzenesulfone derivatives and uses thereof |
BR112016017045A2 (en) | 2014-01-31 | 2017-08-08 | Dana Farber Cancer Inst Inc | DIAZEPANE DERIVATIVES AND USES THEREOF |
SG10201809260XA (en) | 2014-04-04 | 2018-11-29 | Syros Pharmaceuticals Inc | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
AU2015240518A1 (en) | 2014-04-05 | 2016-10-20 | Syros Pharmaceuticals, Inc. | Inhibitors of cyclin-dependent kinase 7 (CDK7) |
US9862688B2 (en) | 2014-04-23 | 2018-01-09 | Dana-Farber Cancer Institute, Inc. | Hydrophobically tagged janus kinase inhibitors and uses thereof |
WO2015164614A1 (en) | 2014-04-23 | 2015-10-29 | Dana-Farber Cancer Institute, Inc. | Janus kinase inhibitors and uses thereof |
CN104829610B (en) | 2014-06-20 | 2017-03-15 | 中国科学院合肥物质科学研究院 | A kind of novel cloth Shandong tyrosine kinase inhibitor |
US10287268B2 (en) | 2014-07-21 | 2019-05-14 | Dana-Farber Cancer Institute, Inc. | Imidazolyl kinase inhibitors and uses thereof |
AU2015292827B2 (en) | 2014-07-21 | 2019-11-14 | Dana-Farber Cancer Institute, Inc. | Macrocyclic kinase inhibitors and uses thereof |
US10308648B2 (en) | 2014-10-16 | 2019-06-04 | Syros Pharmaceuticals, Inc. | Inhibitors of cyclin-dependent kinase 7 (CDK7) |
WO2016105528A2 (en) | 2014-12-23 | 2016-06-30 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinase 7 (cdk7) |
WO2016142855A2 (en) | 2015-03-09 | 2016-09-15 | Aurigene Discovery Technologies Limited | Pyrazolo[1,5-a][1,3,5]triazine and pyrazolo[1,5-a]pyrimidine derivatives as cdk inhibitors |
AU2016243529B2 (en) | 2015-03-27 | 2021-03-25 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinases |
US10702527B2 (en) | 2015-06-12 | 2020-07-07 | Dana-Farber Cancer Institute, Inc. | Combination therapy of transcription inhibitors and kinase inhibitors |
EP3340990B1 (en) | 2015-08-28 | 2019-09-25 | Novartis AG | Pharmaceutical combinations comprising (a) the cyclin dependent kinase 4/6 (cdk4/6) inhibitor lee011 (=ribociclib), and (b) the epidermal growth factor receptor (egfr) inhibitor erlotinib, for the treatment or prevention of cancer |
AU2016319125B2 (en) | 2015-09-09 | 2021-04-08 | Dana-Farber Cancer Institute, Inc. | Inhibitors of cyclin-dependent kinases |
-
2015
- 2015-12-23 WO PCT/US2015/000297 patent/WO2016105528A2/en active Application Filing
- 2015-12-23 CA CA2972239A patent/CA2972239A1/en active Pending
- 2015-12-23 JP JP2017534308A patent/JP6854762B2/en active Active
- 2015-12-23 US US15/538,763 patent/US10870651B2/en active Active
- 2015-12-23 AU AU2015371251A patent/AU2015371251B2/en active Active
- 2015-12-23 EP EP15873803.9A patent/EP3236959A4/en active Pending
-
2018
- 2018-04-09 HK HK18104628.2A patent/HK1245260A1/en unknown
-
2020
- 2020-09-28 US US17/034,822 patent/US20220024929A9/en active Pending
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11826365B2 (en) | 2009-12-29 | 2023-11-28 | Dana-Farber Cancer Institute, Inc. | Type II raf kinase inhibitors |
Also Published As
Publication number | Publication date |
---|---|
JP2018502098A (en) | 2018-01-25 |
EP3236959A4 (en) | 2018-04-25 |
US10870651B2 (en) | 2020-12-22 |
WO2016105528A2 (en) | 2016-06-30 |
JP6854762B2 (en) | 2021-04-07 |
HK1245260A1 (en) | 2018-08-24 |
CA2972239A1 (en) | 2016-06-30 |
US20190055248A1 (en) | 2019-02-21 |
AU2015371251B2 (en) | 2020-06-11 |
EP3236959A2 (en) | 2017-11-01 |
WO2016105528A3 (en) | 2016-08-18 |
US20210115051A1 (en) | 2021-04-22 |
AU2015371251A1 (en) | 2017-07-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220024929A9 (en) | Inhibitors of cyclin-dependent kinase 7 (cdk7) | |
US11325910B2 (en) | Inhibitors of cyclin-dependent kinases | |
US20220055998A1 (en) | Inhibitors of cyclin-dependent kinases | |
US20210315894A9 (en) | 4,6-pyrimidinylene derivatives and uses thereof | |
US10342798B2 (en) | Fused bicyclic pyrimidine derivatives and uses thereof | |
US20220089611A1 (en) | Inhibitors of cyclin-dependent kinase 7 and uses thereof | |
US20230242534A9 (en) | Inhibitors of cyclin-dependent kinase 7 and uses thereof | |
US20240101559A1 (en) | Tricyclic kinase inhibitors and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: DANA-FARBER CANCER INSTITUTE, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GRAY, NATHANAEL S.;LIANG, YANKE;ZHANG, TINGHU;AND OTHERS;SIGNING DATES FROM 20160225 TO 20160229;REEL/FRAME:053947/0159 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |