US20220002391A1 - Broadly Neutralizing Anti-HIV Antibodies and Epitope Therefor - Google Patents
Broadly Neutralizing Anti-HIV Antibodies and Epitope Therefor Download PDFInfo
- Publication number
- US20220002391A1 US20220002391A1 US17/471,573 US202117471573A US2022002391A1 US 20220002391 A1 US20220002391 A1 US 20220002391A1 US 202117471573 A US202117471573 A US 202117471573A US 2022002391 A1 US2022002391 A1 US 2022002391A1
- Authority
- US
- United States
- Prior art keywords
- 8anc195
- hiv
- antibody
- antibodies
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000003472 neutralizing effect Effects 0.000 title claims abstract description 20
- 230000036436 anti-hiv Effects 0.000 title description 6
- 239000000427 antigen Substances 0.000 claims abstract description 74
- 108091007433 antigens Proteins 0.000 claims abstract description 73
- 102000036639 antigens Human genes 0.000 claims abstract description 73
- 238000000034 method Methods 0.000 claims abstract description 67
- 239000000203 mixture Substances 0.000 claims abstract description 35
- 241000725303 Human immunodeficiency virus Species 0.000 claims description 67
- 230000027455 binding Effects 0.000 claims description 60
- 241000713772 Human immunodeficiency virus 1 Species 0.000 claims description 35
- 101800001690 Transmembrane protein gp41 Proteins 0.000 claims description 34
- 150000007523 nucleic acids Chemical class 0.000 claims description 29
- 239000013598 vector Substances 0.000 claims description 27
- 102000039446 nucleic acids Human genes 0.000 claims description 23
- 108020004707 nucleic acids Proteins 0.000 claims description 23
- 150000001413 amino acids Chemical class 0.000 claims description 22
- 208000031886 HIV Infections Diseases 0.000 claims description 12
- 238000003556 assay Methods 0.000 claims description 12
- 239000012472 biological sample Substances 0.000 claims description 9
- 230000028993 immune response Effects 0.000 claims description 9
- 239000000523 sample Substances 0.000 claims description 7
- 210000004748 cultured cell Anatomy 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 60
- 102000004196 processed proteins & peptides Human genes 0.000 description 58
- 229920001184 polypeptide Polymers 0.000 description 53
- 108090000623 proteins and genes Proteins 0.000 description 46
- 210000004027 cell Anatomy 0.000 description 44
- 238000006386 neutralization reaction Methods 0.000 description 39
- 150000004676 glycans Chemical class 0.000 description 38
- 102000004169 proteins and genes Human genes 0.000 description 34
- 235000018102 proteins Nutrition 0.000 description 32
- 239000012634 fragment Substances 0.000 description 26
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 24
- 239000013078 crystal Substances 0.000 description 23
- 238000001493 electron microscopy Methods 0.000 description 23
- 108091033319 polynucleotide Proteins 0.000 description 22
- 239000002157 polynucleotide Substances 0.000 description 22
- 102000040430 polynucleotide Human genes 0.000 description 22
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 21
- 235000001014 amino acid Nutrition 0.000 description 20
- 241000700605 Viruses Species 0.000 description 19
- 229940024606 amino acid Drugs 0.000 description 19
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 19
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 18
- 239000013638 trimer Substances 0.000 description 18
- 238000011282 treatment Methods 0.000 description 17
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 16
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 16
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 16
- 239000008194 pharmaceutical composition Substances 0.000 description 15
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 14
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 14
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 14
- 210000004602 germ cell Anatomy 0.000 description 14
- 230000036515 potency Effects 0.000 description 14
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 12
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 12
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 12
- 241000124008 Mammalia Species 0.000 description 12
- 230000000694 effects Effects 0.000 description 12
- 208000015181 infectious disease Diseases 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 11
- 201000010099 disease Diseases 0.000 description 11
- 238000005516 engineering process Methods 0.000 description 11
- 239000001257 hydrogen Substances 0.000 description 11
- 229910052739 hydrogen Inorganic materials 0.000 description 11
- 239000013615 primer Substances 0.000 description 11
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 10
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 10
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 10
- 125000003275 alpha amino acid group Chemical group 0.000 description 10
- 125000004429 atom Chemical group 0.000 description 10
- 230000014509 gene expression Effects 0.000 description 10
- 230000003993 interaction Effects 0.000 description 10
- 230000009467 reduction Effects 0.000 description 10
- 239000000872 buffer Substances 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- 239000013604 expression vector Substances 0.000 description 9
- -1 i.e. Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 208000037357 HIV infectious disease Diseases 0.000 description 8
- 108091028043 Nucleic acid sequence Proteins 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 8
- 238000002425 crystallisation Methods 0.000 description 8
- 230000008025 crystallization Effects 0.000 description 8
- 238000010586 diagram Methods 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 208000033519 human immunodeficiency virus infectious disease Diseases 0.000 description 8
- 238000003780 insertion Methods 0.000 description 8
- 230000037431 insertion Effects 0.000 description 8
- 238000004519 manufacturing process Methods 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 239000003937 drug carrier Substances 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 6
- 108060003951 Immunoglobulin Proteins 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- 230000004071 biological effect Effects 0.000 description 6
- 238000012217 deletion Methods 0.000 description 6
- 230000037430 deletion Effects 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 102000018358 immunoglobulin Human genes 0.000 description 6
- 239000002245 particle Substances 0.000 description 6
- 239000000546 pharmaceutical excipient Substances 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 230000000069 prophylactic effect Effects 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 5
- 239000012505 Superdex™ Substances 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 230000001900 immune effect Effects 0.000 description 5
- 230000001976 improved effect Effects 0.000 description 5
- 230000006872 improvement Effects 0.000 description 5
- 239000002773 nucleotide Substances 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 230000003389 potentiating effect Effects 0.000 description 5
- 238000001542 size-exclusion chromatography Methods 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- 230000029812 viral genome replication Effects 0.000 description 5
- 230000003612 virological effect Effects 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 239000002671 adjuvant Substances 0.000 description 4
- 125000003295 alanine group Chemical class N[C@@H](C)C(=O)* 0.000 description 4
- 230000003321 amplification Effects 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 238000011081 inoculation Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 210000001806 memory b lymphocyte Anatomy 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 238000003199 nucleic acid amplification method Methods 0.000 description 4
- 244000052769 pathogen Species 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 238000001162 G-test Methods 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 3
- 101150008942 J gene Proteins 0.000 description 3
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 3
- 101100285000 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) his-3 gene Proteins 0.000 description 3
- 241001112090 Pseudovirus Species 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 230000002349 favourable effect Effects 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 230000008676 import Effects 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000003094 microcapsule Substances 0.000 description 3
- 238000012856 packing Methods 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 210000003813 thumb Anatomy 0.000 description 3
- 230000009385 viral infection Effects 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- GANZODCWZFAEGN-UHFFFAOYSA-N 5-mercapto-2-nitro-benzoic acid Chemical compound OC(=O)C1=CC(S)=CC=C1[N+]([O-])=O GANZODCWZFAEGN-UHFFFAOYSA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 2
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 2
- 108010073807 IgG Receptors Proteins 0.000 description 2
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical group C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 230000004988 N-glycosylation Effects 0.000 description 2
- 101100068676 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) gln-1 gene Proteins 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- 206010036790 Productive cough Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 241000580858 Simian-Human immunodeficiency virus Species 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 238000002441 X-ray diffraction Methods 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000003443 antiviral agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 238000009933 burial Methods 0.000 description 2
- 238000004422 calculation algorithm Methods 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000010205 computational analysis Methods 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000002405 diagnostic procedure Methods 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 150000004662 dithiols Chemical class 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 238000003032 molecular docking Methods 0.000 description 2
- 239000012452 mother liquor Substances 0.000 description 2
- 238000002439 negative-stain electron microscopy Methods 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 210000004789 organ system Anatomy 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 230000001766 physiological effect Effects 0.000 description 2
- 108010054442 polyalanine Proteins 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 229920001451 polypropylene glycol Polymers 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 230000001681 protective effect Effects 0.000 description 2
- 239000012460 protein solution Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 210000003296 saliva Anatomy 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 230000000392 somatic effect Effects 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 210000003802 sputum Anatomy 0.000 description 2
- 208000024794 sputum Diseases 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- XIUROWKZWPIAIB-UHFFFAOYSA-N sulfotep Chemical compound CCOP(=S)(OCC)OP(=S)(OCC)OCC XIUROWKZWPIAIB-UHFFFAOYSA-N 0.000 description 2
- 230000008093 supporting effect Effects 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- JIAARYAFYJHUJI-UHFFFAOYSA-L zinc dichloride Chemical compound [Cl-].[Cl-].[Zn+2] JIAARYAFYJHUJI-UHFFFAOYSA-L 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- AQPVUEJJARLJHB-BQBZGAKWSA-N Arg-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCCN=C(N)N AQPVUEJJARLJHB-BQBZGAKWSA-N 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 101150097493 D gene Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 241000255925 Diptera Species 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 102100027723 Endogenous retrovirus group K member 6 Rec protein Human genes 0.000 description 1
- 101710121417 Envelope glycoprotein Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000013463 Immunoglobulin Light Chains Human genes 0.000 description 1
- 108010065825 Immunoglobulin Light Chains Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- UWKNTTJNVSYXPC-CIUDSAMLSA-N Lys-Ala-Ser Chemical group OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CCCCN UWKNTTJNVSYXPC-CIUDSAMLSA-N 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- OSKIPPQETUTOMW-YHLOVPAPSA-N N-[(2R,3R,4R,5S,6R)-5-[(2S,3R,4R,5S,6R)-3-Acetamido-5-[(2R,3S,4S,5R,6R)-4-[(2R,3S,4S,5S,6R)-3-[(2S,3S,4S,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-3-[(2R,3S,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2S,3S,4S,5R,6R)-6-[[(2S,3S,4S,5S,6R)-4,5-dihydroxy-6-(hydroxymethyl)-3-[(2R,3S,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxymethyl]-3,5-dihydroxy-4-[(2R,3S,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxymethyl]-3,5-dihydroxyoxan-2-yl]oxy-4-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-2,4-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide Chemical compound O[C@@H]1[C@@H](NC(=O)C)[C@H](O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O[C@@H]2[C@H]([C@@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O[C@@H]3[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO[C@@H]3[C@H]([C@@H](O[C@@H]4[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO[C@@H]4[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O4)O[C@@H]4[C@H]([C@@H](O)[C@H](O)[C@@H](CO)O4)O)O3)O)O2)O)[C@@H](CO)O1 OSKIPPQETUTOMW-YHLOVPAPSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical group CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 101710204410 Scaffold protein Proteins 0.000 description 1
- XZKQVQKUZMAADP-IMJSIDKUSA-N Ser-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(O)=O XZKQVQKUZMAADP-IMJSIDKUSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 101000895926 Streptomyces plicatus Endo-beta-N-acetylglucosaminidase H Proteins 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- XFTYVCHLARBHBQ-FOHZUACHSA-N Thr-Gly-Asn Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O XFTYVCHLARBHBQ-FOHZUACHSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 238000002819 bacterial display Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- LZCZIHQBSCVGRD-UHFFFAOYSA-N benzenecarboximidamide;hydron;chloride Chemical compound [Cl-].NC(=[NH2+])C1=CC=CC=C1 LZCZIHQBSCVGRD-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 238000005460 biophysical method Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 238000013216 cat model Methods 0.000 description 1
- 238000010366 cell biology technique Methods 0.000 description 1
- 238000010370 cell cloning Methods 0.000 description 1
- 230000002032 cellular defenses Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 239000005515 coenzyme Substances 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000008139 complexing agent Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000000205 computational method Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000012926 crystallographic analysis Methods 0.000 description 1
- 238000002447 crystallographic data Methods 0.000 description 1
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 239000002254 cytotoxic agent Substances 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 238000000635 electron micrograph Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- RDYMFSUJUZBWLH-UHFFFAOYSA-N endosulfan Chemical compound C12COS(=O)OCC2C2(Cl)C(Cl)=C(Cl)C1(Cl)C2(Cl)Cl RDYMFSUJUZBWLH-UHFFFAOYSA-N 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 239000002532 enzyme inhibitor Substances 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 238000012395 formulation development Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 210000005095 gastrointestinal system Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 238000011577 humanized mouse model Methods 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 210000001613 integumentary system Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 125000000311 mannosyl group Chemical group C1([C@@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 239000002687 nonaqueous vehicle Substances 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000003182 parenteral nutrition solution Substances 0.000 description 1
- 238000005192 partition Methods 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000000149 penetrating effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 238000002818 protein evolution Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108010043277 recombinant soluble CD4 Proteins 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000000611 regression analysis Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 238000002922 simulated annealing Methods 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- PTLRDCMBXHILCL-UHFFFAOYSA-M sodium arsenite Chemical compound [Na+].[O-][As]=O PTLRDCMBXHILCL-UHFFFAOYSA-M 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 230000005469 synchrotron radiation Effects 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 230000005727 virus proliferation Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 239000011592 zinc chloride Substances 0.000 description 1
- 235000005074 zinc chloride Nutrition 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1036—Retroviridae, e.g. leukemia viruses
- C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
- C07K16/1063—Lentiviridae, e.g. HIV, FIV, SIV env, e.g. gp41, gp110/120, gp160, V3, PND, CD4 binding site
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/21—Retroviridae, e.g. equine infectious anemia virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
- G01N33/56988—HIV or HTLV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/16011—Human Immunodeficiency Virus, HIV
- C12N2740/16111—Human Immunodeficiency Virus, HIV concerning HIV env
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/15—Retroviridae, e.g. bovine leukaemia virus, feline leukaemia virus, feline leukaemia virus, human T-cell leukaemia-lymphoma virus
- G01N2333/155—Lentiviridae, e.g. visna-maedi virus, equine infectious virus, FIV, SIV
- G01N2333/16—HIV-1, HIV-2
- G01N2333/162—HIV-1, HIV-2 env, e.g. gp160, gp110/120, gp41, V3, peptid T, DC4-Binding site
Definitions
- Env envelope
- bNAbs broadly neutralizing antibodies
- combinations of bNAbs can also suppress established HIV-1 and SHIV infections (Klein et al., Nature 492, 118 (2012); Barouch et al., Nature 503, 224 (2013); Shingai et al., Nature 503, 277 (2013)).
- bNAbs characterized to date target one of four major sites of vulnerability on HIV-1 Env: on gp120, the CD4 binding site, the V2 loop, and the base of the V3 loop, and on gp41, the membrane proximal region (Klein et al., Science 341, 1199 (2013); Burton et al., Science 337, 183 (2012); Mascola et al., Immunological Reviews 254, 225 (2013)). 8ANC195 is among a small group of bNAbs that does not appear to target any of these sites.
- 8ANC195 is classified as a bNAb because it neutralized 66% of viruses in a diverse viral panel (Scheid et al., Science 333, 1633 (2011)). Like other anti-HIV-1 bNAbs, 8ANC195 is highly somatically mutated, including insertions and deletions in the complementarity determining regions (CDRs) and framework regions (FWRs) of its heavy chain (HC) and light chain (LC). Although initial efforts to map the 8ANC195 epitope were unsuccessful (Ibid.) computational analyses of neutralization data predicted that intact potential N-linked glycosylation sites (PNGSs) at positions 234 gp120 and 276 gp120 were essential for its activity.
- CDRs complementarity determining regions
- FWRs framework regions
- This invention relates, in part, to the isolation of broadly-neutralizing antibodies (bNAbs) directed at an epitope on the HIV-1 envelope spike that spans the gp120 and gp41 subunits.
- bNAbs broadly-neutralizing antibodies
- the antibody comprises a heavy chain having one of the following amino acid sequences:
- the antibody comprises a light chain having one of the following amino acid sequences:
- one aspect of this invention features an isolated polypeptide comprising the sequence of any one of SEQ ID NOs: 1-33.
- the invention also provides an isolated anti-HIV antibody comprising one or both of a heavy chain comprising the sequence of any one of SEQ ID NOs: 1-18 and a light chain comprising the sequence any one of SEQ ID NOs: 19-33.
- the above-mentioned antibody can be a human antibody, a chimeric antibody, or a humanized antibody. It can be an IgG1, IgG2, IgG3, or IgG4.
- the antibodies of the invention recognize the epitope on the HIV-1 envelope spike recognized by 8ANC195 and are broadly neutralizing.
- the invention provides an isolated nucleic acid encoding the isolated polypeptide or anti-HIV-1 antibody described above. Also provided are a vector comprising the nucleic acid and a cultured cell comprising the nucleic acid.
- the invention provides a composition comprising at least one of the above-described isolated polypeptide or anti-HIV-1 antibody or a fragment thereof.
- the composition comprises a pharmaceutically acceptable carrier.
- the invention provides a method of preventing or treating an HIV-1 infection or an HIV-related disease.
- the method includes steps of identifying a patient in need of such prevention or treatment, and administering to the patient a first therapeutic agent comprising a therapeutically effective amount of at least one of the above-described isolated polypeptide or anti-HIV-1 antibody.
- the method can further comprise administering a second therapeutic agent, such as an antiviral agent.
- the present invention provides an isolated antigen comprising an epitope-scaffold that mimics the HIV-1 envelope spike epitope of broadly neutralizing antibody 8ANC195.
- the epitope-scaffold comprises a discontinous epitope and a scaffold.
- the epitope is derived from HIV-1 gp120 and gp41, and at least part of the scaffold is not derived from gp120 or gp41.
- the discontinuous epitope comprises amino acids corresponding to amino acid numbers 44-47, 90-94, 97, 234, 236-238, 240, 274-278, 352-354, 357, 456, 463, 466, 487, and 625-641 of gp140 from HIV strain 93TH057 numbered using standard numbering for HIV strain HXBC2.
- the amino acids corresponding to amino acid numbers 234 and 276 may be glycosylated.
- the invention provides an isolated nucleic acid encoding the isolated antigen described above. Also provided are a vector comprising the nucleic acid and a cultured cell comprising the nucleic acid.
- the invention provides a composition comprising the isolated antigen.
- the composition further comprises a pharmaceutically acceptable carrier.
- the composition further comprises an adjuvant.
- the present invention provides a method for generating an immune response in a subject in need thereof, comprising administering to said subject a composition comprising the above-described isolated antigen in an amount effective to generate an immune response.
- the invention provides a method of preventing or treating an HIV-1 infection or an HIV-related disease.
- the method includes steps of identifying a patient in need of such prevention or treatment, and administering to the patient a first therapeutic agent comprising a therapeutically effective amount of the above-described antigen.
- the method can further comprise administering a second therapeutic agent, such as an antiviral agent.
- the present invention provides a method for detecting or isolating an HIV-1 binding antibody in a subject comprising obtaining a biological sample from the subject, contacting the sample with the above-described antigen, and conducting an assay to detect or isolate an HIV-1 binding antibody.
- FIGS. 1A and 1B illustrates alignments of (A) VH and (B) VL sequences of mature 8ANC195 and its putative germ-line progenitor (GL).
- 8ANC195 HC has the sequence of SEQ ID NO:34.
- 8ANC195 LC has the sequence of SEQ ID NO:35.
- GL HC has the sequence of SEQ ID NO:36.
- GL LC has the sequence of SEQ ID NO:37.
- Residues forming the CDR loops are labeled (CDR1), (CDR2) and (CDR3).
- 8ANC195 is one of the most heavily mutated bNAbs isolated to date, with 49 of 103 amino acid mutations in the HC and 25 of 90 in the LC.
- the HC was too highly somatically mutated to accurately assign D and J gene segments, but the LC showed sufficient homology to assign its J segment as IGKJ5*01.
- FIGS. 2A, 2B and 2C illustrates conformations of 8ANC195 CDRH1 and CDRH3 loops.
- A The hook-like conformation of CDRH1 is stabilized by burial of the hydrophobic Phe30HC side chain and hydrogen bonds within CDRH1 and with CDRH3 and FWR1 and FWR3 residues (Ala24HC and Asp73HC, respectively).
- B The complexed CDRH3 conformation consists of a protruding loop (residues 95HC-100HC) and a small (3-sheet subdomain (residues 100dHC-100kHC) stabilized by multiple hydrogen bonds within CDRH3 as well as with CDRH1 and CDRL3.
- CDRH1 and CDRH3 loop backbone atoms are shown as sticks and side chains of residues important for stabilizing the loop conformations are shown as sticks (involved in direct contacts) or lines (backbone involved in contacts) (other side chains Tyr98HC, Lys100HC and Trp100aHC, are shown for clarity).
- C Comparison of CDRH3 loops in 8ANC195 and other anti-HIV-1 bNAbs.
- CDRH3 residues corresponding to 8ANC195HC residues 90-105 of NIH45-46 (PDB 3U7Y), PG16 (PDB 4DQO), PGT121 (PDB 4FQC) and PGT128 (PDB 3TYG) are shown as Ca traces.
- FIGS. 3A, 3B, 3C, 3D and 3E illustrates CD4 interactions with 8ANC195.
- A Superimposition of sCD4 D1D2/gp120 structures (ribbon diagrams) from complexes with 8ANC195, 17b (PDB 1GCI) and 21c PDB 3LQA).
- B Competition ELISA of 8ANC195 IgG binding to 93TH057 gp120 in the presence of increasing concentrations of potential competitors (sCD4, diamonds; J3 VHH, triangles; 3BNC60 Fab, squares; NIH45-46 Fab, circles).
- C In vitro assay comparing neutralization of YU2 by sCD4 (squares), 8ANC195 IgG (triangles), and an equimolar mixture of 8ANC195 and sCD4 (circles).
- D Packing of 8ANC195/sCD4/gp120 crystals. Several symmetry mates are shown as surface representations (8ANC195 HC; 8ANC195 LC; 93TH057 gp120; sCD4 D1D2). Areas where two complexes form crystal contacts are indicated.
- FIGS. 4A, 4B, 4C, 4D, 4E, 4F, 4G, 4H and 4I illustrates surface area buried at interface of 8ANC195 Fab and gp120.
- Left panels surface area buried on 8ANC195 Fab by (A) gp120 protein residues, (C) Asn276gp120 glycan or (E) Asn234gp120 glycan; right panels, surface area buried by 8ANC195 Fab on (B) gp120 protein residues, (D) Asn234gp120 glycan or (F) Asn276gp120 glycan.
- Atoms buried at these interfaces are shown as surface representations overlaid onto ribbon diagrams of 8ANC195 Fab and gp120 or stick representations of glycans.
- 8ANC195 Fab HC; LC; CDRH1; CDRH2; CDRH3; gp120: inner domain; outer domain; loop D; loop V5; Asn234gp120 glycan: Asn276gp120 glycan.
- FIGS. 5A and 5B illustrates a comparison of glycan-dependent bNAbs.
- 8ANC195 is “bracketed” by two glycans (Asn234 gp120 glycan; Asn276 gp120 glycan) in the 8ANC195 Fab/gp120/sCD4 complex structure (left panels).
- crystal structures of PG16 (middle panels, PDB 4DQO) bound to a V1/V2 loop scaffold and PGT128 (right panels, PDB 3TYG) bound to a V3 loop scaffold are shown with (A) the antibody HCs aligned to the 8ANC195 HC or (B) an alternative view showing their interactions with bracketing glycans (for PG16: Asn160 gp120 glycan/Asn172 glycan; for PGT128: Asn301 gp120 glycan/Asn332 gp120 glycan).
- the proteins are shown as ribbon diagrams and the glycans as stick representations.
- FIGS. 6A, 6B and 6C illustrates green EM refinement statistics.
- A Electron micrograph at 52,000 ⁇ magnification and ⁇ 0.8 ⁇ m defocus.
- B Reference-free 2D class averages of the SOSIP trimer in complex with 8ANC195 Fab showing various orientations.
- C Fourier Shell Correlation (FSC) graph resulting from refinement. The resolution was determined as 18.7 ⁇ at an FSC cut-off of 0.5.
- FIGS. 7A and 7B illustrates negative stain EM reconstruction of BG505 SOSIP.664 in complex with 8ANC195 Fab fit two ways.
- A When the gp120-8ANC195 Fab structure was fit into the EM density, the gp120 from the complex structure was displaced slightly outwards in comparison to the gp120 in the SOSIP trimer structure. The HC and LC of the Fab are shown. The Asn234 gp120 and Asn276 gp120 glycans are shown as spheres.
- B Close up of the Fab-Env interface.
- the position of Asn637 gp120 can be deduced from the position of the C-terminus of HR2, which corresponds to residue Gly664 gp41 . This residue is in close proximity to the LC and the glycan at this position could interact with the 8ANC195 Fab.
- FIGS. 8A, 8B, 8C and 8D illustrates EM reconstruction of 8ANC195 Fab/BG505 SOSIP.664 showing gp41 contacts.
- Areas of contact between 8ANC195 and gp41 are marked with circles, those between 8ANC195 and gp120 with black circles.
- C,D Close-up of 8ANC195 LC and HR2 region in EM complex structure (HR2 coordinates in PDB 4NCO with presumptive sidechains for strain YU2 added to the polyalanine coordinates).
- C Fab is shown as a surface representation with highlights (CDRL1; CDRL2; CDRH3, and gp41 HR2 is shown as a ribbon diagram. The position of Asn637gp41 was deduced from the position of the C-terminus of the SOSIP.664 trimer (Gly664gp41).
- D 8ANC195 HC and LC residues (sticks) positioned to contact HR2, with side chains of surface-exposed residues that vary between newly isolated 8ANC195 (T/K) variants shown as sticks.
- FIGS. 9A, 9B and 9C relate to Single Cell Variants of 8ANC195.
- A Strategy of large scale single cell sorting.
- B IgH and IgL chain genes from isolated single cell variants of 8ANC195. Identical members are grouped together.
- the HC CDR3 of 8ANC195 has the sequence of SEQ ID NO:38.
- the HC CDR3 of 8ANC142 has the sequence of SEQ ID NO:39.
- the HC CDR3 of 8ANC3430 has the sequence of SEQ ID NO:40.
- the HC CDR3 of 8ANC3484 has the sequence of SEQ ID NO:41.
- the HC CDR3 of 8ANC3044 has the sequence of SEQ ID NO:42.
- the HC CDR3 of 8ANC3630 has the sequence of SEQ ID NO:43.
- the LC CDR3 of 8ANC195 has the sequence of SEQ ID NO:44.
- the LC CDR3 of 8ANC142 has the sequence of SEQ ID NO:45.
- the LC CDR3 of 8ANC3430 has the sequence of SEQ ID NO:46.
- the LC CDR3 of 8ANC3484 has the sequence of SEQ ID NO:47.
- the LC CDR3 of 8ANC3044 has the sequence of SEQ ID NO:48.
- the LC CDR3 of 8ANC3630 has the sequence of SEQ ID NO:49.
- FIGS. 10A and 10B depict the alignment of amino acid sequences of all distinct single cell versions of the 8ANC195 clone.
- HC (A) and LC (B) sequences were aligned with the respective germline genes. Mutations introduced by somatic hypermutation are indicated.
- FIGS. 11A, 11B and 11C are directed to Bulk Sorted Variants of 8ANC195.
- A Strategy of bulk memory B cell sorting without antigen.
- B PCR strategy for the amplification of 8ANC195 HC and LC clone members. Shown are the priming sites aligned with the original nucleotide sequence of 8ANC195 at the respective sites. Mismatches with the respective germline genes are indicated.
- Primers 1 and 2 for the 8ANC195 HC FWR1 have SEQ ID Nos: 50 and 51, respectively.
- Primers 1 and 2 for the 8ANC195 LC FWR1 have SEQ ID Nos: 52 and 53, respectively.
- the primer for the 8ANC195 HC J-gene has SEQ ID NO:54.
- Primers 1 and 2 for the 8ANC195 LC J-gene have SEQ ID Nos: 55 and 56, respectively.
- C Phylogenetic tree of 128 isolated HC and 100 LC sequences. Representative members chosen for alignment are indicated.
- FIGS. 12A and 12B depict alignment of amino acid sequences of selected bulk sorted versions of the 8ANC195 clone.
- HC (A) and LC (B) sequences were aligned with the respective germline genes as well as the original 8ANC195 sequence. All mutations introduced by somatic hypermutation are indicated.
- FIGS. 13A and 13B show that 52 HC ⁇ 5 LC is more potent than 8ANC195.
- FIGS. 14A, 14B and 14C show that somatic mutations in the 8ANC195 LC CDRs and FWRs could affect contacts with gp41.
- A Surface representation of 8ANC195 Fab (HC; LC; somatically mutated, surface-exposed LC residues; residue 64 LC ).
- B Surface representation of 8ANC195 Fab and BG505 gp41 HR2 with a modeled Man6 sugar attached to Asn637gp41.
- C Surface representation of 8ANC195 Fab (CDRL1; CDRL2; CDRH3; residue 64 LC ) and BG505 gp41 HR2 with a modeled Man6 sugar attached to Asn637gp41.
- FIG. 15 illustrates locations of bNAb epitopes on HIV-1 Env Trimer.
- EM density map of Env trimer including MPER region showing approximate epitope locations for antibodies targeting the 8ANC195 epitope, CD4 binding site, V3 loop/Asn332 glycan (332 glycan shown as spheres), V1/V2 loop/Asn160 glycan (160 glycan shown as spheres), and MPER
- FIGS. 16A, 16B and 16C illustrate crystal structures of 8ANC195 Fab and 8ANC195/gp120/sCD4 complex.
- the epitopes of V3 and V1N2 antibodies include regions of loops (dotted lines) not present in the gp120 core structure.
- CD4 binding site and 8ANC195 epitopes are outlined by black (CD4 binding site) and (8ANC195) dots.
- Glycans included in the 8ANC195 epitope are indicated.
- Subdomains of gp120 are indicated as in (B).
- FIGS. 17A, 17B, 17C, 17D and 17E show contacts made by 8ANC195 HC with gp120 protein residues and glycans. Labels for gp120 protein and glycan residues are italicized. Hydrogen bonds are shown as dashed lines.
- C Buried surface area between the Asn234 gp120 glycan (transparent surface with glycan residues shown as sticks) and 8ANC195 (HC FWR residues and CDRH2 are indicated).
- Antibody atoms buried by glycan interactions are shown as surfaces.
- D Buried surface area between the Asn276 glycan gp120 (transparent surface with glycan residues shown as sticks) and 8ANC195 (HC FWR residues and CDRH1 are indicated). Antibody atoms buried by glycan interactions are shown as surfaces.
- E Top: Contacts made by 8ANC195 HC FWR residues and CDRH2 with Asn234 gp120 glycan. Glycan and protein residues involved in hydrogen bonds are shown as sticks.
- Bottom schematic of ordered high mannose glycans on Asn234 gp120 and Asn276 gp120 (bottom).
- FIGS. 18A and 18B show the EM structure of 8ANC195/Env trimer complex and model of 8ANC195 LC interactions with gp41 HR2.
- A EM reconstruction of 8ANC195 Fab/BG505 SOSIP.664. Side (left) and top (right) views of EM density with the X-ray structures of BG505 SOSIP.664 (PDB ID 4NCO; gp120, gp41) and 8ANC195 Fab fit in two ways: (i) fitting 8ANC195 Fab independently of gp140 coordinates to the EM density (best fit/independently placed), and (ii) by aligning the gp120 of the gp120/8ANC195 complex structure onto the gp120 of PDB 4NCO fit to the EM density.
- FIGS. 19A, 19B and 19C show effects of LC sequence changes on 8ANC195 neutralization potency.
- A Sequences of LC CDRs in constructs used with 8ANC195 HC to make chimeric IgGs (left) and location of CDRs on 8ANC195 structure (right). Sequences derived from the mature antibody are shown and those derived from the germline precursor are shown on a grey background. The mutations introduced into CDRL3 in glCDRL3Ala are shown on a white background.
- KD and IC 50 values for these experiments are shown in table S3.
- C Heat map showing the expression and neutralization of randomly paired HCs and LCs from the bulk sort on a Tier 2 15-virus panel. Average IC 50 values (arithmetic means) between 0.1 and 2 ⁇ g/ml; between 2.1 and 10 ⁇ g/ml, between 10.1 and 14.9 ⁇ g/ml, and above 15 ⁇ g/ml are indicated with varying degrees of shaded squares. Empty squares represent insufficient antibody expression.
- FIG. 20 depicts the alignment of gp140 sequences from HIV strains HXBC2 and 93TH057 using standard HXBC2 numbering of amino acid residues.
- Amino acid residues contacted by 8ANC195 in the complex crystal structure with 93TH057 gp120 core are indicated on the 93TH057 sequence.
- Glycans contacted by 8ANC195 in the complex crystal structure with 93TH057 gp120 core are shown as the asparagine residues to which they are attached, highlighted in cyan on the 93TH057 sequence.
- the region of gp41 contacted by 8ANC195 based on the EM complex structure is indicated.
- Select glycans are shown as diagrams on the asparagine residues to which they are attached.
- the present invention is based, at least in part, on the identification of the epitope recognized by 8ANC195, a broadly neutralizing antibody to the HIV-1 envelope glycoprotein.
- the present invention in one embodiment, provides an isolated antigen comprising the epitope, compositions comprising the antigen, and methods of using the antigen.
- the present invention provides isolated ant-HIV-1 antibodies that recognize the epitope on the HIV-1 envelope spike recognized by 8ANC195, compositions comprising the antibodies, and methods of using the antibodies.
- the present invention is directed to an isolated anti-HIV antibody comprising one or both of a heavy chain comprising the sequence of any one of SEQ ID NOs: 1-18 and a light chain comprising the sequence any one of of SEQ ID NOs: 19-33.
- the heavy chain comprises the sequence of SEQ ID NO:1 and the light chain comprises the sequence of SEQ ID NO:20.
- the present invention provides an isolated polypeptide comprising the sequence of any one of SEQ ID NOs: 1-33.
- the above-mentioned antibody can be a human antibody, a chimeric antibody, or a humanized antibody. It can be an IgG1, IgG2, IgG3, or IgG4.
- the antibodies of the invention recognize the epitope on the HIV-1 envelope spike recognized by 8ANC195 and are broadly neutralizing.
- 8ANC195 is known in the art and disclosed, for example, by Scheid et al., Science, 333, 1633 (2011).
- the heavy chain of 8ANC195 has the sequence of SEQ ID NO:34 and the light chain of 8ANC195 has the sequence of SEQ ID NO:35.
- antibody as used herein includes monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific antibodies and polyreactive antibodies), and antibody fragments.
- antibody as used in any context within this specification is meant to include, but not be limited to, any specific binding member, immunoglobulin class and/or isotype (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA, IgD, IgE and IgM); and biologically relevant fragment or specific binding member thereof, including but not limited to Fab, F(ab′)2, Fv, and scFv (single chain or related entity).
- immunoglobulin class and/or isotype e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA, IgD, IgE and IgM
- biologically relevant fragment or specific binding member thereof including but not limited to Fab, F(ab′)2, Fv, and scFv (s
- an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- a heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH1, CH2 and CH3).
- a light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL).
- the variable regions of both the heavy and light chains comprise framework regions (FWR) and complementarity determining regions (CDR).
- CDR1, CDR2 and CDR3 represent hypervariable regions and are arranged from NH2 terminus to the COOH terminus as follows: FWR1, CDR1, FWR2, CDR2, FWR3, CDR3, and FWR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen while, depending of the isotype, the constant region(s) may mediate the binding of the immunoglobulin to host tissues or factors.
- antibody as used herein are chimeric antibodies, humanized antibodies, and recombinant antibodies, human antibodies generated from a transgenic non-human animal, as well as antibodies selected from libraries using enrichment technologies available to the artisan.
- variable refers to the fact that certain segments of the variable (V) domains differ extensively in sequence among antibodies.
- the V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
- variability is not evenly distributed across the 110-amino acid span of the variable regions.
- the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long.
- FRs framework regions
- hypervariable regions that are each 9-12 amino acids long.
- the variable regions of native heavy and light chains each comprise four FRs, largely adopting a beta sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta sheet structure.
- the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen binding.
- the hypervariable region generally comprises amino acid residues from a “complementarity determining region” (“CDR”).
- the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
- polyclonal antibody refers to preparations that include different antibodies directed against different determinants (“epitopes”).
- the monoclonal antibodies herein include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with, or homologous to, corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with, or homologous to, corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see, for example, U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)).
- Chimeric antibodies include antibodies having one or more human antigen binding sequences (for example, CDRs) and containing one or more sequences derived from a non-human antibody, for example, an FR or C region sequence.
- chimeric antibodies included herein are those comprising a human variable region antigen binding sequence of one antibody class or subclass and another sequence, for example, FR or C region sequence, derived from another antibody class or subclass.
- a “humanized antibody” generally is considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues often are referred to as “import” residues, which typically are taken from an “import” variable region. Humanization may be performed following the method of Winter and co-workers (see, for example, Jones et al., Nature 321:522-525 (1986); Reichmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988)), by substituting import hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies (see, for example, U.S. Pat. No. 4,816,567), where substantially less than an intact human variable region has been substituted by the corresponding sequence from a non-human species.
- antibody fragment comprises a portion of an intact antibody, such as the antigen binding or variable region of the intact antibody.
- antibody fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies (see, for example, U.S. Pat. No. 5,641,870; Zapata et al., Protein Eng. 8(10): 1057-1062 [1995]); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- “Fv” is the minimum antibody fragment that contains a complete antigen-recognition and antigen-binding site. This fragment contains a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (three loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable region (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- Single-chain Fv (“sFv” or “scFv”) are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
- the sFv polypeptide can further comprise a polypeptide linker between the VH and VL domains that enables the sFv to form the desired structure for antigen binding.
- sFv Single-chain Fv
- diabodies refers to small antibody fragments prepared by constructing sFv fragments with short linkers (about 5-10 residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites.
- Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
- Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- DAbs Domain antibodies
- VH and VL immunoglobulins
- DAbs are the robust variable regions of the heavy and light chains of immunoglobulins (VH and VL, respectively). They are highly expressed in microbial cell culture, show favorable biophysical properties including, for example, but not limited to, solubility and temperature stability, and are well suited to selection and affinity maturation by in vitro selection systems such as, for example, phage display.
- DAbs are bioactive as monomers and, owing to their small size and inherent stability, can be formatted into larger molecules to create drugs with prolonged serum half-lives or other pharmacological activities. Examples of this technology have been described in, for example, WO9425591 for antibodies derived from Camelidae heavy chain Ig, as well in US20030130496 describing the isolation of single domain fully human antibodies from phage libraries.
- Fv and sFv are the only species with intact combining sites that are devoid of constant regions. Thus, they are suitable for reduced nonspecific binding during in vivo use.
- sFv fusion proteins can be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an sFv. See, for example, Antibody Engineering, ed. Borrebaeck, supra.
- the antibody fragment also can be a “linear antibody”, for example, as described in U.S. Pat. No. 5,641,870 for example. Such linear antibody fragments can be monospecific or bispecific.
- antibodies of the described invention are bispecific or multispecific.
- Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes.
- Exemplary bispecific antibodies can bind to two different epitopes of a single antigen.
- Other such antibodies can combine a first antigen binding site with a binding site for a second antigen.
- an anti-HIV arm can be combined with an arm that binds to a triggering molecule on a leukocyte, such as a T-cell receptor molecule (for example, CD3), or Fc receptors for IgG (Fc gamma R), such as Fc gamma RI (CD64), Fc gamma RH (CD32) and Fc gamma RIII (CD16), so as to focus and localize cellular defense mechanisms to the infected cell.
- a triggering molecule on a leukocyte such as a T-cell receptor molecule (for example, CD3), or Fc receptors for IgG (Fc gamma R), such as Fc gamma RI (CD64), Fc gamma RH (CD32) and Fc gamma RIII (CD16), so as to focus and localize cellular defense mechanisms to the infected cell.
- Bispecific antibodies also can be used to localize cytotoxic agents to infected cells.
- WO 96/16673 describes a bispecific anti-ErbB2/anti-Fc gamma RIII antibody and U.S. Pat. No. 5,837,234 discloses a bispecific anti-ErbB2/anti-Fc gamma RI antibody.
- a bispecific anti-ErbB2/Fc alpha antibody is reported in WO98/02463; U.S. Pat. No. 5,821,337 teaches a bispecific anti-ErbB2/anti-CD3 antibody. See also, for example, Mouquet et al., Polyreactivity Increases The Apparent Affinity Of Anti-HIV Antibodies By Heteroligation. NATURE. 467, 591-5 (2010).
- bispecific antibodies are known in the art. Traditional production of full length bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (see, for example, Millstein et al., Nature, 305:537-539 (1983)). Similar procedures are disclosed in, for example, WO 93/08829, Traunecker et al., EMBO J., 10:3655-3659 (1991) and see also; Mouquet et al., Polyreactivity Increases The Apparent Affinity Of Anti-HIV Antibodies By Heteroligation. NATURE. 467, 591-5 (2010).
- antibody variable regions with the desired binding specificities are fused to immunoglobulin constant domain sequences.
- the fusion is with an Ig heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions.
- the first heavy-chain constant region (CH1) containing the site necessary for light chain bonding is present in at least one of the fusions.
- bispecific antibodies can be prepared using chemical linkage.
- Brennan et al., Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab′)2 fragments. These fragments are reduced in the presence of the dithiol complexing agent, sodium arsenite, to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
- the Fab′ fragments generated then are converted to thionitrobenzoate (TNB) derivatives.
- One of the Fab′-TNB derivatives then is reconverted to the Fab′-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab′-TNB derivative to form the bispecific antibody.
- the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- the antibody can be linked to one of a variety of nonproteinaceous polymers, for example, polyethylene glycol, polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol.
- the antibody also can be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate)microcapsules, respectively), in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- macroemulsions for example, Remington's Pharmaceutical Sciences, 16th edition, Oslo, A., Ed., (1980).
- the antibodies of the described invention are produced recombinantly, using vectors and methods available in the art.
- Human antibodies also can be generated by in vitro activated B cells (see, for example, U.S. Pat. Nos. 5,567,610 and 5,229,275).
- General methods in molecular genetics and genetic engineering useful in the present invention are described in the current editions of Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991. Academic Press, San Diego, Calif.), “Guide to Protein Purification” in Methods in Enzymology (M. P.
- Human antibodies also can be produced in transgenic animals (for example, mice) that are capable of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
- transgenic animals for example, mice
- JH antibody heavy-chain joining region
- F(ab′)2 fragments can be isolated directly from recombinant host cell culture.
- Fab and F(ab′)2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- Phage display technology is known in the art (e.g., see technology from Cambridge Antibody Technology (CAT)) as disclosed in U.S. Pat. Nos. 5,565,332; 5,733,743; 5,871,907; 5,872,215; 5,885,793; 5,962,255; 6,140,471; 6,225,447; 6,291650; 6,492,160; 6,521,404; 6,544,731; 6,555,313; 6,582,915; 6,593,081, as well as other U.S. family members, or applications which rely on priority filing GB 9206318, filed 24 May 1992; see also Vaughn, et al. 1996 , Nature Biotechnology 14: 309-314).
- Single chain antibodies may also be designed and constructed using available recombinant DNA technology, such as a DNA amplification method (e.g., PCR), or possibly by using a respective hybridoma cDNA as a template.
- variants of the sequences recited in the application also are included within the scope of the invention.
- Further variants of the antibody sequences having improved affinity can be obtained using methods known in the art and are included within the scope of the invention.
- amino acid substitutions can be used to obtain antibodies with further improved affinity.
- codon optimization of the nucleotide sequence can be used to improve the efficiency of translation in expression systems for the production of the antibody.
- the present invention provides for antibodies, either alone or in combination with other antibodies, such as, but not limited to, VRC01, anti-V3 loop, CD4bs, and CD4i antibodies as well as PG9/PG16-like antibodies, that have broad neutralizing activity in serum.
- the present invention also relates to isolated polypeptides comprising the amino acid sequences of the light chains and heavy chains of the antibodies of the invention.
- the isolated polypeptide comprises the sequence of any one of SEQ ID NOs: 1-33.
- polypeptide is used in its conventional meaning, i.e., as a sequence of amino acids.
- the polypeptides are not limited to a specific length of the product.
- Peptides, oligopeptides, and proteins are included within the definition of polypeptide, and such terms can be used interchangeably herein unless specifically indicated otherwise.
- This term also includes post-expression modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring.
- a polypeptide can be an entire protein, or a subsequence thereof.
- a polypeptide “variant,” as the term is used herein, is a polypeptide that typically differs from a polypeptide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. Such variants can be naturally occurring or can be synthetically generated, for example, by modifying one or more of the above polypeptide sequences of the invention and evaluating one or more biological activities of the polypeptide as described herein and/or using any of a number of techniques well known in the art.
- amino acids can be substituted for other amino acids in a protein structure without appreciable loss of its ability to bind other polypeptides (for example, antigens) or cells. Since it is the binding capacity and nature of a protein that defines that protein's biological functional activity, certain amino acid sequence substitutions can be made in a protein sequence, and, accordingly, its underlying DNA coding sequence, whereby a protein with like properties is obtained. It is thus contemplated that various changes can be made in the peptide sequences of the disclosed compositions, or corresponding DNA sequences that encode said peptides without appreciable loss of their biological utility or activity.
- a polypeptide variant will contain one or more conservative substitutions.
- a “conservative substitution” is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of peptide chemistry would expect the secondary structure and hydropathic nature of the polypeptide to be substantially unchanged.
- Amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions that take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- the present invention provides an isolated antigen comprising an epitope-scaffold that mimics the HIV-1 envelope spike epitope of broadly neutralizing antibody 8ANC195.
- the epitope-scaffold comprises a discontinous epitope and a scaffold, wherein the epitope is derived from HIV-1 gp120 and gp41, and wherein at least part of the scaffold is not derived from gp120 or gp41.
- the discontinuous epitope comprises amino acids corresponding to amino acid numbers 44-47, 90-94, 97, 234, 236-238, 240, 274-278, 352-354, 357, 456, 463, 466, 487, and 625-641 of gp140 from HIV strain 93TH057 numbered using standard numbering for HIV strain HXBC2 as depicted in FIG. 20 and disclosed by Korber et al. (1998, Numbering positions in HIV relative to HXBc2, p. III-102-IV-103. In B. Korber, C. L. Kuiken, B. Foley, B. Hahn, F. McCutchan, J. W. Mellors, and J. Sodroski (ed.), Human retroviruses and AIDS. Los Alamos National Laboratories, Los Alamos, N. Mex.).
- the amino acids corresponding to amino acid numbers 234 and 276 are glycosylated.
- Epitope-scaffolds are then designed and produced, and their immunological properties are characterized.
- the Protein Data Bank www.pdb.org
- An algorithm such as Multigraft Design disclosed by Azoitei et al. is used for scaffold design in which regions of the scaffold are deleted and new segments are built to connect the epitope to the scaffold.
- Candidate epitope-scaffolds may be expressed in a host cell and purified, and tested for binding to 8ANC195 or another antibody that binds to the epitope recognized by 8ANC195.
- the invention also includes isolated nucleic acid sequences encoding part or all of the light and heavy chains of the described inventive antibodies, and fragments thereof. Due to redundancy of the genetic code, variants of these sequences will exist that encode the same amino acid sequences.
- the present invention provides an isolated nucleic acid encoding a polypeptide having the sequence of any one of SEQ ID Nos:1-33.
- the isolated nucleic acid encodes an antibody comprising a heavy chain comprising the sequence of any one of SEQ ID Nos: 1-18 and a light chain comprising the sequence of any one of SEQ ID Nos:19-33.
- the invention also includes isolated nucleic acid sequences that encode the antigen comprising the epitope-scaffold of the invention.
- nucleic acid and “polynucleotide” are used interchangeably herein to refer to single-stranded or double-stranded RNA, DNA, or mixed polymers.
- Polynucleotides can include genomic sequences, extra-genomic and plasmid sequences, and smaller engineered gene segments that express, or can be adapted to express polypeptides.
- isolated nucleic acid is a nucleic acid that is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence.
- the term encompasses a nucleic acid sequence that has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems.
- a substantially pure nucleic acid includes isolated forms of the nucleic acid. Accordingly, this refers to the nucleic acid as originally isolated and does not exclude genes or sequences later added to the isolated nucleic acid by the hand of man.
- a polynucleotide “variant,” as the term is used herein, is a polynucleotide that typically differs from a polynucleotide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. Such variants can be naturally occurring or can be synthetically generated, for example, by modifying one or more of the polynucleotide sequences of the invention and evaluating one or more biological activities of the encoded polypeptide as described herein and/or using any of a number of techniques well known in the art.
- Modifications can be made in the structure of the polynucleotides of the described invention and still obtain a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics.
- a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics.
- one skilled in the art typically will change one or more of the codons of the encoding DNA sequence.
- polynucleotide variants typically contain one or more substitutions, additions, deletions and/or insertions, such that the immunogenic binding properties of the polypeptide encoded by the variant polynucleotide is not substantially diminished relative to a polypeptide encoded by a polynucleotide sequence specifically set forth herein.
- the polypeptide encoded by the polynucleotide variant or fragment has the same binding specificity (i.e., specifically or preferentially binds to the same epitope or HIV strain) as the polypeptide encoded by the native polynucleotide.
- the described polynucleotides, polynucleotide variants, fragments and hybridizing sequences encode polypeptides that have a level of binding activity of at least about 50%, at least about 70%, and at least about 90% of that for a polypeptide sequence specifically set forth herein.
- polynucleotides of the described invention can be combined with other DNA sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length can vary considerably.
- a nucleic acid fragment of almost any length is employed.
- illustrative polynucleotide segments with total lengths of about 10000, about 5000, about 3000, about 2000, about 1000, about 500, about 200, about 100, about 50 base pairs in length, and the like, (including all intermediate lengths) are included in many implementations of this invention.
- vectors such as expression vectors, comprising a nucleic acid sequence according to the invention.
- Cells transformed with such vectors also are included within the scope of the invention.
- the present invention also provides vectors and host cells comprising a nucleic acid of the invention, as well as recombinant techniques for the production of a polypeptide of the invention.
- Vectors of the invention include those capable of replication in any type of cell or organism, including, for example, plasmids, phage, cosmids, and mini chromosomes.
- vectors comprising a polynucleotide of the described invention are vectors suitable for propagation or replication of the polynucleotide, or vectors suitable for expressing a polypeptide of the described invention. Such vectors are known in the art and commercially available.
- Vector includes shuttle and expression vectors.
- the plasmid construct also will include an origin of replication (for example, the ColE1 origin of replication) and a selectable marker (for example, ampicillin or tetracycline resistance), for replication and selection, respectively, of the plasmids in bacteria.
- An “expression vector” refers to a vector that contains the necessary control sequences or regulatory elements for expression of the antibodies including antibody fragment of the invention, in bacterial or eukaryotic cells.
- cell can be any cell, including, but not limited to, that of a eukaryotic, multicellular species (for example, as opposed to a unicellular yeast cell), such as, but not limited to, a mammalian cell or a human cell.
- a cell can be present as a single entity, or can be part of a larger collection of cells.
- Such a “larger collection of cells” can comprise, for example, a cell culture (either mixed or pure), a tissue (for example, endothelial, epithelial, mucosa or other tissue), an organ (for example, lung, liver, muscle and other organs), an organ system (for example, circulatory system, respiratory system, gastrointestinal system, urinary system, nervous system, integumentary system or other organ system), or an organism (e.g., a bird, mammal, or the like).
- a cell culture either mixed or pure
- a tissue for example, endothelial, epithelial, mucosa or other tissue
- an organ for example, lung, liver, muscle and other organs
- an organ system for example, circulatory system, respiratory system, gastrointestinal system, urinary system, nervous system, integumentary system or other organ system
- an organism e.g., a bird, mammal, or the like.
- Polynucleotides of the invention may synthesized, whole or in parts that then are combined, and inserted into a vector using routine molecular and cell biology techniques, including, for example, subcloning the polynucleotide into a linearized vector using appropriate restriction sites and restriction enzymes.
- Polynucleotides of the described invention are amplified by polymerase chain reaction using oligonucleotide primers complementary to each strand of the polynucleotide. These primers also include restriction enzyme cleavage sites to facilitate subcloning into a vector.
- the replicable vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, and one or more marker or selectable genes.
- the nucleotide sequences encoding the polypeptide, or functional equivalents may be inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted coding sequence.
- an appropriate expression vector i.e., a vector that contains the necessary elements for the transcription and translation of the inserted coding sequence.
- Methods well known to those skilled in the art may be used to construct expression vectors containing sequences encoding a polypeptide of interest and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described, for example, in Sambrook, J., et al.
- the present invention provides methods for the preparation and administration of an HIV antibody composition that is suitable for administration to a human or non-human primate patient having HIV infection, or at risk of HIV infection, in an amount and according to a schedule sufficient to induce a protective immune response against HIV, or reduction of the HIV virus, in a human.
- the present invention provides methods for the preparation and administration of an HIV antigen composition that is suitable for administration to a human or non-human primate patient having HIV infection, or at risk of HIV infection, in an amount and according to a schedule sufficient to induce a protective immune response against HIV, or reduction of the HIV virus, in a human.
- the present invention provides a composition comprising at least one antibody or polypeptide of the invention and a pharmaceutically acceptable carrier.
- the composition may include a plurality of the antibodies having the characteristics described herein in any combination and can further include antibodies neutralizing to HIV as are known in the art.
- the present invention provides a composition comprising at least one antigen of the invention and a pharmaceutically acceptable carrier, can further include antibodies neutralizing to HIV as are known in the art, and can further include an adjuvant.
- compositions can be a single or a combination of antibodies disclosed herein, which can be the same or different, in order to prophylactically or therapeutically treat the progression of various subtypes of HIV infection after vaccination. Such combinations can be selected according to the desired immunity.
- an antibody or antigen When an antibody or antigen is administered to an animal or a human, it can be combined with one or more pharmaceutically acceptable carriers, excipients or adjuvants as are known to one of ordinary skilled in the art.
- the composition can further include broadly neutralizing antibodies known in the art, including but not limited to, VRC01, b12, anti-V3 loop, CD4bs, and CD4i antibodies as well as PG9/PG16-like antibodies.
- suitable animal models are available and have been widely implemented for evaluating the in vivo efficacy against HIV of various gene therapy protocols (Sarver et al. (1993b), supra). These models include mice, monkeys and cats.
- mice models for example, SCID, bg/nu/xid, NOD/SCID, SCID-hu, immunocompetent SCID-hu, bone marrow-ablated BALB/c
- PBMCs peripheral blood mononuclear cells
- lymph nodes fetal liver/thymus or other tissues
- simian immune deficiency virus (SIV)/monkey model can be employed, as can the feline immune deficiency virus (FIV)/cat model.
- the pharmaceutical composition can contain other pharmaceuticals, in conjunction with a vector according to the invention, when used to therapeutically treat AIDS. These other pharmaceuticals can be used in their traditional fashion (i.e., as agents to treat HIV infection).
- the present invention provides an antibody-based pharmaceutical composition comprising an effective amount of an isolated antibody of the invention, or an affinity matured version, which provides a prophylactic or therapeutic treatment choice to reduce infection of the HIV virus.
- the present invention provides an antigen-based pharmaceutical composition comprising an effective amount of an isolated antigen of the invention, which provides a prophylactic or therapeutic treatment choice to reduce infection of the HIV virus.
- the pharmaceutical compositions of the present invention may be formulated by any number of strategies known in the art (e.g., see McGoff and Scher, 2000, Solution Formulation of Proteins/Peptides: In McNally, E. J., ed. Protein Formulation and Delivery. New York, N.Y.: Marcel Dekker; pp.
- a pharmaceutically acceptable composition suitable for patient administration will contain an effective amount of the antibody in a formulation which both retains biological activity while also promoting maximal stability during storage within an acceptable temperature range.
- the pharmaceutical compositions can also include, depending on the formulation desired, pharmaceutically acceptable diluents, pharmaceutically acceptable carriers and/or pharmaceutically acceptable excipients, or any such vehicle commonly used to formulate pharmaceutical compositions for animal or human administration.
- the diluent is selected so as not to affect the biological activity of the combination.
- examples of such diluents are distilled water, physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution.
- the amount of an excipient that is useful in the pharmaceutical composition or formulation of this invention is an amount that serves to uniformly distribute the antibody throughout the composition so that it can be uniformly dispersed when it is to be delivered to a subject in need thereof. It may serve to dilute the antibody or antigen to a concentration which provides the desired beneficial palliative or curative results while at the same time minimizing any adverse side effects that might occur from too high a concentration. It may also have a preservative effect.
- compositions comprising an antigen of the invention may further comprise one or more adjuvants.
- the above described antibodies and antibody compositions comprising at least one or a combination of the antibodies described herein, can be administered for the prophylactic and therapeutic treatment of HIV viral infection.
- antigens and antigen compositions comprising at least one or a combination of the antigens described herein, can be administered for the prophylactic and therapeutic treatment of HIV viral infection.
- kits of the present invention include a suitable container comprising an HIV antibody, an antigen, a polypeptide or a nucleic acid of the invention in either labeled or unlabeled form.
- the kit further includes reagents for performing the appropriate indirect assay.
- the kit may include one or more suitable containers including enzyme substrates or derivatizing agents, depending on the nature of the label. Control samples and/or instructions may also be included.
- the present invention also provides kits for detecting the presence of the HIV antibodies or the nucleotide sequence of the HIV antibody of the present invention in a biological sample by PCR or mass spectrometry.
- Label refers to a detectable compound or composition that is conjugated directly or indirectly to the antibody so as to generate a “labeled” antibody.
- a label can also be conjugated to a polypeptide and/or a nucleic acid sequence disclosed herein.
- the label can be detectable by itself (for example, radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition that is detectable.
- Antibodies and polypeptides of the described invention also can be modified to include an epitope tag or label, for example, for use in purification or diagnostic applications.
- Suitable detection means include the use of labels such as, but not limited to, radionucleotides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- labels such as, but not limited to, radionucleotides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- a method includes administering to the subject an amount of an HIV antibody of the invention effective to reduce an increase in HIV titer, virus replication or an amount of an HIV protein of one or more HIV strains or isolates in the subject.
- a method includes administering to the subject an amount of an HIV antigen of the invention effective to reduce an increase in HIV titer, virus replication or an amount of an HIV protein of one or more HIV strains or isolates in the subject.
- the present invention provides a method of reducing viral replication or spread of HIV infection to additional host cells or tissues comprising contacting a mammalian cell with the antibody, or a portion thereof, which binds to the 8ANC195 antigenic epitope on gp120.
- the present invention provides a method of reducing viral replication or spread of HIV infection to additional host cells or tissues comprising contacting a mammalian cell with the antigen that mimics the 8ANC195 antigenic epitope on gp120.
- the present invention provides a method for treating a mammal infected with a virus infection, such as, for example, HIV, comprising administering to said mammal a pharmaceutical composition comprising the HIV antibodies disclosed herein.
- the method for treating a mammal infected with HIV comprises administering to said mammal a pharmaceutical composition that comprises an antibody of the present invention, or a fragment thereof.
- the compositions of the invention can include more than one antibody having the characteristics disclosed (for example, a plurality or pool of antibodies). It also can include other HIV neutralizing antibodies as are known in the art, for example, but not limited to, VRC01, PG9 and b12.
- Passive immunization has proven to be an effective and safe strategy for the prevention and treatment of viral diseases.
- Passive immunization using human monoclonal antibodies provides an immediate treatment strategy for emergency prophylaxis and treatment of HIV.
- the present invention provides a method of inducing an HIV antigen-specific immune response in a mammal infected with HIV or at risk of infection with HIV comprising administering to the mammal a pharmaceutical composition comprising the antigen of the invention.
- the present invention provides a method of inducing an HIV antigen-specific immune response in a mammal infected with HIV or at risk of infection with HIV comprising administering to the mammal a pharmaceutical composition comprising a nucleic acid encoding the antigen of the invention.
- Subjects at risk for HIV-related diseases or disorders include patients who have come into contact with an infected person or who have been exposed to HIV in some other way. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of HIV-related disease or disorder, such that a disease or disorder is prevented or, alternatively, delayed in its progression.
- the patient is administered or provided a pharmaceutical formulation including an HIV antibody or antigen of the invention.
- the antibodies and antigens of the invention are administered to the patient in therapeutically effective amounts (i.e., amounts that eliminate or reduce the patient's viral burden).
- the antibodies or antigens are administered to a human patient, in accord with known methods, such as intravenous administration, for example, as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes.
- the antibodies can be administered parenterally, when possible, at the target cell site, or intravenously. In some embodiments, antibody is administered by intravenous or subcutaneous administration.
- Therapeutic compositions of the invention may be administered to a patient or subject systemically, parenterally, or locally. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- the antibodies or antigens may be formulated in a unit dosage injectable form (solution, suspension, emulsion) in association with a pharmaceutically acceptable, parenteral vehicle.
- a pharmaceutically acceptable, parenteral vehicle examples include, but are not limited, water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin.
- Nonaqueous vehicles include, but are not limited to, fixed oils and ethyl oleate. Liposomes can be used as carriers.
- the vehicle may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability, such as, for example, buffers and preservatives.
- the antibodies can be formulated in such vehicles at concentrations of about 1 mg/ml to 10 mg/ml.
- the dose and dosage regimen depends upon a variety of factors readily determined by a physician, such as the nature of the infection, for example, its therapeutic index, the patient, and the patient's history.
- a therapeutically effective amount of an antibody or antigen is administered to a patient.
- the amount of antibody or antigen administered is in the range of about 0.1 mg/kg to about 50 mg/kg of patient body weight.
- about 0.1 mg/kg to about 50 mg/kg body weight (for example, about 0.1-15 mg/kg/dose) of antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- the progress of this therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art.
- the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- a dosage regimen for administration of an antigen to a patient may be a suitable immunization regimen, including for example at least three separate inoculations.
- the second inoculation may be administered more than at least two weeks after the first inoculation.
- the third inoculation may be administered at least several months after the second administration.
- Other therapeutic regimens may be combined with the administration of the HIV antibody or antigen of the present invention.
- the combined administration includes co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.
- Such combined therapy can result in a synergistic therapeutic effect.
- the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- treating or “treatment” or “alleviation” are used interchangeably and refer to both therapeutic treatment and prophylactic or preventative measures; wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder.
- Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented.
- a subject or mammal is successfully “treated” for an infection if, after receiving a therapeutic amount of an antibody or antigen according to the methods of the present invention, the patient shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of infected cells or absence of the infected cells; reduction in the percent of total cells that are infected; and/or relief to some extent, one or more of the symptoms associated with the specific infection; reduced morbidity and mortality, and improvement in quality of life issues.
- the above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- terapéuticaally effective amount refers to an amount of an antibody or a drug effective to treat a disease or disorder in a subject or mammal.
- Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
- Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
- physiologically acceptable carriers include, but not limited to, buffers such as phosphate, citrate, and other organic acids; antioxidants including, but not limited to, ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as, but not limited to, serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as, but not limited to, polyvinylpyrrolidone; amino acids such as, but not limited to, glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including, but not limited to, glucose, mannose, or dextrins; chelating agents such as, but not limited to, EDTA; sugar alcohols such as, but not limited to, mannitol or sorbitol; salt-forming counterions such as, but not limited to, sodium; and/or nonionic surfactants such as, but not limited to, TWEEN; polyethylene glycol (PEG
- the present invention provides diagnostic methods. Diagnostic methods generally involve contacting a biological sample obtained from a patient, such as, for example, blood, serum, saliva, urine, sputum, a cell swab sample, or a tissue biopsy, with an HIV antibody and determining whether the antibody preferentially binds to the sample as compared to a control sample or predetermined cut-off value, thereby indicating the presence of the HIV virus.
- a biological sample obtained from a patient, such as, for example, blood, serum, saliva, urine, sputum, a cell swab sample, or a tissue biopsy.
- the present invention provides methods to detect the presence of the HIV antibodies of the present invention in a biological sample from a patient. Detection methods generally involve obtaining a biological sample from a patient, such as, for example, blood, serum, saliva, urine, sputum, a cell swab sample, or a tissue biopsy and isolating HIV antibodies or fragments thereof, or the nucleic acids that encode an HIV antibody, and assaying for the presence of an HIV antibody in the biological sample. Also, the present invention provides methods to detect the nucleotide sequence of an HIV antibody in a cell. The nucleotide sequence of an HIV antibody may also be detected using the primers disclosed herein. The presence of the HIV antibody in a biological sample from a patient may be determined utilizing known recombinant techniques and/or the use of a mass spectrometer.
- the present invention provides methods for detecting or isolating an HIV-1 binding antibody in a subject comprising obtaining a biological sample from the subject, contacting said sample with the antigen of the invention, and conducting an assay to detect or isolate an HIV-1 binding antibody.
- assessing includes any form of measurement, and includes determining if an element is present or not.
- the terms “determining”, “measuring”, “evaluating”, “assessing” and “assaying” are used interchangeably and include quantitative and qualitative determinations. Assessing may be relative or absolute. “Assessing the presence of” includes determining the amount of something present, and/or determining whether it is present or absent. As used herein, the terms “determining,” “measuring,” and “assessing,” and “assaying” are used interchangeably and include both quantitative and qualitative determinations.
- the antibodies used in this study were produced and purified as in previously-described studies (Diskin et al., Science 334, 1289 (2011).) Briefly, 8ANC195, 3BNC60 and chimeric antibody (mature HC/various LC; / ⁇ combinations of newly isolated 8ANC195 variants) IgGs were expressed by transiently transfecting HEK293-6E cells with vectors containing the appropriate heavy and light chain genes. Secreted IgGs were purified from cell supernatants using protein A affinity chromatography (GE Healthcare). For neutralization assays, IgGs were diluted to 1 mg/mL stocks in 20 mM Tris pH 8.0, 150 mM sodium chloride (TBS buffer).
- 8ANC195 Fab was expressed with a 6 ⁇ -His tag on the C-terminus of CH1 as described for IgGs and purified using Ni 2+ -NTA affinity chromatography (GE Healthcare) and Superdex 200 16/60 size exclusion chromatography (GE Healthcare).
- a truncated gp120 from the HIV-1 strain 93TH057 containing mutations Asn88Gln gp120 , Asn289Gln gp120 , Asn334Gln gp120 , Asn392Gln gp120 , Asn448Gln gp120 was produced by transiently transfecting HEK293-S (GnTI ⁇ / ⁇ ) cells adapted for growth in suspension by the Caltech Protein Expression Center with a pTT5 vector encoding His-tagged gp120.
- Secreted gp120 was captured on Ni 2+ -NTA resin (GE Healthcare) and further purified using Superdex 200 16/60 size exclusion chromatography (GE Healthcare).
- Soluble CD4 domains 1 and 2 were produced as described previously (Diskin et al. Nat Struct Mol Biol 17, 608 (2010)). Briefly, the pACgp67b vector encoding 6 ⁇ -His-tagged sCD4 or sCD4 K75T (residues 1-186 of mature CD4) was used to make infectious baculovirus particles using BaculoGold (BD Biosynthesis). Protein was expressed in Hi5 cells, captured on a Ni 2+ -NTA column (GE Healthcare) and further purified using Superdex 200 16/60 size exclusion chromatography (GE Healthcare).
- the protein was treated with Endoglycosidase H (New England Biolabs) for 16 hours at 25° C. and then purified by Superdex 200 16/60 size exclusion chromatography (GE Healthcare).
- Crystallization conditions were screened using vapor diffusion in sitting drops set using a Mosquito® crystallization robot (TTP labs) in a final volume of 200 nL per drop (1:1 protein to reservoir ratio) utilizing commercially available crystallization screens (Hampton Research, Microlytic).
- Initial crystallization hits for 8ANC195 Fab and for 8ANC195 Fab/93TH057 gp120/sCD4 K75T complex were identified using the MCSG-1 (Microlytic) and PEGRx (Hampton) screens and then manually optimized.
- Crystals of the 8ANC195 Fab/93TH057 gp120/sCD4 K75T complex were obtained upon mixing a protein solution at 16 mg/mL with 14% polyethylene glycol 3,350, 0.1 M HEPES pH 7.3, 2% benzamidine HCl at 20° C. Crystals were briefly soaked in mother liquor solution supplemented with 30% ethylene glycol before flash cooling in liquid nitrogen.
- X-ray diffraction data for 8ANC195 Fab crystals were collected at the Argonne National Laboratory Advanced Photon Source (APS) beamline 23-ID-D using a MAR 300 CCD detector.
- X-ray diffraction data for 8ANC195 Fab/93TH057 gp120/sCD4 K75T complex crystals were collected at the Stanford Synchrotron Radiation Lightsource (SSRL) beamline 12-2 using a Pilatus 6M pixel detector (Dectris). The data were indexed, integrated and scaled using XDS (Kabsch, Acta Crystallogr D Biol Crystallogr 66, 133 (2010)).
- the 8ANC195 Fab structure was solved by molecular replacement using Phenix (Adams et al., Acta Crystallogr D Biol Crystallogr 66, 213 (2010)) and the V H V L and C H 1C L domains of NIH45-46 Fab (PDB code 3U7W) lacking all CDR loops as two separate search models.
- the model was then refined to 2.13 ⁇ resolution using an iterative approach involving refinement and verification of model accuracy with simulated annealing composite omit maps using the Phenix crystallography package, and manually fitting models into electron density maps using Coot (Emsley et al., Acta Crystallogr D Biol Crystallogr 60, 2126 (2004).
- the 8ANC195 Fab/93TH057 gp120/sCD4 K75T complex structure was solved by molecular replacement using Phaser (Adams et al., Acta Crystallogr D Biol Crystallogr 66, 213 (2010)) and the V H V L and C H 1C L domains of 8ANC195 (lacking all CDR loops), 93TH057 gp120 (taken from PDB code 3U7Y), and sCD4 (taken from PDB code 3LQA) as separate search models.
- the complex structure was refined to 3.0 ⁇ resolution as described for the Fab structure.
- CC 1/2 statistic (Karplus et al., Science 336, 1030 (2012)) (correlation coefficient between two random halves of the data set where CC 1/2>10 %) was used to determine the high-resolution cutoff for the data. Phenix was used to compute CC 1/2 (85.4% for the highest resolution shell and 99.8% for the entire data set), supporting our high-resolution cutoff determination.
- Disordered residues that were not included in the model include residues 146-153, 206-208, 233-238 and the 6 ⁇ -His tag of the 8ANC195 heavy chain, residues 213-215 of the light chain, residues 125-197 (V1/V2 substitution), 302-324 (V3 substitution), residues 397-409 (a total of 6 residues from V4), residues 492-494 and the 6 ⁇ -His tag of 93TH057 gp120 and residues 106-111, 154-155, 177-186 of sCD4 K75T .
- Buried surface areas were calculated using PDBePISA (Krissinel et al., Journal of molecular biology 372, 774 (2007)) and a 1.4 ⁇ probe. Superimposition calculations were done and molecular representations were generated using PyMol (Schrödinger (The PyMOL Molecular Graphics System, 2011). Pairwise Ca alignments were performed using PDBeFold (Krissinel et al., Acta Crystallogr D Biol Crystallogr 60, 2256 (2004)).
- High-binding 96-well ELISA plates (Costar) were coated overnight with 5 ⁇ g/well of purified gp120 in 100 mM sodium carbonate pH 9.6. After washing with TBS containing 0.05% Tween 20, the plates were blocked for 2 h with 1% BSA, 0.05% Tween-TBS (blocking buffer) and then incubated for 2 h with 8ANC195 IgG (1 ⁇ g/mL) mixed with 1:2 serially diluted solutions of potential antibody competitors (sCD4, J3 VHH, 3BNC60 Fab, NIH45-46 Fab) in blocking buffer (competitor concentration range from 5 to 320 ⁇ g/mL).
- the plates were incubated with HRP-conjugated goat anti-human IgG antibodies (Jackson ImmunoReseach) (at 0.8 ⁇ g/ml in blocking buffer) for 1 hour.
- HRP-conjugated goat anti-human IgG antibodies Jackson ImmunoReseach
- the ELISAs were developed by addition of HRP chromogenic substrate (TMB solution, BioLegend) and the color development stopped by addition of 10% sulfuric acid. Experiments were performed in duplicate.
- Biacore T100 Biacore T100
- YU-2 and 93TH057 gp120 proteins were primary amine-coupled on CMS chips (Biacore) at a coupling density of 1,000 RUs and one flow cell was mock coupled using HBS-EP+ buffer.
- 8ANC195 and chimeric IgGs were injected over flow cells at increasing concentrations (62.5 to 1,000 nM), at flow rates of 20 ⁇ l/min with 5 consecutive cycles of 2 min association/1 min dissociation and a final 10 min dissociation phase.
- Flow cells were regenerated with 3 pulses of 10 mM glycine pH 2.5.
- K D (M) Apparent binding constants
- a TZM-bl/pseudovirus neutralization assay was used to evaluate the neutralization potencies of the antibodies as described (Montefiori, Current protocols in immunology edited by John E. Coligan et al., Chapter 12 , Unit 12 11 (2005)).
- Pseudoviruses were generated by cotransfection of HEK 293T cells with an Env expression plasmid and a replication-defective backbone plasmid.
- Neutralization was determined by measuring the reduction in luciferase reporter gene expression in the presence of antibody following a single round of pseudovirus infection in TZM-bl cells.
- Nonlinear regression analysis was used to calculate the concentrations at which half-maximal inhibition was observed (IC 50 values).
- the BG505 SOSIP.664/8ANC195 Fab complex and grids were prepared as described previously (Kong et al., Nat Struct Mol Biol 20, 796 (2013).
- the data were collected on an FEI Tecnai T12 electron microscope coupled with a Tietz TemCam-F416 4 k ⁇ 4 k CMOS camera using the LEGINON interface. Images were collected in 10° increments from 0° to ⁇ 40° using a defocus range of 0.6-0.9 ⁇ m at a magnification of 52,000 ⁇ , resulting in a pixel size of 2.05 ⁇ at the specimen plane.
- Particles were selected using DogPicker (Voss et al., Journal of structural biology 166, 205 (2009)) within the Appion software package (Lander et al., Journal of structural biology 166, 95 (2009)), and sorted from reference-free 2D class averages using the SPARX package (Penczek et al., Ultramicroscopy 40, 33 (1992).
- An initial model was generated by common lines from class averages using the EMAN2 package (Tang et al., Journal of structural biology 157, 38 (2007) and was refined using 11,637 unbinned particles. The refinement was carried out using the SPARX package (Penczek et al., Ultramicroscopy 53, 251 (1994)) with C3 symmetry applied.
- the resulting resolution at a 0.5 Fourier Shell Correlation (FSC) cut-off was 18.7 ⁇ ( FIGS. 6A ,B).
- Single Cell clonal variants of 8ANC195 were isolated by 2CC core-specific single cell sorting, followed by reverse transcription and immunoglobulin gene amplification as described previously (Scheid et al., Science 333, 1633 (2011)). Immunoglobulin genes were cloned into heavy and light chain expression vectors and co-transfected for IgG production as described previously (Tiller et al., Journal of immunological methods 329, 112 (2008)).
- IgG+CD19+ memory B cells were bulk sorted on a FACS AriaIII cell sorter. Bulk mRNA was extracted using TRIzol (Invitrogen) and reverse transcribed as previously described (Scheid et al., Science 333, 1633 (2011)). 8ANC195-related heavy and light chain genes were PCR amplified using the following clone-specific primers:
- Amplification products were gel purified and cloned into TOPO TA sequencing vectors (Invitrogen) and expression vectors as described previously (T. Tiller et al., Journal of immunological methods 329, 112 (2008)).
- Phylogenetic trees were assembled using Geneious Neighbor-Joining Tree Software. Sequence Alignments were performed using DNA Star Clustal W alignment software.
- IC 50 values derived from neutralization assays with 8ANC195 and its 52 HC / ⁇ 5 LC variant against 11 sensitive virus strains were analyzed by G-test for the relationship between the amino acid identity at position 636 gp41 and the antibody IC 50 .
- the partition between “high” and “low” IC 50 s was chosen such that approximately half of the strains had high IC 50 s (0.8 ⁇ g/mL for 8ANC195, 0.1 ⁇ g/mL for 52 HC / ⁇ 5 LC .
- CDRH1 loop conformation was stabilized by a hydrogen bond network among backbone atoms of CDRH1, burial of Phe30 HC , and hydrogen bonds with Asp73 HC and Thr104 HC ( FIG. 2A ).
- CDRH3 had a complex tertiary structure in which residues 102 HC -110 HC formed a loop protruding ⁇ 10 ⁇ from the antibody surface, and residues 111 HC -118 HC formed a (3-sheet subdomain that was stabilized by hydrophobic stacking between His113 HC and Trp33 LC and a hydrogen bond between Met117 HC and Gln90 LC ( FIG. 2B ).
- the side chain of Tyr92 LC hydrogen bonded with the Gly110 HC carbonyl oxygen, stabilizing a kink in the loop that formed the transition between these secondary structure elements ( FIG. 2B ).
- the complex structure showed independent binding of sCD4 and 8ANC195 Fab to distinct sites on gp120 ( FIG. 16B ).
- sCD4 interacted with the gp120 core as in other sCD4-gp120 structures (Kwong et al., Nature 393, 648 (1998)) ( FIG. 3A ), thus its binding was not altered by the presence of the adjacent antibody, consistent with binding and neutralization experiments showing no effects of CD4 addition on 8ANC195 activity ( FIG. 3B ,C).
- sCD4 did, however, contribute to crystal packing ( FIG. 3D ), rationalizing why diffraction-quality crystals failed to grow in its absence.
- 8ANC195 bound to a gp120 region adjacent to the CD4 binding site, contacting mainly the gp120 inner domain, loops D and V5, and a small patch of the gp120 outer domain (His352 gp120 -Asn354 gp120 ) ( FIG. 16B ,C).
- a loop in FWR3 HC consisting of somatically-mutated residues and extended by a four-residue insertion, reached like a thumb into the pocket formed by loops D, V5 and outer domain residues 352 gp120 -358 gp120 ( FIGS. 16A ,B and 17 A, FIG. 4B ).
- CDRH1 and CDRH3 contacted the gp120 inner domain ( FIG. 16B , FIG. 4B ), contributing to a 1287 ⁇ 2 interface between the 8ANC195 HC and gp120 protein residues.
- the CDRH1 and CDRH3 loop conformations conserved in the free Fab ( FIG. 16A , FIG.
- the Asn276 gp120 glycan (a complex-type N-glycan in native HIV-1 Envs (Go et al., Journal of virology 85, 8270 (2011); Binley et al., Journal of virology 84, 5637 (2010)), but high mannose in the crystallized gp120) was wedged between 8ANC195 and sCD4, where it contacted FWR residues in strands A and B and the N-terminal portion of CDRH1, forming an interface involving only the core pentasaccharide common to both high mannose and complex-type N-glycans ( FIG. 17D , FIG. 4E ,F).
- the 8ANC195 HC was bracketed by the Asn234 gp120 and Asn276 gp120 glycans in a manner analogous to interactions of HIV-1 antibodies that penetrate the Env glycan shield, such as PG16 (interactions with Asn156 gp120 /Asn173 gp120 and Asn160 gp120 glycans) (Pancera et al., Nature structural & molecular biology 20, 804 (2013), PGT128 (with Asn301 gp120 and Asn332 gp120 glycans) (Pejchal et al., Science 334, 1097 (2011)) and PGT121 (with Asn137 gp120 and Asn332 gp120 glycans) (Mouquet et al., Proceedings of the National Academy of Sciences of the United States of America 109, E3268 (2012); Julien et al., Science 342, 1477 (2013) Julien et al., PL
- 8ANC195 contacts with gp120 were made exclusively by its HC; indeed, 33% of 8ANC195 V H domain residues not buried at the LC interface contacted gp120.
- the 8ANC195-gp120 structure demonstrated that 8ANC195 recognizes a novel epitope involving the Asn234 gp120 and Asn276 gp120 glycans, the gp120 inner domain, loop D and loop V5, which would be adjacent to gp41 in Env trimer (Julien et al., Science 342, 1477 (2013); Lyumkis et al., Science 342, 1484 (2013)).
- the slightly different placements could be due to crystal packing effects, spatial restraints imposed by the gp41 glycans that were not present in the 8ANC195-gp120 complex, removal of the PNGS at Asn88 gp120 in the gp120 core, which may have allowed for a closer association of 8ANC195 and gp120 in the crystal structure, and/or a small conformational change in the gp120 region of the trimer to accommodate the Fab orientation trapped by crystallization.
- the EM reconstruction highlighted a potential role for 8ANC195 LC contacts to gp41.
- chimeras consisting of the 8ANC195 HC paired with different Lcs were tested in neutralization and binding assays.
- the chimeras included a full germline LC, a mature LC with individual CDR loops reverted to their germline sequences or CDRL3 partially mutated to alanines, or the LC from the CD4 binding site antibody 3BNC117 ( FIG. 19A ).
- the chimeras bound normally to gp120 core and to a full-length 93TH057 gp120 ( FIG. 19B , table 3), thus changes in the LC did not disrupt the HC portion of the antibody combining site.
- a chimeric IgG with one of the most conservatively-substituted LCs (Thr-Gly-Asn, mature CDRL1 containing a one-residue insertion, reverted to Ser-Ser, germline CDRL1) displayed unchanged binding to gp120, yet showed reductions in neutralization potency of up to 250-fold.
- conservative changes in CDRL2 (Arg-Gly-Ala, the mature CDRL2, reverted to the germline Lys-Ala-Ser sequence) caused large reductions in neutralization potencies but had little effect on gp120 binding.
- clone-specific primers were used to amplify 8ANC195 variants from purified populations of CD19+ IgG+ memory B cells ( FIG. 11 ). 128 HC and 100 LC sequences were obtained that were clonally related to 8ANC195 and displayed greater sequence diversity than antibodies obtained using antigen-specific selection ( FIGS. 10, 12 ). Of the 13 HC and 6 LC genes exhibiting greatest diversity, all combinations were co-transfected in order to evaluate their neutralizing activity against a 15-member Tier 2 virus panel. 3 of 39 (7.7%) new antibodies were at least as broad and potent as 8ANC195 ( FIG. 19C and Table 5).
- VRC01 neutralized 12 of 15 viruses with a 0.56 ⁇ g/ml mean IC 50
- 10-1074 neutralized 6 of 15 viruses with a mean of 0.09 ⁇ g/ml
- the LC was critical to the activity of more potent 52 HC ⁇ 5 LC variant, as demonstrated by diminished neutralization potencies when ⁇ 5 LC was swapped for either ⁇ 3 LC or ⁇ 11 LC ( FIG. 19C ).
- the weaker neutralization could be explained by differences between ⁇ 5 LC and ⁇ 3 LC at solvent-exposed residues in CDRL2 (53 LC and 54 LC ) and FWRL3 (64 LC ), and a nearby buried residue (34 LC ) that may affect the structural integrity of CDRL1.
- ⁇ 5 LC was the only LC containing an S64R LC substitution and this single change compared to the 8ANC195 LC may account for the 5-fold improved potency of 52 HC ⁇ 5 LC .
- Residues in the immediate vicinity of Asn637 gp41 might also modify neutralization; all six viral strains that were potently neutralized by the 52 HC ⁇ 5 LC variant had Asp636 gp41 or Asn636 gp41 whereas the remaining eight strains had Ser636 gp41 (p ⁇ 0.001 by G-test).
- 8ANC195 defines a novel site of HIV-1 Env vulnerability to neutralizing antibodies that spans gp120 and gp41 ( FIG. 15 ).
- a strategy employed by antibodies such as PG9 and PGT128 (Pejchal et al., Science 334, 1097 (2011); McLellan et al., Nature 480, 336 (2011)) 8ANC195 inserted its entire HC variable region into a gap in the shield to form a large interface, of which >50% involved contacts to gp120 glycans ( FIG. 17 ).
- 8ANC195 variants Although it was not possible to obtain large numbers of 8ANC195 variants by standard single cell cloning techniques (Scheid et al., J Immunol Methods 343, 65 (2009)), randomly combining HCs and LCs obtained from memory B cells without antigen-specific sorting demonstrated that the target of this antibody supported neutralization activity comparable to that against the most vulnerable sites on Env. Potent variants of 8ANC195 are particularly since the epitope does not overlap with the targets of CD4 binding site, V2 loop, V3 loop or MPER antibodies.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Engineering & Computer Science (AREA)
- AIDS & HIV (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Tropical Medicine & Parasitology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
Abstract
Description
- This application is a Divisional of U.S. patent application Ser. No. 16/578,833, filed Sep. 23, 2019, which is a Continuation of U.S. patent application Ser. No. 15/115,547, filed Jul. 29, 2016, now U.S. Pat. No. 10,421,803, which is the U.S. National Phase of International Patent Application No. PCT/US2015/013924, filed Jan. 30, 2015, which claims priority to U.S. Provisional Application No. 61/934,359 filed Jan. 31, 2014, the contents of which are incorporated herein by reference.
- This invention was made with government support under Grant Nos. AI100148 and AI100663 awarded by the National Institutes of Health. The government has certain rights in the invention.
- The only target of neutralizing anti-HIV-1 antibodies is the envelope (Env) spike, a heterotrimer of gp120 and gp41 subunits. Single cell-based antibody cloning techniques have recently uncovered a large number of antibodies that can potently neutralize highly diverse HIV-1 variants by targeting Env (Klein et al., Science 341, 1199 (2013)). When transferred passively, broadly neutralizing antibodies (bNAbs) can prevent infection by HIV-1 or SHIV in humanized mice and macaques, respectively. Moreover, combinations of bNAbs can also suppress established HIV-1 and SHIV infections (Klein et al., Nature 492, 118 (2012); Barouch et al., Nature 503, 224 (2013); Shingai et al., Nature 503, 277 (2013)).
- Most of the bNAbs characterized to date target one of four major sites of vulnerability on HIV-1 Env: on gp120, the CD4 binding site, the V2 loop, and the base of the V3 loop, and on gp41, the membrane proximal region (Klein et al., Science 341, 1199 (2013); Burton et al., Science 337, 183 (2012); Mascola et al., Immunological Reviews 254, 225 (2013)). 8ANC195 is among a small group of bNAbs that does not appear to target any of these sites. Although only two of the B cells originally isolated from the 8ANC195 donor, an HIV-1 elite controller, belonged to the 8ANC195 clone, the antibodies produced by this clone complemented the neutralizing activity of antibodies produced by a more expanded B cell clone that targeted the CD4 binding site (Scheid et al., Science 333, 1633 (2011)).
- 8ANC195 is classified as a bNAb because it neutralized 66% of viruses in a diverse viral panel (Scheid et al., Science 333, 1633 (2011)). Like other anti-HIV-1 bNAbs, 8ANC195 is highly somatically mutated, including insertions and deletions in the complementarity determining regions (CDRs) and framework regions (FWRs) of its heavy chain (HC) and light chain (LC). Although initial efforts to map the 8ANC195 epitope were unsuccessful (Ibid.) computational analyses of neutralization data predicted that intact potential N-linked glycosylation sites (PNGSs) at
positions - This invention relates, in part, to the isolation of broadly-neutralizing antibodies (bNAbs) directed at an epitope on the HIV-1 envelope spike that spans the gp120 and gp41 subunits.
- In one embodiment, the antibody comprises a heavy chain having one of the following amino acid sequences:
-
(g52; SEQ ID NO: 1) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTY DRWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g23; SEQ ID NO: 2) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVIIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTS DYWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g8; SEQ ID NO: 3) QIHLVQSGTGVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQGLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPITSLEIKNVTSDDTAVYFCTTTSTY DKWSGLYHDGVMAFSSWGQGTLISVSAASTKG; (g20; SEQ ID NO: 4) QIHLVQSGTEVKKPGSSVAVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHDFRGRVIIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTATSTP DYWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g59; SEQ ID NO: 5) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQGLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNVTSDDTAVYFCTTTSTY DEWSDLHHDGVMAFSSWGQGTLISVSAASTKG; (g62; SEQ ID NO: 6) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTY DKWSGLHHDGVMAFSSRGQGTLISVSAASTKG; (g22; SEQ ID NO: 7) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGPSPPISSLEIKNLTSDDTAVYFCTTTSTY DKWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g15; SEQ ID NO: 8) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVIIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTASTY DKWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g4; SEQ ID NO: 9) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVIIS AVDLTGSSPPISPLEIKNLTSDDTAVYFCTTTSTS DRWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g46; SEQ ID NO: 10) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQGLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNVTSDDTAVYFCTTTSTY DKWSGLHHDGVVAFSSWGQGTLISVSAASTKG; (g44; SEQ ID NO: 11) QIHLVQSGTEVKKPGSSVTVSCKAYEVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNVTSDDTAVYFCTTTSTH DKWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g50; SEQ ID NO: 12) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQGLEYIGQIWRWKSSASHHFRGRVLIS AIDLTGSSPPISSLEIKNVTSDDTAVYFCTTMSTY DKWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (g3; SEQ ID NO: 13) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV SWVRQAPGQRLEYIGQIRRWKSSASHHFRGRVTVS AVDPTGSSPPISSLEIRDLTTDDTAVYFCTTTSTS DYWSGLHNERGTAFSSWGQGTLISVSAASTKG; (3040HC; SEQ ID NO: 14) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTY DQWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (3430HC; SEQ ID NO: 15) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVIIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTS DYWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (3484HC; SEQ ID NO: 16) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTY DRWSGLHHDGVMAFSSWGQGTLISVSAASTKG; (3044HC: SEQ ID NO: 17) QIHLVQSGTEVRKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTY DKWSGLHHDGVMAFSSWGQGTLISVSAASTKG; and (3630HC: SEQ ID NO: 18) QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAV NWVRQAPGQSLEYIGQIWRWKSSASHHFRGRVLIS AVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTY DRWSGLHHDGVMAFSSWGQGTLISVSAASTKG. - In one embodiment, the antibody comprises a light chain having one of the following amino acid sequences:
-
(k3; SEQ ID NO: 19) DIQMTQSPSTLSASIGDTVRISCRASQSITGNWLA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGT DFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k5; SEQ ID NO: 20) DIQMTQSPSTLSASTGDTVRISCRASQSITGNWVA WYQQRPGKAPRLLIYRGAALLGGVPSRFRGSAAGT DFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k59; SEQ ID NO: 21) DIQMTQSPSTLSASIGDTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLLGGVPSKFSGSAAGT DFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k62; SEQ ID NO: 22) DIQMTQSPSTLSASIGDTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLVGGVPSRFSGSAAGT DFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k18; SEQ ID NO: 23) DIQMTQSPSTLSASVGDTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGA DFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k53; SEQ ID NO: 24) DIQMTQSPSTLSASIGDTVMISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSKLLGGVPSRFSGSAAGT GFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k61; SEQ ID NO: 25) DIQMTQSPSTLSASIGDTVRISCRASQSITGNWVA WYHQRPGKAPRLLIYRGAALLGGVPSRFSGSAAGT DFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k11; SEQ ID NO: 26) DIQMTQSPSTLSASVGGTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGT DFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k19; SEQ ID NO: 27) DIQMTQSPSTLSASVGDTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGT GFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (k81; SEQ ID NO: 28) DIQMTQSPSTLSASIGDTVRISCRASQSITGGWVA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGT DFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (3040LC; SEQ ID NO: 29) DIQMTQSPSTLSASIGDTVRISCRASQSITGNWVA WYQQRPGKAPRLLIYRGAALLGGVPSRFSGSAAGT DFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (3430LC; SEQ ID NO: 30) DIQMTQSPSTLSASVGDTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGT DFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (3484LC; SEQ ID NO: 31) DIQMTQSPSTLSASIGDTVRISCRASQSITGNWVA WYQQRPGKAPRLLIYRGAALLGGVPSRFRGSAAGT DFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; (3044LC; SEQ ID NO: 32) DIQMTQSPSTLSASIGDTVRISCRASQSITGNWVA WYQQRPGKAPRLLIYRGAALLGGVPSRFSGSAAGT DFTLTIGNLQTEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF; and (3630LC; SEQ ID NO: 33) DIQMTQSPSTLSASIGDTVRISCRASQSITGGWLA WYHQRPGKAPRLLIYRGSRLLGGVPSRFSGSAAGT DFTLTIANLQAEDFGTFYCQQYDTYPGTFGQGTKV EVKRTVAAPSVF. - Accordingly, one aspect of this invention features an isolated polypeptide comprising the sequence of any one of SEQ ID NOs: 1-33. The invention also provides an isolated anti-HIV antibody comprising one or both of a heavy chain comprising the sequence of any one of SEQ ID NOs: 1-18 and a light chain comprising the sequence any one of SEQ ID NOs: 19-33.
- The above-mentioned antibody can be a human antibody, a chimeric antibody, or a humanized antibody. It can be an IgG1, IgG2, IgG3, or IgG4. The antibodies of the invention recognize the epitope on the HIV-1 envelope spike recognized by 8ANC195 and are broadly neutralizing.
- In another aspect, the invention provides an isolated nucleic acid encoding the isolated polypeptide or anti-HIV-1 antibody described above. Also provided are a vector comprising the nucleic acid and a cultured cell comprising the nucleic acid.
- In another aspect, the invention provides a composition comprising at least one of the above-described isolated polypeptide or anti-HIV-1 antibody or a fragment thereof. In one embodiment, the composition comprises a pharmaceutically acceptable carrier.
- In another aspect, the invention provides a method of preventing or treating an HIV-1 infection or an HIV-related disease. The method includes steps of identifying a patient in need of such prevention or treatment, and administering to the patient a first therapeutic agent comprising a therapeutically effective amount of at least one of the above-described isolated polypeptide or anti-HIV-1 antibody. The method can further comprise administering a second therapeutic agent, such as an antiviral agent.
- In another embodiment, the present invention provides an isolated antigen comprising an epitope-scaffold that mimics the HIV-1 envelope spike epitope of broadly neutralizing antibody 8ANC195. In one aspect, the epitope-scaffold comprises a discontinous epitope and a scaffold. In another aspect, the epitope is derived from HIV-1 gp120 and gp41, and at least part of the scaffold is not derived from gp120 or gp41. In another aspect, the discontinuous epitope comprises amino acids corresponding to amino acid numbers 44-47, 90-94, 97, 234, 236-238, 240, 274-278, 352-354, 357, 456, 463, 466, 487, and 625-641 of gp140 from HIV strain 93TH057 numbered using standard numbering for HIV strain HXBC2. The amino acids corresponding to
amino acid numbers - In another aspect, the invention provides an isolated nucleic acid encoding the isolated antigen described above. Also provided are a vector comprising the nucleic acid and a cultured cell comprising the nucleic acid.
- In another aspect, the invention provides a composition comprising the isolated antigen. In one embodiment, the composition further comprises a pharmaceutically acceptable carrier. In one embodiment, the composition further comprises an adjuvant.
- In another aspect, the present invention provides a method for generating an immune response in a subject in need thereof, comprising administering to said subject a composition comprising the above-described isolated antigen in an amount effective to generate an immune response.
- In another aspect, the invention provides a method of preventing or treating an HIV-1 infection or an HIV-related disease. The method includes steps of identifying a patient in need of such prevention or treatment, and administering to the patient a first therapeutic agent comprising a therapeutically effective amount of the above-described antigen. The method can further comprise administering a second therapeutic agent, such as an antiviral agent.
- In another aspect, the present invention provides a method for detecting or isolating an HIV-1 binding antibody in a subject comprising obtaining a biological sample from the subject, contacting the sample with the above-described antigen, and conducting an assay to detect or isolate an HIV-1 binding antibody.
- The details of one or more embodiments of the invention are set forth in the description below. Other features, objects, and advantages of the invention will be apparent from the description and from the claims.
-
FIGS. 1A and 1B illustrates alignments of (A) VH and (B) VL sequences of mature 8ANC195 and its putative germ-line progenitor (GL). 8ANC195 HC has the sequence of SEQ ID NO:34. 8ANC195 LC has the sequence of SEQ ID NO:35. GL HC has the sequence of SEQ ID NO:36. GL LC has the sequence of SEQ ID NO:37. Residues forming the CDR loops are labeled (CDR1), (CDR2) and (CDR3). 8ANC195 is one of the most heavily mutated bNAbs isolated to date, with 49 of 103 amino acid mutations in the HC and 25 of 90 in the LC. The HC was too highly somatically mutated to accurately assign D and J gene segments, but the LC showed sufficient homology to assign its J segment asIGKJ5* 01. -
FIGS. 2A, 2B and 2C illustrates conformations of 8ANC195 CDRH1 and CDRH3 loops. (A) The hook-like conformation of CDRH1 is stabilized by burial of the hydrophobic Phe30HC side chain and hydrogen bonds within CDRH1 and with CDRH3 and FWR1 and FWR3 residues (Ala24HC and Asp73HC, respectively). (B) The complexed CDRH3 conformation consists of a protruding loop (residues 95HC-100HC) and a small (3-sheet subdomain (residues 100dHC-100kHC) stabilized by multiple hydrogen bonds within CDRH3 as well as with CDRH1 and CDRL3. A hydrogen bond between Tyr92LC and Gly100cHC stabilized the bifurcation of CDRH3 into its two subdomains. CDRH1 and CDRH3 loop backbone atoms are shown as sticks and side chains of residues important for stabilizing the loop conformations are shown as sticks (involved in direct contacts) or lines (backbone involved in contacts) (other side chains Tyr98HC, Lys100HC and Trp100aHC, are shown for clarity). (C) Comparison of CDRH3 loops in 8ANC195 and other anti-HIV-1 bNAbs. CDRH3 residues corresponding to 8ANC195HC residues 90-105 of NIH45-46 (PDB 3U7Y), PG16 (PDB 4DQO), PGT121 (PDB 4FQC) and PGT128 (PDB 3TYG) are shown as Ca traces. -
FIGS. 3A, 3B, 3C, 3D and 3E illustrates CD4 interactions with 8ANC195. (A) Superimposition of sCD4 D1D2/gp120 structures (ribbon diagrams) from complexes with 8ANC195, 17b (PDB 1GCI) and 21c PDB 3LQA). (B) Competition ELISA of 8ANC195 IgG binding to 93TH057 gp120 in the presence of increasing concentrations of potential competitors (sCD4, diamonds; J3 VHH, triangles; 3BNC60 Fab, squares; NIH45-46 Fab, circles). No competition was observed with small, single-Ig domain CD4-binding site ligands (sCD4, J3 VHH), but larger Fab fragments of CD4 binding site antibodies (3BNC60, NIH45-46) competed for binding. (C) In vitro assay comparing neutralization of YU2 by sCD4 (squares), 8ANC195 IgG (triangles), and an equimolar mixture of 8ANC195 and sCD4 (circles). (D) Packing of 8ANC195/sCD4/gp120 crystals. Several symmetry mates are shown as surface representations (8ANC195 HC; 8ANC195 LC; 93TH057 gp120; sCD4 D1D2). Areas where two complexes form crystal contacts are indicated. (E) In vitro assay comparing neutralization of YU2 by 8ANC195 IgG (squares), 3BNC60 IgG (triangles), and an 8ANC195 IgG mutant that lacks the FWR3 insertion (Ser77a-Pro77b-Pro77c-Ile77d) that results in the protruding “FWR3HC thumb” (circles). -
FIGS. 4A, 4B, 4C, 4D, 4E, 4F, 4G, 4H and 4I illustrates surface area buried at interface of 8ANC195 Fab and gp120. Left panels, surface area buried on 8ANC195 Fab by (A) gp120 protein residues, (C) Asn276gp120 glycan or (E) Asn234gp120 glycan; right panels, surface area buried by 8ANC195 Fab on (B) gp120 protein residues, (D) Asn234gp120 glycan or (F) Asn276gp120 glycan. Atoms buried at these interfaces are shown as surface representations overlaid onto ribbon diagrams of 8ANC195 Fab and gp120 or stick representations of glycans. 8ANC195 Fab: HC; LC; CDRH1; CDRH2; CDRH3; gp120: inner domain; outer domain; loop D; loop V5; Asn234gp120 glycan: Asn276gp120 glycan. 2Fo-Fc annealed omit electron density maps (grey mesh, o′=1) used to build (E) Asn234gp120 glycan and (H) Asn276gp120 glycan. (I) Modeled fucose residue α1-6-linked to the first N-acetylglucosamine residue of the Asn276gp120 glycan shows that the core fucose of a complex-type N-glycan could be accommodated by the 8ANC195. Glycan residues are shown as sticks, and gp120, 8ANC195 HC and CD4 are shown as surface representations. -
FIGS. 5A and 5B illustrates a comparison of glycan-dependent bNAbs. 8ANC195 is “bracketed” by two glycans (Asn234gp120 glycan; Asn276gp120 glycan) in the 8ANC195 Fab/gp120/sCD4 complex structure (left panels). For comparison, crystal structures of PG16 (middle panels, PDB 4DQO) bound to a V1/V2 loop scaffold and PGT128 (right panels, PDB 3TYG) bound to a V3 loop scaffold are shown with (A) the antibody HCs aligned to the 8ANC195 HC or (B) an alternative view showing their interactions with bracketing glycans (for PG16: Asn160gp120 glycan/Asn172 glycan; for PGT128: Asn301gp120 glycan/Asn332gp120 glycan). The proteins are shown as ribbon diagrams and the glycans as stick representations. -
FIGS. 6A, 6B and 6C illustrates green EM refinement statistics. (A) Electron micrograph at 52,000× magnification and −0.8 μm defocus. (B) Reference-free 2D class averages of the SOSIP trimer in complex with 8ANC195 Fab showing various orientations. (C) Fourier Shell Correlation (FSC) graph resulting from refinement. The resolution was determined as 18.7 Å at an FSC cut-off of 0.5. -
FIGS. 7A and 7B illustrates negative stain EM reconstruction of BG505 SOSIP.664 in complex with 8ANC195 Fab fit two ways. (A) When the gp120-8ANC195 Fab structure was fit into the EM density, the gp120 from the complex structure was displaced slightly outwards in comparison to the gp120 in the SOSIP trimer structure. The HC and LC of the Fab are shown. The Asn234gp120 and Asn276gp120 glycans are shown as spheres. (B) Close up of the Fab-Env interface. The position of Asn637gp120 can be deduced from the position of the C-terminus of HR2, which corresponds to residue Gly664gp41. This residue is in close proximity to the LC and the glycan at this position could interact with the 8ANC195 Fab. -
FIGS. 8A, 8B, 8C and 8D illustrates EM reconstruction of 8ANC195 Fab/BG505 SOSIP.664 showing gp41 contacts. Top view of EM density with the X-ray structures of BG505 SOSIP.664 (PDB ID 4NCO; gp120, grey; gp41) and 8ANC195 Fab (HC; LC with a map contour level of 0.0176 (A) and 0.030 (B). Areas of contact between 8ANC195 and gp41 are marked with circles, those between 8ANC195 and gp120 with black circles. (C,D) Close-up of 8ANC195 LC and HR2 region in EM complex structure (HR2 coordinates in PDB 4NCO with presumptive sidechains for strain YU2 added to the polyalanine coordinates). (C) Fab is shown as a surface representation with highlights (CDRL1; CDRL2; CDRH3, and gp41 HR2 is shown as a ribbon diagram. The position of Asn637gp41 was deduced from the position of the C-terminus of the SOSIP.664 trimer (Gly664gp41). (D) 8ANC195 HC and LC residues (sticks) positioned to contact HR2, with side chains of surface-exposed residues that vary between newly isolated 8ANC195 (T/K) variants shown as sticks. -
FIGS. 9A, 9B and 9C relate to Single Cell Variants of 8ANC195. (A) Strategy of large scale single cell sorting. (B) IgH and IgL chain genes from isolated single cell variants of 8ANC195. Identical members are grouped together. The HC CDR3 of 8ANC195 has the sequence of SEQ ID NO:38. The HC CDR3 of 8ANC142 has the sequence of SEQ ID NO:39. The HC CDR3 of 8ANC3430 has the sequence of SEQ ID NO:40. The HC CDR3 of 8ANC3484 has the sequence of SEQ ID NO:41. The HC CDR3 of 8ANC3044 has the sequence of SEQ ID NO:42. The HC CDR3 of 8ANC3630 has the sequence of SEQ ID NO:43. The LC CDR3 of 8ANC195 has the sequence of SEQ ID NO:44. The LC CDR3 of 8ANC142 has the sequence of SEQ ID NO:45. The LC CDR3 of 8ANC3430 has the sequence of SEQ ID NO:46. The LC CDR3 of 8ANC3484 has the sequence of SEQ ID NO:47. The LC CDR3 of 8ANC3044 has the sequence of SEQ ID NO:48. The LC CDR3 of 8ANC3630 has the sequence of SEQ ID NO:49. (C) IC50 neutralization titers of distinct single cell versions of the 8ANC195 clone compared to 8ANC195 against a 15virus Tier 2 panel. -
FIGS. 10A and 10B depict the alignment of amino acid sequences of all distinct single cell versions of the 8ANC195 clone. HC (A) and LC (B) sequences were aligned with the respective germline genes. Mutations introduced by somatic hypermutation are indicated. -
FIGS. 11A, 11B and 11C are directed to Bulk Sorted Variants of 8ANC195. (A) Strategy of bulk memory B cell sorting without antigen. (B) PCR strategy for the amplification of 8ANC195 HC and LC clone members. Shown are the priming sites aligned with the original nucleotide sequence of 8ANC195 at the respective sites. Mismatches with the respective germline genes are indicated.Primers Primers Primers -
FIGS. 12A and 12B depict alignment of amino acid sequences of selected bulk sorted versions of the 8ANC195 clone. HC (A) and LC (B) sequences were aligned with the respective germline genes as well as the original 8ANC195 sequence. All mutations introduced by somatic hypermutation are indicated. -
-
FIGS. 14A, 14B and 14C show that somatic mutations in the 8ANC195 LC CDRs and FWRs could affect contacts with gp41. (A) Surface representation of 8ANC195 Fab (HC; LC; somatically mutated, surface-exposed LC residues; residue 64LC). (B) Surface representation of 8ANC195 Fab and BG505 gp41 HR2 with a modeled Man6 sugar attached to Asn637gp41. (C) Surface representation of 8ANC195 Fab (CDRL1; CDRL2; CDRH3; residue 64LC) and BG505 gp41 HR2 with a modeled Man6 sugar attached to Asn637gp41. -
FIG. 15 illustrates locations of bNAb epitopes on HIV-1 Env Trimer. EM density map of Env trimer including MPER region showing approximate epitope locations for antibodies targeting the 8ANC195 epitope, CD4 binding site, V3 loop/Asn332 glycan (332 glycan shown as spheres), V1/V2 loop/Asn160 glycan (160 glycan shown as spheres), and MPER -
FIGS. 16A, 16B and 16C illustrate crystal structures of 8ANC195 Fab and 8ANC195/gp120/sCD4 complex. (A) Superimposition of unbound and bound (HC and LC) structures of 8ANC195 Fab shown as ribbon diagrams. CDR loops are highlighted (CDRH1/CDRL1; CDRH2/CDRL2; CDRH3; CDRL3) and a “thumb”-like loop formed by an insertion in FWR3 is indicated. Disordered loops are shown as dashed lines. (B) Space-filling model (inset) and ribbon diagram of ternary complex of 8ANC195 (HC and LC), sCD4, and 93TH057 gp120 core (inner domain; outer domain; bridging sheet; loop D; loop V5; CD4 binding loop). Ordered glycans attached to Asn234gp120 and Asn276gp120 are shown as sticks. Fab CDR loops are indicated as in (A). sCD4 was omitted from the right panel for clarity. (C) Approximate locations of bNAb epitopes on a surface representation of the gp120 core. The epitopes of V3 and V1N2 antibodies include regions of loops (dotted lines) not present in the gp120 core structure. CD4 binding site and 8ANC195 epitopes are outlined by black (CD4 binding site) and (8ANC195) dots. Glycans included in the 8ANC195 epitope are indicated. Subdomains of gp120 are indicated as in (B). -
FIGS. 17A, 17B, 17C, 17D and 17E show contacts made by 8ANC195 HC with gp120 protein residues and glycans. Labels for gp120 protein and glycan residues are italicized. Hydrogen bonds are shown as dashed lines. (A) FWR3HC loop contacts with loop D, loop V5, and outer domain loop. (B) 8ANC195 HC CDRH1 and CDRH3 contacts with gp120 inner domain. (C) Buried surface area between the Asn234gp120 glycan (transparent surface with glycan residues shown as sticks) and 8ANC195 (HC FWR residues and CDRH2 are indicated). Antibody atoms buried by glycan interactions are shown as surfaces. (D) Buried surface area between the Asn276 glycangp120 (transparent surface with glycan residues shown as sticks) and 8ANC195 (HC FWR residues and CDRH1 are indicated). Antibody atoms buried by glycan interactions are shown as surfaces. (E) Top: Contacts made by 8ANC195 HC FWR residues and CDRH2 with Asn234gp120 glycan. Glycan and protein residues involved in hydrogen bonds are shown as sticks. Bottom: schematic of ordered high mannose glycans on Asn234gp120 and Asn276gp120 (bottom). -
FIGS. 18A and 18B show the EM structure of 8ANC195/Env trimer complex and model of 8ANC195 LC interactions with gp41 HR2. (A) EM reconstruction of 8ANC195 Fab/BG505 SOSIP.664. Side (left) and top (right) views of EM density with the X-ray structures of BG505 SOSIP.664 (PDB ID 4NCO; gp120, gp41) and 8ANC195 Fab fit in two ways: (i) fitting 8ANC195 Fab independently of gp140 coordinates to the EM density (best fit/independently placed), and (ii) by aligning the gp120 of the gp120/8ANC195 complex structure onto the gp120 of PDB 4NCO fit to the EM density. (B) Close-up of 8ANC195 LC/HR2 region of EM complex structure (Fab placement is best fit/independently placed as in (A)). Left: Fab is shown as a surface representation with highlights (CDRL1; CDRL2; CDRH1; CDRH3), and gp140 is shown as a ribbon diagram (gp120; gp41). The position of Asn637gp41 was deduced from the position of the C-terminus of the SOSIP.664 trimer (Gly664gp41). Right: 8ANC195 HC and LC residues (sticks) positioned to contact HR2, which is shown as a surface representation calculated from HR2 coordinates in PDB 4NCO with presumptive sidechains added to the polyalanine coordinates. -
FIGS. 19A, 19B and 19C show effects of LC sequence changes on 8ANC195 neutralization potency. (A) Sequences of LC CDRs in constructs used with 8ANC195 HC to make chimeric IgGs (left) and location of CDRs on 8ANC195 structure (right). Sequences derived from the mature antibody are shown and those derived from the germline precursor are shown on a grey background. The mutations introduced into CDRL3 in glCDRL3Ala are shown on a white background. (B) Effects of changes in 8ANC195 LC on binding to 93TH057 and YU2 gp120s and neutralization of viral strains, expressed as fold changes over results for 8ANC195 IgG. KD and IC50 values for these experiments are shown in table S3. (C) Heat map showing the expression and neutralization of randomly paired HCs and LCs from the bulk sort on aTier 2 15-virus panel. Average IC50 values (arithmetic means) between 0.1 and 2 μg/ml; between 2.1 and 10 μg/ml, between 10.1 and 14.9 μg/ml, and above 15 μg/ml are indicated with varying degrees of shaded squares. Empty squares represent insufficient antibody expression. -
FIG. 20 depicts the alignment of gp140 sequences from HIV strains HXBC2 and 93TH057 using standard HXBC2 numbering of amino acid residues. Amino acid residues contacted by 8ANC195 in the complex crystal structure with 93TH057 gp120 core are indicated on the 93TH057 sequence. Glycans contacted by 8ANC195 in the complex crystal structure with 93TH057 gp120 core are shown as the asparagine residues to which they are attached, highlighted in cyan on the 93TH057 sequence. The region of gp41 contacted by 8ANC195 based on the EM complex structure is indicated. Select glycans are shown as diagrams on the asparagine residues to which they are attached. - The present invention is based, at least in part, on the identification of the epitope recognized by 8ANC195, a broadly neutralizing antibody to the HIV-1 envelope glycoprotein. The present invention, in one embodiment, provides an isolated antigen comprising the epitope, compositions comprising the antigen, and methods of using the antigen. In other embodiments, the present invention provides isolated ant-HIV-1 antibodies that recognize the epitope on the HIV-1 envelope spike recognized by 8ANC195, compositions comprising the antibodies, and methods of using the antibodies.
- In one embodiment, the present invention is directed to an isolated anti-HIV antibody comprising one or both of a heavy chain comprising the sequence of any one of SEQ ID NOs: 1-18 and a light chain comprising the sequence any one of of SEQ ID NOs: 19-33. In one preferred embodiment, the heavy chain comprises the sequence of SEQ ID NO:1 and the light chain comprises the sequence of SEQ ID NO:20. In another embodiment, the present invention provides an isolated polypeptide comprising the sequence of any one of SEQ ID NOs: 1-33.
- The above-mentioned antibody can be a human antibody, a chimeric antibody, or a humanized antibody. It can be an IgG1, IgG2, IgG3, or IgG4. The antibodies of the invention recognize the epitope on the HIV-1 envelope spike recognized by 8ANC195 and are broadly neutralizing. 8ANC195 is known in the art and disclosed, for example, by Scheid et al., Science, 333, 1633 (2011). The heavy chain of 8ANC195 has the sequence of SEQ ID NO:34 and the light chain of 8ANC195 has the sequence of SEQ ID NO:35.
- The term “antibody” (Ab) as used herein includes monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific antibodies and polyreactive antibodies), and antibody fragments. Thus, the term “antibody” as used in any context within this specification is meant to include, but not be limited to, any specific binding member, immunoglobulin class and/or isotype (e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA, IgD, IgE and IgM); and biologically relevant fragment or specific binding member thereof, including but not limited to Fab, F(ab′)2, Fv, and scFv (single chain or related entity). It is understood in the art that an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. A heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH1, CH2 and CH3). A light chain is comprised of a light chain variable region (VL) and a light chain constant region (CL). The variable regions of both the heavy and light chains comprise framework regions (FWR) and complementarity determining regions (CDR). The four FWR regions are relatively conserved while CDR regions (CDR1, CDR2 and CDR3) represent hypervariable regions and are arranged from NH2 terminus to the COOH terminus as follows: FWR1, CDR1, FWR2, CDR2, FWR3, CDR3, and FWR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen while, depending of the isotype, the constant region(s) may mediate the binding of the immunoglobulin to host tissues or factors.
- Also included in the definition of “antibody” as used herein are chimeric antibodies, humanized antibodies, and recombinant antibodies, human antibodies generated from a transgenic non-human animal, as well as antibodies selected from libraries using enrichment technologies available to the artisan.
- The term “variable” refers to the fact that certain segments of the variable (V) domains differ extensively in sequence among antibodies. The V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen. However, the variability is not evenly distributed across the 110-amino acid span of the variable regions. Instead, the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long. The variable regions of native heavy and light chains each comprise four FRs, largely adopting a beta sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the beta sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see, for example, Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- The term “hypervariable region” as used herein refers to the amino acid residues of an antibody that are responsible for antigen binding. The hypervariable region generally comprises amino acid residues from a “complementarity determining region” (“CDR”).
- The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. The term “polyclonal antibody” refers to preparations that include different antibodies directed against different determinants (“epitopes”).
- The monoclonal antibodies herein include “chimeric” antibodies in which a portion of the heavy and/or light chain is identical with, or homologous to, corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with, or homologous to, corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see, for example, U.S. Pat. No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984)). Chimeric antibodies include antibodies having one or more human antigen binding sequences (for example, CDRs) and containing one or more sequences derived from a non-human antibody, for example, an FR or C region sequence. In addition, chimeric antibodies included herein are those comprising a human variable region antigen binding sequence of one antibody class or subclass and another sequence, for example, FR or C region sequence, derived from another antibody class or subclass.
- A “humanized antibody” generally is considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues often are referred to as “import” residues, which typically are taken from an “import” variable region. Humanization may be performed following the method of Winter and co-workers (see, for example, Jones et al., Nature 321:522-525 (1986); Reichmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239:1534-1536 (1988)), by substituting import hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies (see, for example, U.S. Pat. No. 4,816,567), where substantially less than an intact human variable region has been substituted by the corresponding sequence from a non-human species.
- An “antibody fragment” comprises a portion of an intact antibody, such as the antigen binding or variable region of the intact antibody. Examples of antibody fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments; diabodies; linear antibodies (see, for example, U.S. Pat. No. 5,641,870; Zapata et al., Protein Eng. 8(10): 1057-1062 [1995]); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- “Fv” is the minimum antibody fragment that contains a complete antigen-recognition and antigen-binding site. This fragment contains a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (three loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable region (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- “Single-chain Fv” (“sFv” or “scFv”) are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. The sFv polypeptide can further comprise a polypeptide linker between the VH and VL domains that enables the sFv to form the desired structure for antigen binding. For a review of sFv, see, for example, Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994); Borrebaeck 1995, infra.
- The term “diabodies” refers to small antibody fragments prepared by constructing sFv fragments with short linkers (about 5-10 residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites. Bispecific diabodies are heterodimers of two “crossover” sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
- Domain antibodies (dAbs), which can be produced in fully human form, are the smallest known antigen-binding fragments of antibodies, ranging from about 11 kDa to about 15 kDa. DAbs are the robust variable regions of the heavy and light chains of immunoglobulins (VH and VL, respectively). They are highly expressed in microbial cell culture, show favorable biophysical properties including, for example, but not limited to, solubility and temperature stability, and are well suited to selection and affinity maturation by in vitro selection systems such as, for example, phage display. DAbs are bioactive as monomers and, owing to their small size and inherent stability, can be formatted into larger molecules to create drugs with prolonged serum half-lives or other pharmacological activities. Examples of this technology have been described in, for example, WO9425591 for antibodies derived from Camelidae heavy chain Ig, as well in US20030130496 describing the isolation of single domain fully human antibodies from phage libraries.
- Fv and sFv are the only species with intact combining sites that are devoid of constant regions. Thus, they are suitable for reduced nonspecific binding during in vivo use. sFv fusion proteins can be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an sFv. See, for example, Antibody Engineering, ed. Borrebaeck, supra. The antibody fragment also can be a “linear antibody”, for example, as described in U.S. Pat. No. 5,641,870 for example. Such linear antibody fragments can be monospecific or bispecific.
- In certain embodiments, antibodies of the described invention are bispecific or multispecific. Bispecific antibodies are antibodies that have binding specificities for at least two different epitopes. Exemplary bispecific antibodies can bind to two different epitopes of a single antigen. Other such antibodies can combine a first antigen binding site with a binding site for a second antigen. Alternatively, an anti-HIV arm can be combined with an arm that binds to a triggering molecule on a leukocyte, such as a T-cell receptor molecule (for example, CD3), or Fc receptors for IgG (Fc gamma R), such as Fc gamma RI (CD64), Fc gamma RH (CD32) and Fc gamma RIII (CD16), so as to focus and localize cellular defense mechanisms to the infected cell. Bispecific antibodies also can be used to localize cytotoxic agents to infected cells. Bispecific antibodies can be prepared as full length antibodies or antibody fragments (for example, F(ab′)2 bispecific antibodies). For example, WO 96/16673 describes a bispecific anti-ErbB2/anti-Fc gamma RIII antibody and U.S. Pat. No. 5,837,234 discloses a bispecific anti-ErbB2/anti-Fc gamma RI antibody. For example, a bispecific anti-ErbB2/Fc alpha antibody is reported in WO98/02463; U.S. Pat. No. 5,821,337 teaches a bispecific anti-ErbB2/anti-CD3 antibody. See also, for example, Mouquet et al., Polyreactivity Increases The Apparent Affinity Of Anti-HIV Antibodies By Heteroligation. NATURE. 467, 591-5 (2010).
- Methods for making bispecific antibodies are known in the art. Traditional production of full length bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two chains have different specificities (see, for example, Millstein et al., Nature, 305:537-539 (1983)). Similar procedures are disclosed in, for example, WO 93/08829, Traunecker et al., EMBO J., 10:3655-3659 (1991) and see also; Mouquet et al., Polyreactivity Increases The Apparent Affinity Of Anti-HIV Antibodies By Heteroligation. NATURE. 467, 591-5 (2010).
- Alternatively, antibody variable regions with the desired binding specificities (antibody-antigen combining sites) are fused to immunoglobulin constant domain sequences. The fusion is with an Ig heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. According to some embodiments, the first heavy-chain constant region (CH1) containing the site necessary for light chain bonding, is present in at least one of the fusions. DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host cell. This provides for greater flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yield of the desired bispecific antibody. It is, however, possible to insert the coding sequences for two or all three polypeptide chains into a single expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios have no significant affect on the yield of the desired chain combination.
- Techniques for generating bispecific antibodies from antibody fragments also have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. For example, Brennan et al., Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab′)2 fragments. These fragments are reduced in the presence of the dithiol complexing agent, sodium arsenite, to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab′ fragments generated then are converted to thionitrobenzoate (TNB) derivatives. One of the Fab′-TNB derivatives then is reconverted to the Fab′-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab′-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- Other modifications of the antibody are contemplated herein. For example, the antibody can be linked to one of a variety of nonproteinaceous polymers, for example, polyethylene glycol, polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol. The antibody also can be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization (for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate)microcapsules, respectively), in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules), or in macroemulsions. Such techniques are disclosed in, for example, Remington's Pharmaceutical Sciences, 16th edition, Oslo, A., Ed., (1980).
- Typically, the antibodies of the described invention are produced recombinantly, using vectors and methods available in the art. Human antibodies also can be generated by in vitro activated B cells (see, for example, U.S. Pat. Nos. 5,567,610 and 5,229,275). General methods in molecular genetics and genetic engineering useful in the present invention are described in the current editions of Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991. Academic Press, San Diego, Calif.), “Guide to Protein Purification” in Methods in Enzymology (M. P. Deutshcer, ed., (1990) Academic Press, Inc.); PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, Calif.), Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, N.Y.), and Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.). Reagents, cloning vectors, and kits for genetic manipulation are available from commercial vendors such as BioRad, Stratagene, Invitrogen, ClonTech and Sigma-Aldrich Co.
- Human antibodies also can be produced in transgenic animals (for example, mice) that are capable of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production. For example, it has been described that the homozygous deletion of the antibody heavy-chain joining region (JH) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array into such germ-line mutant mice results in the production of human antibodies upon antigen challenge. See, for example, Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immuno., 7:33 (1993); U.S. Pat. Nos. 5,545,806, 5,569,825, 5,591,669 (all of GenPharm); U.S. Pat. No. 5,545,807; and WO 97/17852. Such animals can be genetically engineered to produce human antibodies comprising a polypeptide of the described invention.
- Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, for example, Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. Fab, Fv and ScFv antibody fragments can all be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of these fragments. Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′)2 fragments (see, for example, Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F(ab′)2 fragments can be isolated directly from recombinant host cell culture. Fab and F(ab′)2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- Other techniques that are known in the art for the selection of antibody fragments from libraries using enrichment technologies, including but not limited to phage display, ribosome display (Hanes and Pluckthun, 1997, Proc. Nat. Acad. Sci. 94: 4937-4942), bacterial display (Georgiou, et al., 1997, Nature Biotechnology 15: 29-34) and/or yeast display (Kieke, et al., 1997, Protein Engineering 10: 1303-1310) may be utilized as alternatives to previously discussed technologies to select single chain antibodies. Single-chain antibodies are selected from a library of single chain antibodies produced directly utilizing filamentous phage technology. Phage display technology is known in the art (e.g., see technology from Cambridge Antibody Technology (CAT)) as disclosed in U.S. Pat. Nos. 5,565,332; 5,733,743; 5,871,907; 5,872,215; 5,885,793; 5,962,255; 6,140,471; 6,225,447; 6,291650; 6,492,160; 6,521,404; 6,544,731; 6,555,313; 6,582,915; 6,593,081, as well as other U.S. family members, or applications which rely on priority filing GB 9206318, filed 24 May 1992; see also Vaughn, et al. 1996, Nature Biotechnology 14: 309-314). Single chain antibodies may also be designed and constructed using available recombinant DNA technology, such as a DNA amplification method (e.g., PCR), or possibly by using a respective hybridoma cDNA as a template.
- Variant antibodies also are included within the scope of the invention. Thus, variants of the sequences recited in the application also are included within the scope of the invention. Further variants of the antibody sequences having improved affinity can be obtained using methods known in the art and are included within the scope of the invention. For example, amino acid substitutions can be used to obtain antibodies with further improved affinity. Alternatively, codon optimization of the nucleotide sequence can be used to improve the efficiency of translation in expression systems for the production of the antibody.
- The present invention provides for antibodies, either alone or in combination with other antibodies, such as, but not limited to, VRC01, anti-V3 loop, CD4bs, and CD4i antibodies as well as PG9/PG16-like antibodies, that have broad neutralizing activity in serum.
- The present invention also relates to isolated polypeptides comprising the amino acid sequences of the light chains and heavy chains of the antibodies of the invention. In one embodiment, the isolated polypeptide comprises the sequence of any one of SEQ ID NOs: 1-33.
- The term “polypeptide” is used in its conventional meaning, i.e., as a sequence of amino acids. The polypeptides are not limited to a specific length of the product. Peptides, oligopeptides, and proteins are included within the definition of polypeptide, and such terms can be used interchangeably herein unless specifically indicated otherwise. This term also includes post-expression modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring. A polypeptide can be an entire protein, or a subsequence thereof.
- A polypeptide “variant,” as the term is used herein, is a polypeptide that typically differs from a polypeptide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. Such variants can be naturally occurring or can be synthetically generated, for example, by modifying one or more of the above polypeptide sequences of the invention and evaluating one or more biological activities of the polypeptide as described herein and/or using any of a number of techniques well known in the art.
- For example, certain amino acids can be substituted for other amino acids in a protein structure without appreciable loss of its ability to bind other polypeptides (for example, antigens) or cells. Since it is the binding capacity and nature of a protein that defines that protein's biological functional activity, certain amino acid sequence substitutions can be made in a protein sequence, and, accordingly, its underlying DNA coding sequence, whereby a protein with like properties is obtained. It is thus contemplated that various changes can be made in the peptide sequences of the disclosed compositions, or corresponding DNA sequences that encode said peptides without appreciable loss of their biological utility or activity.
- In many instances, a polypeptide variant will contain one or more conservative substitutions. A “conservative substitution” is one in which an amino acid is substituted for another amino acid that has similar properties, such that one skilled in the art of peptide chemistry would expect the secondary structure and hydropathic nature of the polypeptide to be substantially unchanged.
- Amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take various of the foregoing characteristics into consideration are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- In another embodiment, the present invention provides an isolated antigen comprising an epitope-scaffold that mimics the HIV-1 envelope spike epitope of broadly neutralizing antibody 8ANC195. On one embodiment, the epitope-scaffold comprises a discontinous epitope and a scaffold, wherein the epitope is derived from HIV-1 gp120 and gp41, and wherein at least part of the scaffold is not derived from gp120 or gp41. In one embodiment, the discontinuous epitope comprises amino acids corresponding to amino acid numbers 44-47, 90-94, 97, 234, 236-238, 240, 274-278, 352-354, 357, 456, 463, 466, 487, and 625-641 of gp140 from HIV strain 93TH057 numbered using standard numbering for HIV strain HXBC2 as depicted in
FIG. 20 and disclosed by Korber et al. (1998, Numbering positions in HIV relative to HXBc2, p. III-102-IV-103. In B. Korber, C. L. Kuiken, B. Foley, B. Hahn, F. McCutchan, J. W. Mellors, and J. Sodroski (ed.), Human retroviruses and AIDS. Los Alamos National Laboratories, Los Alamos, N. Mex.). In another embodiment, the amino acids corresponding toamino acid numbers - Methods of making epitope-scaffolds are known in the art and disclosed, for example, by Correia et al. Journal of Molecular Biology 405, 284 (2011), Correia et al.
Structure 18, 1116 (2010), Ofek et al. Proc Natl Acas Sci USA 107, 17780 (2010), McLellan et al. J Mol Biol 409, 853 (2011), Azoitei et al. Science 334, 373 (2011) and in US2010/0068217. Briefly, information obtained from the crystallographic analysis disclosed herein is used to design epitope-scaffolds that mimic the 8ANC195 epitope on the HIV-1 envelope spike. First, computational methods are utilized to identify non-HIV scaffold proteins capable of supporting the discontinuous epitope identified herein. Epitope-scaffolds are then designed and produced, and their immunological properties are characterized. For example, in the method of Azoitei et al., the Protein Data Bank (www.pdb.org) is searched for suitable scaffolds for the discontinuous epitope, for example by using an algorithm such as Multigraft Match. An algorithm such as Multigraft Design disclosed by Azoitei et al. is used for scaffold design in which regions of the scaffold are deleted and new segments are built to connect the epitope to the scaffold. Candidate epitope-scaffolds may be expressed in a host cell and purified, and tested for binding to 8ANC195 or another antibody that binds to the epitope recognized by 8ANC195. - The invention also includes isolated nucleic acid sequences encoding part or all of the light and heavy chains of the described inventive antibodies, and fragments thereof. Due to redundancy of the genetic code, variants of these sequences will exist that encode the same amino acid sequences. In one embodiment, the present invention provides an isolated nucleic acid encoding a polypeptide having the sequence of any one of SEQ ID Nos:1-33. In another embodiment, the isolated nucleic acid encodes an antibody comprising a heavy chain comprising the sequence of any one of SEQ ID Nos: 1-18 and a light chain comprising the sequence of any one of SEQ ID Nos:19-33.
- The invention also includes isolated nucleic acid sequences that encode the antigen comprising the epitope-scaffold of the invention.
- The terms “nucleic acid” and “polynucleotide” are used interchangeably herein to refer to single-stranded or double-stranded RNA, DNA, or mixed polymers. Polynucleotides can include genomic sequences, extra-genomic and plasmid sequences, and smaller engineered gene segments that express, or can be adapted to express polypeptides.
- An “isolated nucleic acid” is a nucleic acid that is substantially separated from other genome DNA sequences as well as proteins or complexes such as ribosomes and polymerases, which naturally accompany a native sequence. The term encompasses a nucleic acid sequence that has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates and chemically synthesized analogues or analogues biologically synthesized by heterologous systems. A substantially pure nucleic acid includes isolated forms of the nucleic acid. Accordingly, this refers to the nucleic acid as originally isolated and does not exclude genes or sequences later added to the isolated nucleic acid by the hand of man.
- A polynucleotide “variant,” as the term is used herein, is a polynucleotide that typically differs from a polynucleotide specifically disclosed herein in one or more substitutions, deletions, additions and/or insertions. Such variants can be naturally occurring or can be synthetically generated, for example, by modifying one or more of the polynucleotide sequences of the invention and evaluating one or more biological activities of the encoded polypeptide as described herein and/or using any of a number of techniques well known in the art.
- Modifications can be made in the structure of the polynucleotides of the described invention and still obtain a functional molecule that encodes a variant or derivative polypeptide with desirable characteristics. When it is desired to alter the amino acid sequence of a polypeptide to create an equivalent, or even an improved, variant or portion of a polypeptide of the invention, one skilled in the art typically will change one or more of the codons of the encoding DNA sequence.
- Typically, polynucleotide variants contain one or more substitutions, additions, deletions and/or insertions, such that the immunogenic binding properties of the polypeptide encoded by the variant polynucleotide is not substantially diminished relative to a polypeptide encoded by a polynucleotide sequence specifically set forth herein.
- In some embodiments, the polypeptide encoded by the polynucleotide variant or fragment has the same binding specificity (i.e., specifically or preferentially binds to the same epitope or HIV strain) as the polypeptide encoded by the native polynucleotide. In some embodiments, the described polynucleotides, polynucleotide variants, fragments and hybridizing sequences, encode polypeptides that have a level of binding activity of at least about 50%, at least about 70%, and at least about 90% of that for a polypeptide sequence specifically set forth herein.
- The polynucleotides of the described invention, or fragments thereof, regardless of the length of the coding sequence itself, can be combined with other DNA sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length can vary considerably. A nucleic acid fragment of almost any length is employed. For example, illustrative polynucleotide segments with total lengths of about 10000, about 5000, about 3000, about 2000, about 1000, about 500, about 200, about 100, about 50 base pairs in length, and the like, (including all intermediate lengths) are included in many implementations of this invention.
- Further included within the scope of the invention are vectors such as expression vectors, comprising a nucleic acid sequence according to the invention. Cells transformed with such vectors also are included within the scope of the invention.
- The present invention also provides vectors and host cells comprising a nucleic acid of the invention, as well as recombinant techniques for the production of a polypeptide of the invention. Vectors of the invention include those capable of replication in any type of cell or organism, including, for example, plasmids, phage, cosmids, and mini chromosomes. In some embodiments, vectors comprising a polynucleotide of the described invention are vectors suitable for propagation or replication of the polynucleotide, or vectors suitable for expressing a polypeptide of the described invention. Such vectors are known in the art and commercially available.
- “Vector” includes shuttle and expression vectors. Typically, the plasmid construct also will include an origin of replication (for example, the ColE1 origin of replication) and a selectable marker (for example, ampicillin or tetracycline resistance), for replication and selection, respectively, of the plasmids in bacteria. An “expression vector” refers to a vector that contains the necessary control sequences or regulatory elements for expression of the antibodies including antibody fragment of the invention, in bacterial or eukaryotic cells.
- As used herein, the term “cell” can be any cell, including, but not limited to, that of a eukaryotic, multicellular species (for example, as opposed to a unicellular yeast cell), such as, but not limited to, a mammalian cell or a human cell. A cell can be present as a single entity, or can be part of a larger collection of cells. Such a “larger collection of cells” can comprise, for example, a cell culture (either mixed or pure), a tissue (for example, endothelial, epithelial, mucosa or other tissue), an organ (for example, lung, liver, muscle and other organs), an organ system (for example, circulatory system, respiratory system, gastrointestinal system, urinary system, nervous system, integumentary system or other organ system), or an organism (e.g., a bird, mammal, or the like).
- Polynucleotides of the invention may synthesized, whole or in parts that then are combined, and inserted into a vector using routine molecular and cell biology techniques, including, for example, subcloning the polynucleotide into a linearized vector using appropriate restriction sites and restriction enzymes. Polynucleotides of the described invention are amplified by polymerase chain reaction using oligonucleotide primers complementary to each strand of the polynucleotide. These primers also include restriction enzyme cleavage sites to facilitate subcloning into a vector. The replicable vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, and one or more marker or selectable genes.
- In order to express a polypeptide of the invention, the nucleotide sequences encoding the polypeptide, or functional equivalents, may be inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted coding sequence. Methods well known to those skilled in the art may be used to construct expression vectors containing sequences encoding a polypeptide of interest and appropriate transcriptional and translational control elements. These methods include in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. Such techniques are described, for example, in Sambrook, J., et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Plainview, N.Y., and Ausubel, F. M. et al. (1989) Current Protocols in Molecular Biology, John Wiley & Sons, New York. N.Y.
- According to another embodiment, the present invention provides methods for the preparation and administration of an HIV antibody composition that is suitable for administration to a human or non-human primate patient having HIV infection, or at risk of HIV infection, in an amount and according to a schedule sufficient to induce a protective immune response against HIV, or reduction of the HIV virus, in a human.
- According to another embodiment, the present invention provides methods for the preparation and administration of an HIV antigen composition that is suitable for administration to a human or non-human primate patient having HIV infection, or at risk of HIV infection, in an amount and according to a schedule sufficient to induce a protective immune response against HIV, or reduction of the HIV virus, in a human.
- According to another embodiment, the present invention provides a composition comprising at least one antibody or polypeptide of the invention and a pharmaceutically acceptable carrier. The composition may include a plurality of the antibodies having the characteristics described herein in any combination and can further include antibodies neutralizing to HIV as are known in the art. According to another embodiment, the present invention provides a composition comprising at least one antigen of the invention and a pharmaceutically acceptable carrier, can further include antibodies neutralizing to HIV as are known in the art, and can further include an adjuvant.
- It is to be understood that compositions can be a single or a combination of antibodies disclosed herein, which can be the same or different, in order to prophylactically or therapeutically treat the progression of various subtypes of HIV infection after vaccination. Such combinations can be selected according to the desired immunity. When an antibody or antigen is administered to an animal or a human, it can be combined with one or more pharmaceutically acceptable carriers, excipients or adjuvants as are known to one of ordinary skilled in the art. The composition can further include broadly neutralizing antibodies known in the art, including but not limited to, VRC01, b12, anti-V3 loop, CD4bs, and CD4i antibodies as well as PG9/PG16-like antibodies.
- Further, with respect to determining the effective level in a patient for treatment of HIV, in particular, suitable animal models are available and have been widely implemented for evaluating the in vivo efficacy against HIV of various gene therapy protocols (Sarver et al. (1993b), supra). These models include mice, monkeys and cats. Even though these animals are not naturally susceptible to HIV disease, chimeric mice models (for example, SCID, bg/nu/xid, NOD/SCID, SCID-hu, immunocompetent SCID-hu, bone marrow-ablated BALB/c) reconstituted with human peripheral blood mononuclear cells (PBMCs), lymph nodes, fetal liver/thymus or other tissues can be infected with lentiviral vector or HIV, and employed as models for HIV pathogenesis. Similarly, the simian immune deficiency virus (SIV)/monkey model can be employed, as can the feline immune deficiency virus (FIV)/cat model. The pharmaceutical composition can contain other pharmaceuticals, in conjunction with a vector according to the invention, when used to therapeutically treat AIDS. These other pharmaceuticals can be used in their traditional fashion (i.e., as agents to treat HIV infection).
- According to another embodiment, the present invention provides an antibody-based pharmaceutical composition comprising an effective amount of an isolated antibody of the invention, or an affinity matured version, which provides a prophylactic or therapeutic treatment choice to reduce infection of the HIV virus. According to another embodiment, the present invention provides an antigen-based pharmaceutical composition comprising an effective amount of an isolated antigen of the invention, which provides a prophylactic or therapeutic treatment choice to reduce infection of the HIV virus. The pharmaceutical compositions of the present invention may be formulated by any number of strategies known in the art (e.g., see McGoff and Scher, 2000, Solution Formulation of Proteins/Peptides: In McNally, E. J., ed. Protein Formulation and Delivery. New York, N.Y.: Marcel Dekker; pp. 139-158; Akers and Defilippis, 2000, Peptides and Proteins as Parenteral Solutions. In: Pharmaceutical Formulation Development of Peptides and Proteins. Philadelphia, Pa.: Talyor and Francis; pp. 145-177; Akers, et al., 2002, Pharm. Biotechnol. 14:47-127). A pharmaceutically acceptable composition suitable for patient administration will contain an effective amount of the antibody in a formulation which both retains biological activity while also promoting maximal stability during storage within an acceptable temperature range. The pharmaceutical compositions can also include, depending on the formulation desired, pharmaceutically acceptable diluents, pharmaceutically acceptable carriers and/or pharmaceutically acceptable excipients, or any such vehicle commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination. Examples of such diluents are distilled water, physiological phosphate-buffered saline, Ringer's solutions, dextrose solution, and Hank's solution. The amount of an excipient that is useful in the pharmaceutical composition or formulation of this invention is an amount that serves to uniformly distribute the antibody throughout the composition so that it can be uniformly dispersed when it is to be delivered to a subject in need thereof. It may serve to dilute the antibody or antigen to a concentration which provides the desired beneficial palliative or curative results while at the same time minimizing any adverse side effects that might occur from too high a concentration. It may also have a preservative effect. Thus, for an active ingredient having a high physiological activity, more of the excipient will be employed. On the other hand, for any active ingredient(s) that exhibit a lower physiological activity, a lesser quantity of the excipient will be employed. Compositions comprising an antigen of the invention may further comprise one or more adjuvants.
- The above described antibodies and antibody compositions, comprising at least one or a combination of the antibodies described herein, can be administered for the prophylactic and therapeutic treatment of HIV viral infection.
- The above described antigens and antigen compositions, comprising at least one or a combination of the antigens described herein, can be administered for the prophylactic and therapeutic treatment of HIV viral infection.
- The present invention also provides kits useful in performing diagnostic and prognostic assays using the antibodies, polypeptides and nucleic acids of the present invention. Kits of the present invention include a suitable container comprising an HIV antibody, an antigen, a polypeptide or a nucleic acid of the invention in either labeled or unlabeled form. In addition, when the antibody, antigen, polypeptide or nucleic acid is supplied in a labeled form suitable for an indirect binding assay, the kit further includes reagents for performing the appropriate indirect assay. For example, the kit may include one or more suitable containers including enzyme substrates or derivatizing agents, depending on the nature of the label. Control samples and/or instructions may also be included. The present invention also provides kits for detecting the presence of the HIV antibodies or the nucleotide sequence of the HIV antibody of the present invention in a biological sample by PCR or mass spectrometry.
- “Label” as used herein refers to a detectable compound or composition that is conjugated directly or indirectly to the antibody so as to generate a “labeled” antibody. A label can also be conjugated to a polypeptide and/or a nucleic acid sequence disclosed herein. The label can be detectable by itself (for example, radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition that is detectable. Antibodies and polypeptides of the described invention also can be modified to include an epitope tag or label, for example, for use in purification or diagnostic applications. Suitable detection means include the use of labels such as, but not limited to, radionucleotides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
- Methods for reducing an increase in HIV virus titer, virus replication, virus proliferation or an amount of an HIV viral protein in a subject are further provided. According to another aspect, a method includes administering to the subject an amount of an HIV antibody of the invention effective to reduce an increase in HIV titer, virus replication or an amount of an HIV protein of one or more HIV strains or isolates in the subject. According to another aspect, a method includes administering to the subject an amount of an HIV antigen of the invention effective to reduce an increase in HIV titer, virus replication or an amount of an HIV protein of one or more HIV strains or isolates in the subject.
- According to another embodiment, the present invention provides a method of reducing viral replication or spread of HIV infection to additional host cells or tissues comprising contacting a mammalian cell with the antibody, or a portion thereof, which binds to the 8ANC195 antigenic epitope on gp120. According to another embodiment, the present invention provides a method of reducing viral replication or spread of HIV infection to additional host cells or tissues comprising contacting a mammalian cell with the antigen that mimics the 8ANC195 antigenic epitope on gp120.
- According to another embodiment, the present invention provides a method for treating a mammal infected with a virus infection, such as, for example, HIV, comprising administering to said mammal a pharmaceutical composition comprising the HIV antibodies disclosed herein. According to one embodiment, the method for treating a mammal infected with HIV comprises administering to said mammal a pharmaceutical composition that comprises an antibody of the present invention, or a fragment thereof. The compositions of the invention can include more than one antibody having the characteristics disclosed (for example, a plurality or pool of antibodies). It also can include other HIV neutralizing antibodies as are known in the art, for example, but not limited to, VRC01, PG9 and b12.
- Passive immunization has proven to be an effective and safe strategy for the prevention and treatment of viral diseases. (See, for example, Keller et al., Clin. Microbiol. Rev. 13:602-14 (2000); Casadevall, Nat. Biotechnol. 20:114 (2002); Shibata et al., Nat. Med. 5:204-10 (1999); and Igarashi et al., Nat. Med. 5:211-16 (1999). Passive immunization using human monoclonal antibodies provides an immediate treatment strategy for emergency prophylaxis and treatment of HIV.
- According to another embodiment, the present invention provides a method of inducing an HIV antigen-specific immune response in a mammal infected with HIV or at risk of infection with HIV comprising administering to the mammal a pharmaceutical composition comprising the antigen of the invention.
- According to another embodiment, the present invention provides a method of inducing an HIV antigen-specific immune response in a mammal infected with HIV or at risk of infection with HIV comprising administering to the mammal a pharmaceutical composition comprising a nucleic acid encoding the antigen of the invention.
- Subjects at risk for HIV-related diseases or disorders include patients who have come into contact with an infected person or who have been exposed to HIV in some other way. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of HIV-related disease or disorder, such that a disease or disorder is prevented or, alternatively, delayed in its progression.
- For in vivo treatment of human and non-human patients, the patient is administered or provided a pharmaceutical formulation including an HIV antibody or antigen of the invention. When used for in vivo therapy, the antibodies and antigens of the invention are administered to the patient in therapeutically effective amounts (i.e., amounts that eliminate or reduce the patient's viral burden). The antibodies or antigens are administered to a human patient, in accord with known methods, such as intravenous administration, for example, as a bolus or by continuous infusion over a period of time, by intramuscular, intraperitoneal, intracerobrospinal, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The antibodies can be administered parenterally, when possible, at the target cell site, or intravenously. In some embodiments, antibody is administered by intravenous or subcutaneous administration. Therapeutic compositions of the invention may be administered to a patient or subject systemically, parenterally, or locally. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- For parenteral administration, the antibodies or antigens may be formulated in a unit dosage injectable form (solution, suspension, emulsion) in association with a pharmaceutically acceptable, parenteral vehicle. Examples of such vehicles include, but are not limited, water, saline, Ringer's solution, dextrose solution, and 5% human serum albumin. Nonaqueous vehicles include, but are not limited to, fixed oils and ethyl oleate. Liposomes can be used as carriers. The vehicle may contain minor amounts of additives such as substances that enhance isotonicity and chemical stability, such as, for example, buffers and preservatives. The antibodies can be formulated in such vehicles at concentrations of about 1 mg/ml to 10 mg/ml.
- The dose and dosage regimen depends upon a variety of factors readily determined by a physician, such as the nature of the infection, for example, its therapeutic index, the patient, and the patient's history. Generally, a therapeutically effective amount of an antibody or antigen is administered to a patient. In some embodiments, the amount of antibody or antigen administered is in the range of about 0.1 mg/kg to about 50 mg/kg of patient body weight. Depending on the type and severity of the infection, about 0.1 mg/kg to about 50 mg/kg body weight (for example, about 0.1-15 mg/kg/dose) of antibody is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. The progress of this therapy is readily monitored by conventional methods and assays and based on criteria known to the physician or other persons of skill in the art. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- A dosage regimen for administration of an antigen to a patient may be a suitable immunization regimen, including for example at least three separate inoculations. The second inoculation may be administered more than at least two weeks after the first inoculation. The third inoculation may be administered at least several months after the second administration.
- Other therapeutic regimens may be combined with the administration of the HIV antibody or antigen of the present invention. The combined administration includes co-administration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities. Such combined therapy can result in a synergistic therapeutic effect. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- The terms “treating” or “treatment” or “alleviation” are used interchangeably and refer to both therapeutic treatment and prophylactic or preventative measures; wherein the object is to prevent or slow down (lessen) the targeted pathologic condition or disorder. Those in need of treatment include those already with the disorder as well as those prone to have the disorder or those in whom the disorder is to be prevented. A subject or mammal is successfully “treated” for an infection if, after receiving a therapeutic amount of an antibody or antigen according to the methods of the present invention, the patient shows observable and/or measurable reduction in or absence of one or more of the following: reduction in the number of infected cells or absence of the infected cells; reduction in the percent of total cells that are infected; and/or relief to some extent, one or more of the symptoms associated with the specific infection; reduced morbidity and mortality, and improvement in quality of life issues. The above parameters for assessing successful treatment and improvement in the disease are readily measurable by routine procedures familiar to a physician.
- The term “therapeutically effective amount” refers to an amount of an antibody or a drug effective to treat a disease or disorder in a subject or mammal.
- Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
- “Carriers” as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution. Examples of physiologically acceptable carriers include, but not limited to, buffers such as phosphate, citrate, and other organic acids; antioxidants including, but not limited to, ascorbic acid; low molecular weight (less than about 10 residues) polypeptide; proteins, such as, but not limited to, serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as, but not limited to, polyvinylpyrrolidone; amino acids such as, but not limited to, glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including, but not limited to, glucose, mannose, or dextrins; chelating agents such as, but not limited to, EDTA; sugar alcohols such as, but not limited to, mannitol or sorbitol; salt-forming counterions such as, but not limited to, sodium; and/or nonionic surfactants such as, but not limited to, TWEEN; polyethylene glycol (PEG), and PLURONICS.
- According to another embodiment, the present invention provides diagnostic methods. Diagnostic methods generally involve contacting a biological sample obtained from a patient, such as, for example, blood, serum, saliva, urine, sputum, a cell swab sample, or a tissue biopsy, with an HIV antibody and determining whether the antibody preferentially binds to the sample as compared to a control sample or predetermined cut-off value, thereby indicating the presence of the HIV virus.
- According to another embodiment, the present invention provides methods to detect the presence of the HIV antibodies of the present invention in a biological sample from a patient. Detection methods generally involve obtaining a biological sample from a patient, such as, for example, blood, serum, saliva, urine, sputum, a cell swab sample, or a tissue biopsy and isolating HIV antibodies or fragments thereof, or the nucleic acids that encode an HIV antibody, and assaying for the presence of an HIV antibody in the biological sample. Also, the present invention provides methods to detect the nucleotide sequence of an HIV antibody in a cell. The nucleotide sequence of an HIV antibody may also be detected using the primers disclosed herein. The presence of the HIV antibody in a biological sample from a patient may be determined utilizing known recombinant techniques and/or the use of a mass spectrometer.
- According to another embodiment, the present invention provides methods for detecting or isolating an HIV-1 binding antibody in a subject comprising obtaining a biological sample from the subject, contacting said sample with the antigen of the invention, and conducting an assay to detect or isolate an HIV-1 binding antibody.
- The term “assessing” includes any form of measurement, and includes determining if an element is present or not. The terms “determining”, “measuring”, “evaluating”, “assessing” and “assaying” are used interchangeably and include quantitative and qualitative determinations. Assessing may be relative or absolute. “Assessing the presence of” includes determining the amount of something present, and/or determining whether it is present or absent. As used herein, the terms “determining,” “measuring,” and “assessing,” and “assaying” are used interchangeably and include both quantitative and qualitative determinations.
- Where a value of ranges is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges which may independently be included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either both of those included limits are also included in the invention.
- This example describes materials and methods used in EXAMPLES 2-5 below.
- The antibodies used in this study were produced and purified as in previously-described studies (Diskin et al., Science 334, 1289 (2011).) Briefly, 8ANC195, 3BNC60 and chimeric antibody (mature HC/various LC; /κ combinations of newly isolated 8ANC195 variants) IgGs were expressed by transiently transfecting HEK293-6E cells with vectors containing the appropriate heavy and light chain genes. Secreted IgGs were purified from cell supernatants using protein A affinity chromatography (GE Healthcare). For neutralization assays, IgGs were diluted to 1 mg/mL stocks in 20 mM Tris pH 8.0, 150 mM sodium chloride (TBS buffer). 8ANC195 Fab was expressed with a 6×-His tag on the C-terminus of CH1 as described for IgGs and purified using Ni2+-NTA affinity chromatography (GE Healthcare) and
Superdex 200 16/60 size exclusion chromatography (GE Healthcare). - A truncated gp120 from the HIV-1 strain 93TH057 containing mutations Asn88Glngp120, Asn289Glngp120, Asn334Glngp120, Asn392Glngp120, Asn448Glngp120 was produced by transiently transfecting HEK293-S (GnTI−/−) cells adapted for growth in suspension by the Caltech Protein Expression Center with a pTT5 vector encoding His-tagged gp120. Secreted gp120 was captured on Ni2+-NTA resin (GE Healthcare) and further purified using
Superdex 200 16/60 size exclusion chromatography (GE Healthcare). -
Soluble CD4 domains 1 and 2 (sCD4) and sCD4K75T were produced as described previously (Diskin et al. NatStruct Mol Biol 17, 608 (2010)). Briefly, the pACgp67b vector encoding 6×-His-tagged sCD4 or sCD4K75T (residues 1-186 of mature CD4) was used to make infectious baculovirus particles using BaculoGold (BD Biosynthesis). Protein was expressed in Hi5 cells, captured on a Ni2+-NTA column (GE Healthcare) and further purified usingSuperdex 200 16/60 size exclusion chromatography (GE Healthcare). To remove an N-linked glycan introduced by mutation in sCD4K75T, the protein was treated with Endoglycosidase H (New England Biolabs) for 16 hours at 25° C. and then purified bySuperdex 200 16/60 size exclusion chromatography (GE Healthcare). - For complex crystallization trials, purified 8ANC195 Fab, 93TH057 gp120 and EndoH-treated sCD4K75T were incubated at a 1:1:1 molar ratio for 2 hours at 25° C. The complex was purified by
Superdex 200 10/300 size exclusion chromatography (GE Healthcare) and the peak corresponding to 8ANC195 Fab/gp120/sCD4K75T complex concentrated to 16 mg/mL in TBS buffer. For crystallization of 8ANC195 Fab alone, the protein was concentrated to 20 mg/mL in TBS buffer. - Purified BG505 SOSIP trimers (Julien et al.,
PLoS pathogens 9, e1003342 (2013); Lyumkis et al., Science 342, 1484 (2013); Sanders et al.,PLoS pathogens 9, e1003618 (2013)) for EM studies were the gift of Dr. John P. Moore (Weill Cornell Medical College). - Crystallization conditions were screened using vapor diffusion in sitting drops set using a Mosquito® crystallization robot (TTP labs) in a final volume of 200 nL per drop (1:1 protein to reservoir ratio) utilizing commercially available crystallization screens (Hampton Research, Microlytic). Initial crystallization hits for 8ANC195 Fab and for 8ANC195 Fab/93TH057 gp120/sCD4K75T complex were identified using the MCSG-1 (Microlytic) and PEGRx (Hampton) screens and then manually optimized. Crystals of 8ANC195 Fab (space group P41212, a=66.5 Å, b=66.5 Å, c=219.0 Å; one molecule per asymmetric unit) were obtained upon mixing a protein solution at 11 mg/mL with 0.1
M Hepes pH 7, 20% PEG 6,000, 10 mM zinc chloride at 20° C. Crystals were briefly soaked in mother liquor solution supplemented with 20% ethylene glycol before flash cooling in liquid nitrogen. Crystals of the 8ANC195 Fab/93TH057 gp120/sCD4K75T complex (space group P212121, a=66.5 Å, b=132.5 Å, c=142.8 Å; one molecule per asymmetric unit) were obtained upon mixing a protein solution at 16 mg/mL with 14% polyethylene glycol 3,350, 0.1 M HEPES pH 7.3, 2% benzamidine HCl at 20° C. Crystals were briefly soaked in mother liquor solution supplemented with 30% ethylene glycol before flash cooling in liquid nitrogen. - X-ray diffraction data for 8ANC195 Fab crystals were collected at the Argonne National Laboratory Advanced Photon Source (APS) beamline 23-ID-D using a
MAR 300 CCD detector. X-ray diffraction data for 8ANC195 Fab/93TH057 gp120/sCD4K75T complex crystals were collected at the Stanford Synchrotron Radiation Lightsource (SSRL) beamline 12-2 using a Pilatus 6M pixel detector (Dectris). The data were indexed, integrated and scaled using XDS (Kabsch, Acta Crystallogr D Biol Crystallogr 66, 133 (2010)). - The 8ANC195 Fab structure was solved by molecular replacement using Phenix (Adams et al., Acta Crystallogr D Biol Crystallogr 66, 213 (2010)) and the VHVL and CH1CL domains of NIH45-46 Fab (PDB code 3U7W) lacking all CDR loops as two separate search models. The model was then refined to 2.13 Å resolution using an iterative approach involving refinement and verification of model accuracy with simulated annealing composite omit maps using the Phenix crystallography package, and manually fitting models into electron density maps using Coot (Emsley et al., Acta Crystallogr
D Biol Crystallogr 60, 2126 (2004). The final model (Rwork=21.4%; Rfree=25.7%) includes 3,279 protein atoms and 127 water molecules as shown in Table 1. -
TABLE 1 8ANC195 Fab/ gp120/sCD4 complex 8ANC195 Fab Data collection Resolution range (Å) 39.22-3.0 (3.22-3.0) 29.73-2.1 (2.21-2.1) Space group P 21 21 21 P 41 21 2Cell dimensions a, b, c (Å) 66.53, 132.49, 142.77 66.48, 66.48, 219.03 α, β, γ (°) 90, 90, 90 90, 90, 90 Total reflections 229212 (12539) 239217 (24708) Unique reflections 36730 (3064) 28097 (2788) Multiplicity 6.2 (6.3) 8.4 (8.9) Completeness (%) 97.65 (99.80) 98.92 (91.00) Mean I/σ(I) 7.86 (2.1) 11.90 (3.16) Wilson B-factor 61.95 32.47 Rmerge 0.1747 (0.765) 0.1225 (0.5802) CC½ 0.996 (0.854) 0.996 (0.876) CC* 0.999 (0.960) 0.999 (0.966) Refinement Rwork/Rfree 0.2655/0.3149 0.2431/0.2772 Number of atoms 7272 3311 Protein 6881 3311 Ligands 391 0 Water 0 0 Protein residues 939 437 RMS (bonds) 0.023 0.008 RMS (angles) 1.33 1.17 Clashscore 22.78 12.43 Average B-factor 81.5 36.5 Protein 81 36.5 Ligands 89 — Water — — Statistics for the highest-resoluton shell are shown in parentheses. - 96.75%, 2.78% and 0.0% of the residues were in the favored, allowed and disallowed regions, respectively, of the Ramachandran plot. Disordered residues that were not included in the model include residues 146-153, 233-238 and the 6×-His tag of the 8ANC195 heavy chain, and residues 214-215 of the light chain.
- The 8ANC195 Fab/93TH057 gp120/sCD4K75T complex structure was solved by molecular replacement using Phaser (Adams et al., Acta Crystallogr D Biol Crystallogr 66, 213 (2010)) and the VHVL and CH1CL domains of 8ANC195 (lacking all CDR loops), 93TH057 gp120 (taken from PDB code 3U7Y), and sCD4 (taken from PDB code 3LQA) as separate search models. The complex structure was refined to 3.0 Å resolution as described for the Fab structure. In addition to considering l/σl and completeness of the highest resolution shell (2.1% and 99.9%, respectively), CC1/2 statistic (Karplus et al., Science 336, 1030 (2012)) (correlation coefficient between two random halves of the data set where CC1/2>10%) was used to determine the high-resolution cutoff for the data. Phenix was used to compute CC1/2 (85.4% for the highest resolution shell and 99.8% for the entire data set), supporting our high-resolution cutoff determination.
- The final model (Rwork=23.4%; Rfree 28.6%) includes x protein atoms and y atoms of carbohydrates (Table SI). 96.2%, 3.8% and 0.0% of the residues were in the favored, allowed and disallowed regions, respectively, of the Ramachandran plot. Disordered residues that were not included in the model include residues 146-153, 206-208, 233-238 and the 6×-His tag of the 8ANC195 heavy chain, residues 213-215 of the light chain, residues 125-197 (V1/V2 substitution), 302-324 (V3 substitution), residues 397-409 (a total of 6 residues from V4), residues 492-494 and the 6×-His tag of 93TH057 gp120 and residues 106-111, 154-155, 177-186 of sCD4K75T.
- Buried surface areas were calculated using PDBePISA (Krissinel et al., Journal of molecular biology 372, 774 (2007)) and a 1.4 Å probe. Superimposition calculations were done and molecular representations were generated using PyMol (Schrödinger (The PyMOL Molecular Graphics System, 2011). Pairwise Ca alignments were performed using PDBeFold (Krissinel et al., Acta Crystallogr
D Biol Crystallogr 60, 2256 (2004)). - High-binding 96-well ELISA plates (Costar) were coated overnight with 5 μg/well of purified gp120 in 100 mM sodium carbonate pH 9.6. After washing with TBS containing 0.05
% Tween 20, the plates were blocked for 2 h with 1% BSA, 0.05% Tween-TBS (blocking buffer) and then incubated for 2 h with 8ANC195 IgG (1 μg/mL) mixed with 1:2 serially diluted solutions of potential antibody competitors (sCD4, J3 VHH, 3BNC60 Fab, NIH45-46 Fab) in blocking buffer (competitor concentration range from 5 to 320 μg/mL). After washing with TBS containing 0.05% Tween 20, the plates were incubated with HRP-conjugated goat anti-human IgG antibodies (Jackson ImmunoReseach) (at 0.8 μg/ml in blocking buffer) for 1 hour. The ELISAs were developed by addition of HRP chromogenic substrate (TMB solution, BioLegend) and the color development stopped by addition of 10% sulfuric acid. Experiments were performed in duplicate. - Experiments were performed using a Biacore T100 (Biacore) using a standard single-cycle kinetics method. YU-2 and 93TH057 gp120 proteins were primary amine-coupled on CMS chips (Biacore) at a coupling density of 1,000 RUs and one flow cell was mock coupled using HBS-EP+ buffer. 8ANC195 and chimeric IgGs were injected over flow cells at increasing concentrations (62.5 to 1,000 nM), at flow rates of 20 μl/min with 5 consecutive cycles of 2 min association/1 min dissociation and a final 10 min dissociation phase. Flow cells were regenerated with 3 pulses of 10 mM glycine pH 2.5. Apparent binding constants (KD (M)) were calculated from single-cycle kinetic analyses after subtraction of backgrounds using a 1:1 binding model without a bulk reflective index (RI) correction (Biacore T100 Evaluation software). Binding constants for bivalent IgGs are referred to as “apparent” affinities to emphasize that the KD values include potential avidity effects.
- A TZM-bl/pseudovirus neutralization assay was used to evaluate the neutralization potencies of the antibodies as described (Montefiori, Current protocols in immunology edited by John E. Coligan et al.,
Chapter 12,Unit 12 11 (2005)). Pseudoviruses were generated by cotransfection of HEK 293T cells with an Env expression plasmid and a replication-defective backbone plasmid. Neutralization was determined by measuring the reduction in luciferase reporter gene expression in the presence of antibody following a single round of pseudovirus infection in TZM-bl cells. Nonlinear regression analysis was used to calculate the concentrations at which half-maximal inhibition was observed (IC50 values). - The BG505 SOSIP.664/8ANC195 Fab complex and grids were prepared as described previously (Kong et al., Nat
Struct Mol Biol 20, 796 (2013). The data were collected on an FEI Tecnai T12 electron microscope coupled with a Tietz TemCam-F416 4 k×4 k CMOS camera using the LEGINON interface. Images were collected in 10° increments from 0° to −40° using a defocus range of 0.6-0.9 μm at a magnification of 52,000×, resulting in a pixel size of 2.05 Å at the specimen plane. Particles were selected using DogPicker (Voss et al., Journal of structural biology 166, 205 (2009)) within the Appion software package (Lander et al., Journal of structural biology 166, 95 (2009)), and sorted from reference-free 2D class averages using the SPARX package (Penczek et al.,Ultramicroscopy 40, 33 (1992). An initial model was generated by common lines from class averages using the EMAN2 package (Tang et al., Journal of structural biology 157, 38 (2007) and was refined using 11,637 unbinned particles. The refinement was carried out using the SPARX package (Penczek et al.,Ultramicroscopy 53, 251 (1994)) with C3 symmetry applied. The resulting resolution at a 0.5 Fourier Shell Correlation (FSC) cut-off was 18.7 Å (FIGS. 6A ,B). - Human samples were collected after signed informed consent in accordance with Institutional Review Board (IRB)-reviewed protocols by all participating institutions.
Patient 8 was selected from a cohort of elite controllers that were followed at the Ragon Institute in Boston. - Single Cell clonal variants of 8ANC195 were isolated by 2CC core-specific single cell sorting, followed by reverse transcription and immunoglobulin gene amplification as described previously (Scheid et al., Science 333, 1633 (2011)). Immunoglobulin genes were cloned into heavy and light chain expression vectors and co-transfected for IgG production as described previously (Tiller et al., Journal of immunological methods 329, 112 (2008)).
- IgG+CD19+ memory B cells were bulk sorted on a FACS AriaIII cell sorter. Bulk mRNA was extracted using TRIzol (Invitrogen) and reverse transcribed as previously described (Scheid et al., Science 333, 1633 (2011)). 8ANC195-related heavy and light chain genes were PCR amplified using the following clone-specific primers:
-
For heavy chain amplification: (SEQ ID NO: 50) 5′ GGTGTACATTCTCAGATACACCTCGTACAA 3′and (SEQ ID NO: 51) 5′ CAGGTGTCCAGTCTCAGATACA 3′as forward primers and (SEQ ID NO: 57) 5′ GCGGAGACGGAGATGAGGGTT 3′as a reverse primer. For light chain amplification: (SEQ ID NO: 52) 5′ GACATCCAGATGACCCAGTCTCCTTCCA CCCTGTCTGCATCTATAGGT 3′ and (SEQ ID NO: 53) 5′ GACATCCAGATGACCCAGTCTCCTTCCA CCCTGTCTGCATCT 3′ as forward and (SEQ ID NO: 58) 5′ GTTTCACCTCAACTTTAGTCCCTT 3′as well as (SEQ ID NO: 59) 5′ GTTTCACCTCAACTTTAGTCCCTTGGCCGAAGGTC 3′as reverse primers. - Amplification products were gel purified and cloned into TOPO TA sequencing vectors (Invitrogen) and expression vectors as described previously (T. Tiller et al., Journal of immunological methods 329, 112 (2008)).
- Phylogenetic trees were assembled using Geneious Neighbor-Joining Tree Software. Sequence Alignments were performed using DNA Star Clustal W alignment software.
- The program AntibodyDatabase (West, Jr. et al., Proceedings of the National Academy of Sciences of the United States of
America 110, 10598 (2013)) was used to analyze 8ANC195 neutralization panel data from Scheid et al., Science 333, 1633 (2011) and Chuang et al., Journal of virology 87, 10047 (2013). This method attempts to model the variation in neutralization potency across strains based on a sum of terms (“rules”) corresponding to specific residues or potential N-linked glycosylation site (PNGS) positions. With the free residual option deselected, the analysis finds a rule corresponding to ˜3-fold better 8ANC195 neutralization for strains with Glu632gp41. This correlation appears to hold across clades based on neutralization data for strains having the most favorable glycosylation pattern (PNGS at 234gp120 and 276gp120, and not at 230gp120) (22). For all clades, the residue at 632gp41 versus geometric mean IC50s for 8ANC195 on strains with the most favorable glycosylation pattern was as follows: Glu, 0.43 μg/mL (n=53) versus Asp, 1.31 μg/mL (n=51). For separate clades, the correlations were Clade A: Glu, 0.47 μg/mL (n=3); Asp, 1.30 μg/mL (n=24); Clade B: Glu, 0.18 μg/mL (n=15); Asp, 0.72 μg/mL (n=6); Clade C: Glu, 0.32 μg/mL (n=2); Asp, 1.31 μg/mL (n=20). - IC50 values derived from neutralization assays with 8ANC195 and its 52HC/κ5LC variant against 11 sensitive virus strains (IC50<50) were analyzed by G-test for the relationship between the amino acid identity at
position 636gp41 and the antibody IC50. For each antibody the partition between “high” and “low” IC50s was chosen such that approximately half of the strains had high IC50s (0.8 μg/mL for 8ANC195, 0.1 μg/mL for 52HC/κ5LC. - Determination of the Crystal Structure of the Fab Fragment of 8ANC195 Alone and Complexed with HIV-1 gp120 Core and CD4 Domains 1-2 (sCD4)
- To determine the epitope recognized by 8ANC195 and investigate its neutralization mechanism, crystal structures were solved of the Fab fragment of 8ANC195 alone and complexed with an HIV-1 clade A/E 93TH057 gp120 core and CD4 domains 1-2 (sCD4) at 1.9 Å and 2.9 Å resolution, respectively (
FIG. 16A ,B; Table 1). Five PNGSs on the core gp120 were removed by mutation (Asn88Glngp120, Asn289Glngp120, Asn334Glngp120, Asn392Gln Asn448Glngp120) to reduce glycan heterogeneity. - Comparison of 8ANC195 Fab in its free versus gp120-bound states revealed high structural similarity (RMSD=0.7 Å for 236 Ca atoms of VH-VL) except for a 3.5 Å displacement of the loop connecting strands D and E in HC FWR3 (
FIG. 16A ). The CDRH1 and CDRH3 loops were folded into hook-like tertiary structures in free and gp120-bound Fabs; therefore the conformations were not induced upon binding to gp120 (FIG. 16A andFIGS. 2A ,B). The CDRH3 architecture differed from CDRH3s in other antibodies including anti-HIV-1 antibodies with long CDR loops (FIG. 2C ). The CDRH1 loop conformation was stabilized by a hydrogen bond network among backbone atoms of CDRH1, burial of Phe30HC, and hydrogen bonds with Asp73HC and Thr104HC (FIG. 2A ). CDRH3 had a complex tertiary structure in which residues 102HC-110HC formed a loop protruding ˜10 Å from the antibody surface, and residues 111HC-118HC formed a (3-sheet subdomain that was stabilized by hydrophobic stacking between His113HC and Trp33LC and a hydrogen bond between Met117HC and Gln90LC (FIG. 2B ). The side chain of Tyr92LC hydrogen bonded with the Gly110HC carbonyl oxygen, stabilizing a kink in the loop that formed the transition between these secondary structure elements (FIG. 2B ). - The complex structure showed independent binding of sCD4 and 8ANC195 Fab to distinct sites on gp120 (
FIG. 16B ). sCD4 interacted with the gp120 core as in other sCD4-gp120 structures (Kwong et al., Nature 393, 648 (1998)) (FIG. 3A ), thus its binding was not altered by the presence of the adjacent antibody, consistent with binding and neutralization experiments showing no effects of CD4 addition on 8ANC195 activity (FIG. 3B ,C). sCD4 did, however, contribute to crystal packing (FIG. 3D ), rationalizing why diffraction-quality crystals failed to grow in its absence. In the ternary complex structure, 8ANC195 bound to a gp120 region adjacent to the CD4 binding site, contacting mainly the gp120 inner domain, loops D and V5, and a small patch of the gp120 outer domain (His352gp120-Asn354gp120) (FIG. 16B ,C). - 8ANC195 Fab bound gp120 core exclusively with its HC, using residues in FWRs and its three CDR loops to form an extensive interface (3,671 Å2 total buried surface area; 1287 Å2 HC-gp120 protein contacts; 2,384 Å2 HC-gp120 glycan contacts) (
FIG. 16B, 2 ,FIG. 4 ; Table 2). -
TABLE 2 Buried Surface Area (BSA) at interfaces Hydrogen Bonds at Interfaces gp120 BSA (Å2) 8ANC195 HC BSA (Å2) gp120 8ANC195 HC Distance (Å) VAL 44 19.4 ASN 28 28.6 THR 278 Oγ1 THR 75 O 2.43 TRP 45 17.4 THR 29 22.9 ARG 456 NH2 GLY 76 O 3.37 LYS 46 35.1 GLY 31 26.3 ASN 354 Nδ2 SER 77 Oγ 2.88 ASP 47 39.7 LEU 32 56.0 THR 278 Oγ1 SER 78 O 3.34 THR 95 39.1 ARG 54 54.5 ASN 92 Nδ2 THR 104 O 2.88 GLU 91 5.7 TRP 55 4.2 ASN 92 Nδ2 TYR 105 O 3.08 ASN 92 87.3 LYS 56 4.4 HIS 352 O THR 75 Oγ1 3.14 PHE 93 9.0 LEU 74 65.7 ASN 354 Oδ1 THR 75 Oγ1 3.08 ASN 94 38.0 THR 75 44.3 ASP 47 Oδ2 TYR 105 OH 3.09 LYS 97 7.2 GLY 76 81.0 LYS 487 Nζ TYR 105 OH 3.49 THR 236 27.7 SER 77 33.9 GLY 237 21.1 SER 78 5.5 PRO 238 51.6 PRO 79 3.9 LYS 240 4.1 THR 104 11.7 SER 274 0.2 TYR 105 100.2 GLU 275 7.0 ASP 106 16.8 ASN 276 15.9 LYS 107 24.0 LEU 277 37.8 TRP 108 70.3 THR 278 69.6 Total 8ANC195 HC 653.9 HIS 352 17.0 PHE 353 10.0 ASN 354 48.1 LYS 357 3.5 ARG 456 13.8 THR 463 0.2 GLU 466 0.1 LYS 487 6.0 Total gp120 633.4 gp120 BSA (Å2) 8ANC195 NC BSA (Å2) gly276 NAG1 121.2 TYR 25 12.8 GLY 26 36.7 VAL 27 6.5 ASN 28 15.3 LEU 74 21.2 PRO 79 4.2 gly276 NAG2 100.5 GLN 1 18.8 HIS 3 8.0 TYR 25 40.8 GLY 26 12.8 gly276 BMA3 65.5 HIS 3 35.3 VAL 5 6.5 TYR 25 19.4 gly275 MAN4 66.5 GLN 1 14.9 ILE 2 1.6 HIS 3 40.0 gly276 MAN5 45.2 VAL 5 18.4 TYR 25 18.7 Total gly276 398.8 Total 8ANC195 HC 331.8 Buried Surface Area (BSA) at interfaces Hydrogen Bonds at Interfaces gp120 BSA (Å2) 8ANC195 HC BSA (Å2) gp120 8ANC195 HC Distance (Å) gly234 NAG1 108.4 ASN 28 1.5 gly234 NAG1 O4 TRP 55 Nϵ1 2.99 THR 29 9.8 gly234 NAG1 O3 ASP 73 Oδ2 3.80 TRP 55 24.9 gly234 NAG2 O6 ASP 73 N 3.13 ASP 73 29.7 gly234 MAN5 O6 VAL 72 N 2.76 LEU 74 16.8 gly234 MAN5 O6 ILE 81 O 2.64 gly234 NAG2 128.4 ARG 54 1.0 gly234 MAN5 O3 GLU 85 Oϵ2 3.17 TRP 55 53.4 gly234 MAN5 O4 GLU 85 Oϵ2 2.34 ALA 71 2 8 gly234 MAN10 O3 ALA 59 N 3.50 VAL 72 11.6 gly234 MAN10 O2 ALA 59 N 3.03 ASP 73 13.1 gly234 MAN10 O6 VAL 67 O 3.17 gly234 BMA3 100.6 ILE 52 9.5 gly234 MAN10 O6 GLY 65 N 2.58 TRP 55 24.5 gly234 MAN10 O2 SER 58 O 3.28 LYS 56 0.2 gly234 MAN10 O2 SEP 58 N 3.19 SEP 57 3.4 gly234 MAN10 O3 SER 57 O 2.79 ILE 69 0.8 SEP 70 10.5 ALA 71 11.4 VAL 72 10.5 gly234 MAN4 55.2 SER 70 8.8 ALA 71 5.2 VAL 72 31.0 gly234 MAN5 129.8 SEP 70 11.9 ALA 71 1.6 VAL 72 18.1 ILE 81 18.5 SER 83 18.6 gly234 MAN6 118.4 THR 19 16.7 LEU 68 24.3 SER 70 8.9 SER 83 7.6 GLU 85 25.7 gly234 MAN7 84.2 ILE 52 3.3 TRP 55 13.4 LYS 56 1.8 SER 57 20.2 LEU 88 18.2 ILE 69 3.6 SER 70 2 1 gly234 MAN8 68.3 SER 57 30.2 SEP 58 0.2 VAL 67 2.6 LEU 68 24.4 ILE 89 1.2 g1y234 MAN10 198.7 SEP 57 20.9 SER 58 11.0 ALA 59 21.8 ARG 64 14.3 GLY 6.5 14.2 VAL 67 13.3 LEU 68 10.9 ILE 69 3.5 Total gly234 992.0 Total 8ANC195 HC 661.2 - A loop in FWR3HC, consisting of somatically-mutated residues and extended by a four-residue insertion, reached like a thumb into the pocket formed by loops D, V5 and outer domain residues 352gp120-358gp120 (
FIGS. 16A ,B and 17A,FIG. 4B ). CDRH1 and CDRH3 contacted the gp120 inner domain (FIG. 16B ,FIG. 4B ), contributing to a 1287 Å2 interface between the 8ANC195 HC and gp120 protein residues. The CDRH1 and CDRH3 loop conformations, conserved in the free Fab (FIG. 16A ,FIG. 2A ,B), were necessary for binding gp120 since extending these loops would result in clashes with gp120. The resulting antibody combining site was exquisitely suited to contacting portions of the inner domain of gp120 not targeted by other bNAbs (FIG. 16C ). - The 8ANC195 Fab also made extensive interfaces with glycans attached to Asn234gp120 (buried surface area=1,653 Å2) and Asn276gp120 (buried surface area=731 Å2), rationalizing its dependence on these PNGSs for neutralization (West, Jr. et al., Proceedings of the National Academy of Sciences of the United States of
America 110, 10598 (2013); Chuang et al., Journal of virology 87, 10047 (2013)). Together with CDRH2, somatically-mutated FWR residues in strands B, C″, D and E contributed to an extensive interface with the Asn234gp120-associated N-glycan (usually high mannose in native HIV-1 Envs (Go et al., Journal of virology 85, 8270 (2011) that involved 10 sugar moieties, including specific interactions with terminal mannose residues (FIG. 17C ,E,FIG. 4C ,D). A two-residue deletion at the CDRH2-FWR3HC boundary compared to the germline sequence permitted these interactions, since the longer loop would clash with inner domain residue Asn234gp120 and its neighbors. The Asn276gp120 glycan (a complex-type N-glycan in native HIV-1 Envs (Go et al., Journal of virology 85, 8270 (2011); Binley et al., Journal of virology 84, 5637 (2010)), but high mannose in the crystallized gp120) was wedged between 8ANC195 and sCD4, where it contacted FWR residues in strands A and B and the N-terminal portion of CDRH1, forming an interface involving only the core pentasaccharide common to both high mannose and complex-type N-glycans (FIG. 17D ,FIG. 4E ,F). - The 8ANC195 HC was bracketed by the Asn234gp120 and Asn276gp120 glycans in a manner analogous to interactions of HIV-1 antibodies that penetrate the Env glycan shield, such as PG16 (interactions with Asn156gp120/Asn173gp120 and Asn160gp120 glycans) (Pancera et al., Nature structural &
molecular biology 20, 804 (2013), PGT128 (with Asn301gp120 and Asn332gp120 glycans) (Pejchal et al., Science 334, 1097 (2011)) and PGT121 (with Asn137gp120 and Asn332gp120 glycans) (Mouquet et al., Proceedings of the National Academy of Sciences of the United States of America 109, E3268 (2012); Julien et al., Science 342, 1477 (2013) Julien et al.,PLoS pathogens 9, e1003342 (2013)) (FIG. 5 ). However, in contrast to these antibodies, 8ANC195 contacts with gp120 were made exclusively by its HC; indeed, 33% of 8ANC195 VH domain residues not buried at the LC interface contacted gp120. In summary, the 8ANC195-gp120 structure demonstrated that 8ANC195 recognizes a novel epitope involving the Asn234gp120 and Asn276gp120 glycans, the gp120 inner domain, loop D and loop V5, which would be adjacent to gp41 in Env trimer (Julien et al., Science 342, 1477 (2013); Lyumkis et al., Science 342, 1484 (2013)). - To investigate portions of the 8ANC195 epitope beyond the gp120 core, including potential contacts with gp41, negative stain single particle EM was used to determine the structure of 8ANC195 Fab bound to a soluble HIV-1 SOSIP trimer derived from strain BG505 (
FIG. 6 ) (Julien et al., Science 342, 1477 (2013); Lyumkis et al., Science 342, 1484 (2013); Sanders et al.,PLoS pathogens 9, e1003618 (2013)). Independent docking of the BG505 Env trimer structure (PDB 4NCO) (Julien et al., Science 342, 1477 (2013)) and 8ANC195 Fab resulted in a model wherein the Fab contacted both gp120 and gp41 within a single protomer (FIG. 18A ,FIG. 7 ). The EM model placed the CDRL1, CDRL2, and portions of FWR3LC and CDRH3 in close proximity to the HR2 helix of gp41 (FIG. 18B ). Although gp41 residues were not definitively identified in the trimer crystal structure (Julien et al., Science 342, 1477 (2013)), based on the assignment of the HR2 C-terminus as Gly664gp41 (Lyumkis et al., Science 342, 1484 (2013), the kink in the HR2 helix was assigned as Asn637gp41 (FIG. 18B ,FIG. 8 ), the asparagine of a highly conserved PNGS. The EM model predicted that the Asn637gp41-linked glycan and adjacent amino acid residues on HR2 interacted with 8ANC195 CDRH3, CDRL1 and CDRL2. - Docking of the gp120-8ANC195 portion of the ternary crystal structure onto the SOSIP trimer structure resulted in a slightly different angular placement of the Fab in the EM density than when the 8ANC195 Fab was fit independently (
FIG. 18A ,FIG. 7 ). The Fab, especially the LC, was pushed further away from gp41 by comparison to the placement suggested by the complex crystal structure. The LC position in the EM model was more likely to be accurate since it left space for bulky side chains at positions 625gp41-640gp41 that were modeled as alanines in the trimer crystal structure (Julien et al., Science 342, 1477 (2013); Lyumkis et al., Science 342, 1484 (2013)). The slightly different placements could be due to crystal packing effects, spatial restraints imposed by the gp41 glycans that were not present in the 8ANC195-gp120 complex, removal of the PNGS at Asn88gp120 in the gp120 core, which may have allowed for a closer association of 8ANC195 and gp120 in the crystal structure, and/or a small conformational change in the gp120 region of the trimer to accommodate the Fab orientation trapped by crystallization. - The EM reconstruction highlighted a potential role for 8ANC195 LC contacts to gp41. To assess LC contacts with trimeric Env, chimeras consisting of the 8ANC195 HC paired with different Lcs were tested in neutralization and binding assays. The chimeras included a full germline LC, a mature LC with individual CDR loops reverted to their germline sequences or CDRL3 partially mutated to alanines, or the LC from the CD4 binding site antibody 3BNC117 (
FIG. 19A ). As expected from the crystal structure in which all gp120 contacts were made by the 8ANC195 HC, the chimeras bound normally to gp120 core and to a full-length 93TH057 gp120 (FIG. 19B , table 3), thus changes in the LC did not disrupt the HC portion of the antibody combining site. -
TABLE 3 Kp (nM) IC50 (pg/mL) 93TH057 YU2 5C422 Antibody gp120 Gp120 YU2 Tro11 SF162 6535_3 6618 PV04 REJ04541 RHPA4259 8ANC195 IgG 33.1 82.0 0.4 0.31 0.30 0.43 0.69 0.52 0.248 0.17 8ANC195 38.0 56.1 6.76 >100 12.9 8.9 8.1 11.5 11.2 14.6 mHC/GILC 8ANC195 38.0 105.4 55 >100 65 24 97 >100 62.4 0.96 gICDRL1 8ANC195 40.5 119.5 6.26 18.9 44 13.3 69 97 82.9 0.82 gICDRL2 8ANC195 44.4 107.1 0.79 0.75 0.85 1.08 1.29 3.1 1.045 0.97 gICDRL3 8ANC195 ND ND 39 ND >100 >100 >100 >100 >100 0.81 CDRL3Ala 8ANC195HC/ ND ND 4.77 5.33 5.6 >100 22 ND 10.9 4.52 3BNC117LC 3BNC60 ND ND 0.027 0.04 0.05 0.335 0.07 0.06 0.063 0.02 - In contrast to gp120 binding, neutralization potencies assayed against native Env spike trimers were decreased by changes in the 8ANC195 LC. For example, reverting CDRL1 and CDRL2 sequences to germline precursor sequences (changing 3 of 7 and 3 of 3 residues, respectively) almost completely abrogated neutralization of YU2, an 8ANC195-sensitive strain. Changes to CDRL3 led to a moderate reduction in neutralization potency, as did substituting the 3BNC117 LC for the cognate LC (
FIG. 19B , table 3). A chimeric IgG with one of the most conservatively-substituted LCs (Thr-Gly-Asn, mature CDRL1 containing a one-residue insertion, reverted to Ser-Ser, germline CDRL1) displayed unchanged binding to gp120, yet showed reductions in neutralization potency of up to 250-fold. Similarly, conservative changes in CDRL2 (Arg-Gly-Ala, the mature CDRL2, reverted to the germline Lys-Ala-Ser sequence) caused large reductions in neutralization potencies but had little effect on gp120 binding. Overall the data showed differential sensitivities of the binding and neutralization assays to changes in the 8ANC195 LC that were distant from the gp120 surface, which supported the EM results suggesting that LC, and CDRL1 and CDRL2 in particular, contacted gp41. - To further investigate Env recognition by 8ANC195, additional members of this antibody clone were isolated from the original donor by single cell sorting using gp120 stabilized in the CD4-bound conformation (2CC core) as bait (
FIG. 9 ). From 1536 single 2CC core-binding B cells, 10 (0.7%) were clonally related to 8ANC195, and of these, only four differed slightly from the two previously-described members (1 to 3 and 1 to 7 residue differences in the HCs and LCs, respectively) (FIG. 10 ). Consistent with the limited sequence diversity, these antibodies exhibited similar potencies to 8ANC195 in neutralization assays against a panel of 15Tier 2 viruses (FIG. 9C and Table 4). -
TABLE 4 Virus 8ANC3040 8ANC3484 8ANC3630 8ANC3044 8ANC 430 8ANG195 REJ04541.67 0.198 0.117 2.652 0.278 0.198 0.08 PVO.4 0.284 0.077 0.102 0.260 0.206 0.52 YU2.DG 0.617 0.461 0.468 0.747 0.545 0.79 3415.v1.c1 3.059 0.589 27.977 7.557 >23 2.404 3365.v2.c20 >25 >30 >30 >30 >23 >30 ZW153M.PB12 14.910 11.581 >30 15.164 >23 9.626 Z.M109F.PB4 NT >30 >30 >30 >23 >30 3016.v5.c45 0.427 0.131 0.136 0.242 0.271 0.195 231965.c1 1.174 0.294 0.375 1.332 1.190 0.514 X1254_c3 2.909 2.192 2.377 4.538 4.284 1.524 251-18 0.571 0.391 0.730 0.858 6.170 0.284 R1166.c1 2.370 1.027 1.453 2.381 3.642 0.986 H086.8 NT 0.394 0.300 3.830 >23 0.095 Du172.17 NT 4.011 >30 >30 >23 10.797 250-4 NT >30 >30 >30 >23 >50 MuLV >30 >30 >30 >30 >23 >23 - Reasoning that the 2CC core bait might fail to capture some 8ANC195 family members, clone-specific primers were used to amplify 8ANC195 variants from purified populations of CD19+ IgG+ memory B cells (
FIG. 11 ). 128 HC and 100 LC sequences were obtained that were clonally related to 8ANC195 and displayed greater sequence diversity than antibodies obtained using antigen-specific selection (FIGS. 10, 12 ). Of the 13 HC and 6 LC genes exhibiting greatest diversity, all combinations were co-transfected in order to evaluate their neutralizing activity against a 15-member Tier 2 virus panel. 3 of 39 (7.7%) new antibodies were at least as broad and potent as 8ANC195 (FIG. 19C and Table 5). -
TABLE 5 γ3 γ4 γ8 γ15 γ20 γ22 γ23 γ44 γ46 γ52 γ59 Virus γ3κ3 γ4κ3 γ8κ3 y15κ3 γ20κ3 γ22κ3 γ52κ3 γ59κ3 REJ045451.67 0.260 >15 >15 >15 >15 >15 >15 8.543 PVO.4 0.170 >15 >15 5.316 >15 >15 1.918 >15 YU2.DG 0.420 >15 5.418 1.068 >15 >15 5.751 8.970 34>15.v1.c1 >15 >15 >15 >15 >15 >15 >15 >15 3365.v2.c20 >15 >15 >35 >15 >15 >15 >15 >15 ZM53M.PB12 >15 >15 >15 >15 >15 >15 >15 >15 ZM189F.PB4 >15 >15 >15 >15 >15 >15 >15 >15 31316.v5.c45 0.347 >15 2.383 1.265 >15 >15 3.050 >15 231965.c1 0.727 >15 3.477 1.611 >15 >15 6.594 >15 X1254_c3 1.822 18.047 4.609 3.487 14.702 >15 >15 3.392 251-18 >15 >15 >15 >15 215 >15 14.537 >15 R1166.c1 2.208 >15 7.596 3.943 >15 >15 23.408 24.226 H086.8 3.307 >15 >15 >15 >15 >15 >15 >15 Du172.17 >15 >15 >15 >15 >15 >15 >15 >15 250-4 >15 >15 >15 >15 >15 >15 >15 >15 MuLV >30 NT >13 >30 >21 NT >30 >30 Virus γ3κ5 γ22κ5 γ23κ5 γ46κ5 γ52κ5 γ59κ5 REJO4541.67 0.097 0.795 0.091 0.196 0.035 4.669 PVO.4 0.081 0.352 0.043 0.129 0.018 >15 YU2. DG 0.200 0.569 0.135 0.259 0.065 7.279 34 >15.v1.c1 >15 >15 1.479 >15 0.120 >15 3365.v2.C.20 >15 >15 >16 >15 >15 >15 ZM53M.PB12 >15 >15 5.676 12.482 3.134 24.057 ZM109F.PB4 >15 >15 >15 >15 >15 >15 3016.v5.c45 0.314 0.103 0.091 0.111 0.017 >15 231965.cl 0.697 0.680 0.291 0.526 0.094 >15 X1254_c3 1.717 1.521 0.919 1.792 0.584 9.416 251-18 0.721 1.696 0.176 0.609 0.048 6.969 R1166.c1 2.074 2.395 1 075 0.922 0.319 28.201 H086.8 0.434 >15 0.474 1.750 0.175 >15 Du172.11 3.728 >15 1.814 >15 NT >15 250-4 >15 >15 >15 >15 >15 >15 MuLV >15 >30 >30 NT NT >30 Virus γ3κ11 γ8κ11 γ15κ11 γ20κ11 γ22κ11 γ23κ11 γ44κ11 γ46κ11 γ52κ11 γ59κ11 R8304541.67 0.091 >15 >15 >15 >15 0.140 >15 >15 3.473 1.572 PVO.4 0.074 8.153 5.704 >15 >15 0.103 >15 2.921 0.103 >15 YU2 00 0.276 9.349 4.122 >15 >15 0.340 >15 2.101 0.298 6.911 34>15.v1.cl >15 >15 >15 >15 >15 >15 >15 >15 >15 >15 3365.v2.c20 >15 >15 >15 >15 >15 >15 >15 >15 >16 >15 ZM53M.PB12 >15 >15 >15 >15 >15 >15 >15 >15 >15 >15 ZM109F.PB4 >15 >15 >15 >15 >15 >15 >35 >15 >15 >15 3016.v5.c45 0.143 2.463 1.325 >15 >15 0.159 >15 1.932 0.161 >15 231965.c1 0.455 2.490 5.103 >15 >15 0.543 >15 2.958 0.296 >15 X1254_c3 2.306 4.144 13.687 7.583 >15 1.695 >15 5.662 2.419 4.669 251-18 >15 >15 >15 >15 >15 2.490 >15 >15 0.647 >15 R1166.c1 1.792 3.883 9.813 20.237 >15 1.611 >15 3.390 1.159 12.580 H086.8 0.778 >15 >15 >15 >15 >15 >15 >15 1.638 >15 Du172.17 >15 >15 >15 >15 >15 11.298 >15 >15 >15 >15 250-4 >15 >15 >15 >15 >15 >15 >15 >15 >15 >15 MuLV >30 NT >30 >30 >30 >30 >19 >30 >30 >30 Virus γ3κ18 γ4κ18 γ15κ18 γ20κ18 γ22κ18 γ23κ18 γ46κ18 γ52κ18 γ3κ18 REJ04541.67 0.049 >15 >15 >15 >15 0.061 >15 2.132 1.227 PVO.4 0.028 >15 1.588 >15 >15 0.047 2.100 0.081 >15 YU2.DG 0.070 >15 1.169 >15 8.229 0.117 2.360 0.265 7.707 34>15.vl.l >15 >15 >15 >15 >15 >15 >15 >15 >15 3365.v2.c20 >15 >15 >15 >15 >15 >15 >15 >15 >15 ZM53M.PB12 >15 >15 >15 >15 >15 >15 >15 >15 >15 ZM109F.PB4 >15 >15 >15 >15 >15 >15 >15 >15 >15 3016.v5.c45 0.057 >15 5.554 >15 >15 >15 2.993 0.129 >15 231965.c1 0.163 >15 1.481 >15 13.350 0.047 4.157 0.264 >15 X1254_c3 0.616 16.224 2.849 5.221 25.988 0.128 4.202 1.567 4.066 251-18 >15 >15 >15 >15 1.563 0.648 >15 0.116 25.339 R1166.c1 0.578 >15 1.986 20.036 >15 1.678 4.096 1.351 11.701 H086.8 0.209 >15 >15 >15 7.311 0.708 >15 0.464 >15 Du172.17 11.518 >15 >15 >15 >15 >15 >15 >15 >15 250-4 >15 >15 >15 >15 >15 2.953 >15 >15 >15 MuLV >30 >30 NT >30 >15 >30 >15 >15 >15 Virus γ20κ19 REJO4541.67 >15 PYO.4 >15 YU2.DG >15 34>15.V1.c1 >15 3365.v2.c20 >15 ZM53M.PB12 >15 Z109F.PB4 >15 3016.v5.c45 >15 231965.c1 >15 X1254_c3 2.291 251-18 >15 R1166.c1 >15 H086.8 >15 Du172.17 >15 250-4 >15 MuLV >15 Virus γ15κ61 γ44κ61 γ46κ61 γ52κ61 γ59κ61 REJO4541.67 2.029 >15 0.378 0.115 1.333 PVO.4 1.230 >15 0.244 0.078 >15 YU2.DG 3.446 >15 0.915 0.406 4.326 34>15.v1.cl >15 >15 >15 0.681 >15 3365.v2.c20 >15 >15 >15 >15 >15 ZM53M.PB12 >15 >15 27.493 8.435 13.301 ZM109F.PB4 >15 >15 >15 >15 >15 3016.v5.c45 1.214 >15 0.383 0.182 >15 231965.c1 5.231 >15 1.576 0.515 >15 X1254_c3 10.584 >15 4.468 2.565 4.018 251-18 4.656 >15 1.842 0.273 1.402 R1156 61 6.548 >15 2.678 1.635 7.461 H086.8 >15 >15 0.584 0.242 >15 Du172.17 >15 >15 26.083 7.275 >15 250-4 >15 >15 >15 >15 >15 MuLV >15 >15 >15 >15 >15 - Of these, 52HCκ5LC was 5-fold more potent than 8ANC195 (neutralized 12 of 15 viruses with a mean IC50 of 0.45 μg/ml as compared to 2.3 μg/ml for 8ANC195) (
FIG. 13 ), a potency and breadth against this virus panel that was comparable to those of other bNAbs, such as VRC01 (neutralized 12 of 15 viruses with a 0.56 μg/ml mean IC50) and 10-1074 (neutralized 6 of 15 viruses with a mean of 0.09 μg/ml), that target non-overlapping sites (Wu et al., Science 329, 856 (2010); Mouquet et al., Proceedings of the National Academy of Sciences of the United States of America 109, E3268 (2012)). - The LC was critical to the activity of more potent 52HCκ5LC variant, as demonstrated by diminished neutralization potencies when κ5LC was swapped for either κ3LC or κ11LC (
FIG. 19C ). The weaker neutralization could be explained by differences between κ5LC and κ3LC at solvent-exposed residues in CDRL2 (53LC and 54LC) and FWRL3 (64LC), and a nearby buried residue (34LC) that may affect the structural integrity of CDRL1. Modeling of YU2 gp41 residues into the Env trimer structure (Julien et al., Science 342, 1477 (2013)) suggested that 8ANC195 positions 53LC and 54LC were adjacent to the Asn637gp41 PNGS (FIGS. 8, 14 ). The improved neutralizing activity of κ5LC compared with the other newly-isolated LCs was associated with small side chains at positions 34LC (Val), 53LC (Ala) and 54LC (Ala), whereas κ3LC or κ11LC, which were less broadly neutralizing when paired with identical HCs, included bulkier and/or charged side chains that would clash with the nearby gp41 glycan. κ5LC was the only LC containing an S64RLC substitution and this single change compared to the 8ANC195 LC may account for the 5-fold improved potency of 52HCκ5LC. Residues in the immediate vicinity of Asn637gp41 might also modify neutralization; all six viral strains that were potently neutralized by the 52HCκ5LC variant had Asp636gp41 or Asn636gp41 whereas the remaining eight strains had Ser636gp41 (p<0.001 by G-test). The same association between Asp636gp41/Asn636gp41 and neutralization potency was also statistically significant for 8ANC195 (p<0.01 by G-test), consistent an interaction between the N-terminal portion of gp41 HR2 (residues ˜625 to 640) and 8ANC195 LC (FIG. 8 ). Also consistent with changes in the gp41 HR2 region affecting 8ANC195 neutralization, a computational analysis of neutralization panel data using the Antibody Database program (West, Jr. et al., Proceedings of the National Academy of Sciences of the United States ofAmerica 110, 10598 (2013)) suggested that Glu632gp41 was associated with stronger neutralization. - In conclusion, 8ANC195 defines a novel site of HIV-1 Env vulnerability to neutralizing antibodies that spans gp120 and gp41 (
FIG. 15 ). Rather than penetrating the glycan shield using only a single CDR loop, a strategy employed by antibodies such as PG9 and PGT128 (Pejchal et al., Science 334, 1097 (2011); McLellan et al., Nature 480, 336 (2011)) 8ANC195 inserted its entire HC variable region into a gap in the shield to form a large interface, of which >50% involved contacts to gp120 glycans (FIG. 17 ). - Although it was not possible to obtain large numbers of 8ANC195 variants by standard single cell cloning techniques (Scheid et al., J Immunol Methods 343, 65 (2009)), randomly combining HCs and LCs obtained from memory B cells without antigen-specific sorting demonstrated that the target of this antibody supported neutralization activity comparable to that against the most vulnerable sites on Env. Potent variants of 8ANC195 are particularly since the epitope does not overlap with the targets of CD4 binding site, V2 loop, V3 loop or MPER antibodies.
- The foregoing examples and description of the preferred embodiments should be taken as illustrating, rather than as limiting the present invention as defined by the claims. As will be readily appreciated, numerous variations and combinations of the features set forth above can be utilized without departing from the present invention as set forth in the claims. Such variations are not regarded as a departure from the scope of the invention, and all such variations are intended to be included within the scope of the following claims. All references cited herein are incorporated herein by reference in their entireties.
Claims (12)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/471,573 US20220002391A1 (en) | 2014-01-31 | 2021-09-10 | Broadly Neutralizing Anti-HIV Antibodies and Epitope Therefor |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201461934359P | 2014-01-31 | 2014-01-31 | |
PCT/US2015/013924 WO2015117008A2 (en) | 2014-01-31 | 2015-01-30 | Broadly neutralizing anti-hiv antibodies and epitope therefor |
US201615115547A | 2016-07-29 | 2016-07-29 | |
US16/578,833 US11155605B2 (en) | 2014-01-31 | 2019-09-23 | Nucleic acids encoding broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 ENV subunits |
US17/471,573 US20220002391A1 (en) | 2014-01-31 | 2021-09-10 | Broadly Neutralizing Anti-HIV Antibodies and Epitope Therefor |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/578,833 Division US11155605B2 (en) | 2014-01-31 | 2019-09-23 | Nucleic acids encoding broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 ENV subunits |
Publications (1)
Publication Number | Publication Date |
---|---|
US20220002391A1 true US20220002391A1 (en) | 2022-01-06 |
Family
ID=53757926
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/115,547 Active 2035-08-19 US10421803B2 (en) | 2014-01-31 | 2015-01-30 | Broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 Env subunits |
US16/578,833 Active US11155605B2 (en) | 2014-01-31 | 2019-09-23 | Nucleic acids encoding broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 ENV subunits |
US17/471,573 Pending US20220002391A1 (en) | 2014-01-31 | 2021-09-10 | Broadly Neutralizing Anti-HIV Antibodies and Epitope Therefor |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/115,547 Active 2035-08-19 US10421803B2 (en) | 2014-01-31 | 2015-01-30 | Broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 Env subunits |
US16/578,833 Active US11155605B2 (en) | 2014-01-31 | 2019-09-23 | Nucleic acids encoding broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 ENV subunits |
Country Status (2)
Country | Link |
---|---|
US (3) | US10421803B2 (en) |
WO (1) | WO2015117008A2 (en) |
Families Citing this family (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018075564A1 (en) | 2016-10-17 | 2018-04-26 | University Of Maryland, College Park | Multispecific antibodies targeting human immunodeficiency virus and methods of using the same |
JP7041898B2 (en) * | 2016-12-27 | 2022-03-25 | ザ ロックフェラー ユニバーシティー | Widespread neutralization anti-HIV-1 antibody and its usage |
AU2019297324B9 (en) | 2018-07-03 | 2022-07-07 | Gilead Sciences, Inc. | Antibodies that target HIV gp120 and methods of use |
KR20220032568A (en) | 2019-06-25 | 2022-03-15 | 길리애드 사이언시즈, 인코포레이티드 | FLT3L-FC fusion protein and methods of use |
JP7454645B2 (en) | 2019-07-16 | 2024-03-22 | ギリアード サイエンシーズ, インコーポレイテッド | HIV vaccine and its production and use methods |
US20220257619A1 (en) | 2019-07-18 | 2022-08-18 | Gilead Sciences, Inc. | Long-acting formulations of tenofovir alafenamide |
BR112022012625A2 (en) | 2019-12-24 | 2022-09-06 | Carna Biosciences Inc | DIACYLGLYCEROL KINASE MODULATING COMPOUNDS |
WO2021188959A1 (en) | 2020-03-20 | 2021-09-23 | Gilead Sciences, Inc. | Prodrugs of 4'-c-substituted-2-halo-2'-deoxyadenosine nucleosides and methods of making and using the same |
WO2021236944A1 (en) | 2020-05-21 | 2021-11-25 | Gilead Sciences, Inc. | Pharmaceutical compositions comprising bictegravir |
CN116194144A (en) | 2020-08-07 | 2023-05-30 | 吉利德科学公司 | Prodrugs of phosphoramide nucleotide analogs and pharmaceutical uses thereof |
EP4204092A1 (en) | 2020-08-25 | 2023-07-05 | Gilead Sciences, Inc. | Multi-specific antigen binding molecules targeting hiv and methods of use |
US11976072B2 (en) | 2021-06-23 | 2024-05-07 | Gilead Sciences, Inc. | Diacylglycerol kinase modulating compounds |
CA3222439A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
CA3222595A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
EP4359389A1 (en) | 2021-06-23 | 2024-05-01 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
US20230203071A1 (en) | 2021-12-03 | 2023-06-29 | Zhimin Du | Therapeutic compounds for hiv virus infection |
CA3238270A1 (en) | 2021-12-03 | 2023-06-08 | Gediminas J. Brizgys | Therapeutic compounds for hiv virus infection |
TW202337439A (en) | 2021-12-03 | 2023-10-01 | 美商基利科學股份有限公司 | Therapeutic compounds for hiv virus infection |
TW202400172A (en) | 2022-04-06 | 2024-01-01 | 美商基利科學股份有限公司 | Bridged tricyclic carbamoylpyridone compounds and uses thereof |
US20240034724A1 (en) | 2022-07-01 | 2024-02-01 | Gilead Sciences, Inc. | Therapeutic compounds useful for the prophylactic or therapeutic treatment of an hiv virus infection |
WO2024015741A1 (en) | 2022-07-12 | 2024-01-18 | Gilead Sciences, Inc. | Hiv immunogenic polypeptides and vaccines and uses thereof |
WO2024076915A1 (en) | 2022-10-04 | 2024-04-11 | Gilead Sciences, Inc. | 4'-thionucleoside analogues and their pharmaceutical use |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
RU94045907A (en) | 1992-04-01 | 1996-11-10 | Мерк Энд Ко. | Human hiv-antibodies or their fragments, expression casettes, host-cells, pharmaceutical composition, method of protection |
EP2618843B1 (en) * | 2010-09-24 | 2016-12-07 | International Aids Vaccine Initiative | Novel hiv-1 broadly neutralizing antibodies |
SI2710033T1 (en) * | 2011-05-17 | 2021-05-31 | The Rockefeller University | Human immunodeficiency virus neutralizing antibodies and methods of use thereof |
-
2015
- 2015-01-30 US US15/115,547 patent/US10421803B2/en active Active
- 2015-01-30 WO PCT/US2015/013924 patent/WO2015117008A2/en active Application Filing
-
2019
- 2019-09-23 US US16/578,833 patent/US11155605B2/en active Active
-
2021
- 2021-09-10 US US17/471,573 patent/US20220002391A1/en active Pending
Non-Patent Citations (10)
Title |
---|
Azoitei, M. L., et al., October 2011, Computation-guided backbone grafting of a discontinuous motif onto a protein scaffold, Science 334:373-376. * |
Baker, D., 2010, An exciting but challenging road ahead for computational enzyme design, Prot. Sci. 19:1817-1819. * |
Correia, B. E., et al., September 2010, Computational design of epitope-scaffolds allows induction of antibodies specific for a poorly immunogenic HIV vaccine epitope, Structure 18:1116-1126. * |
Doores, K. J., et al., February 2013, 2G12-Expressing B Cell Lines May Aid in HIV Carbohydrate Vaccine Design Strategies, J. Virol. 87(4):2234-2241. * |
Garces, F., et al., September 2014, Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies, Cell 159(1):69-79. * |
Haynes, B. F., et al., March 2016, HIV-Host Interactions: Implications for Vaccine Design, Cell Host Microbe 19:292-303. * |
Kabanova, A., et al., 2010, Preparation, Characterization and Immunogenicity of HIV-1 Related High-Mannose Oligosaccharides-CRM197 GLycoconjugates, Glyconj. J. 27:501-513. * |
Kwong, P. D., et al., September 2013, Broadly Neutralizing Antibodies and the Search for an HIV-1 Vaccine: The End of the Beginning, Nat. Rev. Immunol. 13:693-701. * |
Scharf, L., et al., May 2014, Antibody ANC195 Reveals a Site of Broad Vulnerability on the HIV-1 Envelope Spike, Cell Reports 7:785-795. * |
West, Jr., A. P., et al., February 2014, Structural Insights on the Role of Antibodies in HIV-1 Vaccine and Therapy, Cell 156:633-648. * |
Also Published As
Publication number | Publication date |
---|---|
WO2015117008A3 (en) | 2015-10-08 |
WO2015117008A2 (en) | 2015-08-06 |
US10421803B2 (en) | 2019-09-24 |
US20200140528A1 (en) | 2020-05-07 |
US20180171001A1 (en) | 2018-06-21 |
US11155605B2 (en) | 2021-10-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11155605B2 (en) | Nucleic acids encoding broadly neutralizing glycan-dependent 8ANC195 antibody variants that bind to an epitope spanning both HIV-1 ENV subunits | |
US11634478B2 (en) | Human immunodeficiency virus neutralizing antibodies and methods of use thereof | |
JP7376898B2 (en) | Broadly neutralizing anti-HIV antibody | |
EA042696B1 (en) | HUMAN IMMUNODEFICIENCY VIRUS NEUTRALIZING ANTIBODIES AND METHODS FOR THEIR APPLICATION |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: THE ROCKEFELLER UNIVERSITY, NEW YORK Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:NUSSENZWEIG, MICHEL;SCHEID, JOHANNES;SIGNING DATES FROM 20150625 TO 20150710;REEL/FRAME:057444/0502 Owner name: CALIFORNIA INSTITUTE OF TECHNOLOGY, CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BJORKMAN, PAMELA J.;SCHARF, LOUISE;REEL/FRAME:057444/0621 Effective date: 20150624 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: ADVISORY ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |