US20210388398A1 - Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose - Google Patents
Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose Download PDFInfo
- Publication number
- US20210388398A1 US20210388398A1 US17/131,293 US202017131293A US2021388398A1 US 20210388398 A1 US20210388398 A1 US 20210388398A1 US 202017131293 A US202017131293 A US 202017131293A US 2021388398 A1 US2021388398 A1 US 2021388398A1
- Authority
- US
- United States
- Prior art keywords
- cellobiohydrolase
- endoglucanase
- host cell
- seq
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 240000004808 Saccharomyces cerevisiae Species 0.000 title claims abstract description 159
- 229920002678 cellulose Polymers 0.000 title claims abstract description 94
- 239000001913 cellulose Substances 0.000 title claims abstract description 90
- 238000000855 fermentation Methods 0.000 title claims abstract description 34
- 230000004151 fermentation Effects 0.000 title claims abstract description 34
- 102000005575 Cellulases Human genes 0.000 title abstract description 181
- 108010084185 Cellulases Proteins 0.000 title abstract description 181
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 claims abstract description 414
- 241000235649 Kluyveromyces Species 0.000 claims abstract description 33
- 108010059892 Cellulase Proteins 0.000 claims description 236
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 claims description 153
- 108010008885 Cellulose 1,4-beta-Cellobiosidase Proteins 0.000 claims description 137
- 101150052795 cbh-1 gene Proteins 0.000 claims description 132
- 108091033319 polynucleotide Proteins 0.000 claims description 132
- 102000040430 polynucleotide Human genes 0.000 claims description 132
- 239000002157 polynucleotide Substances 0.000 claims description 132
- 241000499912 Trichoderma reesei Species 0.000 claims description 127
- 238000000034 method Methods 0.000 claims description 111
- 150000007523 nucleic acids Chemical class 0.000 claims description 87
- 241000959173 Rasamsonia emersonii Species 0.000 claims description 78
- 102000039446 nucleic acids Human genes 0.000 claims description 67
- 108020004707 nucleic acids Proteins 0.000 claims description 67
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 claims description 65
- 150000001413 amino acids Chemical class 0.000 claims description 62
- 108010047754 beta-Glucosidase Proteins 0.000 claims description 61
- 102000006995 beta-Glucosidase Human genes 0.000 claims description 60
- 241001674013 Chrysosporium lucknowense Species 0.000 claims description 47
- 241000223199 Humicola grisea Species 0.000 claims description 42
- 241000235004 Saccharomycopsis fibuligera Species 0.000 claims description 40
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 claims description 36
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 claims description 36
- 241000228182 Thermoascus aurantiacus Species 0.000 claims description 34
- 241001509962 Coptotermes formosanus Species 0.000 claims description 32
- 241000259810 Acremonium thermophilum Species 0.000 claims description 26
- 241001248634 Chaetomium thermophilum Species 0.000 claims description 25
- 241000122821 Aspergillus kawachii Species 0.000 claims description 23
- 241001250591 Coptotermes acinaciformis Species 0.000 claims description 23
- 241000379510 Heterodera schachtii Species 0.000 claims description 23
- 241001507865 Aspergillus fischeri Species 0.000 claims description 22
- 241000264368 Coptotermes lacteus Species 0.000 claims description 21
- 241000222344 Irpex lacteus Species 0.000 claims description 21
- 241000721708 Mastotermes darwiniensis Species 0.000 claims description 21
- 241001288908 Nasutitermes walkeri Species 0.000 claims description 21
- 241000866500 Reticulitermes speratus Species 0.000 claims description 21
- 241000897253 Nasutitermes takasagoensis Species 0.000 claims description 20
- 241000849734 Orpinomyces sp. Species 0.000 claims description 20
- 241001465318 Aspergillus terreus Species 0.000 claims description 19
- 241000221961 Neurospora crassa Species 0.000 claims description 19
- 241001515917 Chaetomium globosum Species 0.000 claims description 18
- -1 pentose sugars Chemical class 0.000 claims description 18
- 241000219195 Arabidopsis thaliana Species 0.000 claims description 17
- 241000194103 Bacillus pumilus Species 0.000 claims description 17
- 241000233892 Neocallimastix Species 0.000 claims description 17
- 241000235379 Piromyces Species 0.000 claims description 17
- 241001509967 Reticulitermes flavipes Species 0.000 claims description 17
- 241001670248 Saccharophagus degradans Species 0.000 claims description 17
- 241000193453 [Clostridium] cellulolyticum Species 0.000 claims description 17
- 241000186320 Cellulomonas fimi Species 0.000 claims description 16
- 241000203780 Thermobifida fusca Species 0.000 claims description 16
- 235000000346 sugar Nutrition 0.000 claims description 16
- 230000027455 binding Effects 0.000 claims description 15
- 241001225321 Aspergillus fumigatus Species 0.000 claims description 13
- 229940091771 aspergillus fumigatus Drugs 0.000 claims description 13
- 108090000769 Isomerases Proteins 0.000 claims description 5
- 102000004195 Isomerases Human genes 0.000 claims description 5
- 101000689035 Mus musculus Ribulose-phosphate 3-epimerase Proteins 0.000 claims description 4
- 101000729343 Oryza sativa subsp. japonica Ribulose-phosphate 3-epimerase, cytoplasmic isoform Proteins 0.000 claims description 4
- FNZLKVNUWIIPSJ-UHFFFAOYSA-N Rbl5P Natural products OCC(=O)C(O)C(O)COP(O)(O)=O FNZLKVNUWIIPSJ-UHFFFAOYSA-N 0.000 claims description 4
- 108020004530 Transaldolase Proteins 0.000 claims description 4
- 102100028601 Transaldolase Human genes 0.000 claims description 4
- 102000014701 Transketolase Human genes 0.000 claims description 4
- 108010043652 Transketolase Proteins 0.000 claims description 4
- 108700040099 Xylose isomerases Proteins 0.000 claims description 4
- 102100029089 Xylulose kinase Human genes 0.000 claims description 4
- 108091022915 xylulokinase Proteins 0.000 claims description 4
- 102000016912 Aldehyde Reductase Human genes 0.000 claims description 3
- 108010053754 Aldehyde reductase Proteins 0.000 claims description 3
- 238000012258 culturing Methods 0.000 claims description 3
- 101150118141 GRE3 gene Proteins 0.000 claims description 2
- 238000003501 co-culture Methods 0.000 abstract description 53
- 230000001461 cytolytic effect Effects 0.000 abstract description 18
- 210000004027 cell Anatomy 0.000 description 193
- 108090000765 processed proteins & peptides Proteins 0.000 description 165
- 102000004196 processed proteins & peptides Human genes 0.000 description 155
- 229920001184 polypeptide Polymers 0.000 description 153
- 108090000623 proteins and genes Proteins 0.000 description 131
- 229940106157 cellulase Drugs 0.000 description 118
- 230000000694 effects Effects 0.000 description 92
- 235000010980 cellulose Nutrition 0.000 description 82
- 108020004705 Codon Proteins 0.000 description 76
- 239000012634 fragment Substances 0.000 description 67
- 239000013598 vector Substances 0.000 description 67
- 235000001014 amino acid Nutrition 0.000 description 65
- 230000014509 gene expression Effects 0.000 description 65
- 101150114858 cbh2 gene Proteins 0.000 description 58
- 239000000758 substrate Substances 0.000 description 56
- 238000004519 manufacturing process Methods 0.000 description 53
- 239000013612 plasmid Substances 0.000 description 53
- 102000004190 Enzymes Human genes 0.000 description 48
- 108090000790 Enzymes Proteins 0.000 description 48
- 229940088598 enzyme Drugs 0.000 description 47
- 108091026890 Coding region Proteins 0.000 description 46
- 108020004414 DNA Proteins 0.000 description 46
- 125000003275 alpha amino acid group Chemical group 0.000 description 44
- 235000018102 proteins Nutrition 0.000 description 43
- 102000004169 proteins and genes Human genes 0.000 description 43
- 238000006243 chemical reaction Methods 0.000 description 39
- 239000002773 nucleotide Substances 0.000 description 31
- 125000003729 nucleotide group Chemical group 0.000 description 31
- 238000003556 assay Methods 0.000 description 25
- 238000002474 experimental method Methods 0.000 description 25
- 241000894007 species Species 0.000 description 25
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 24
- 239000008103 glucose Substances 0.000 description 24
- 108091028043 Nucleic acid sequence Proteins 0.000 description 22
- 239000007787 solid Substances 0.000 description 22
- 238000011068 loading method Methods 0.000 description 21
- 230000008569 process Effects 0.000 description 21
- 230000009466 transformation Effects 0.000 description 21
- 239000011121 hardwood Substances 0.000 description 18
- 239000003550 marker Substances 0.000 description 18
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 17
- 101100517196 Arabidopsis thaliana NRPE1 gene Proteins 0.000 description 17
- 101100190825 Bos taurus PMEL gene Proteins 0.000 description 17
- 101100073341 Oryza sativa subsp. japonica KAO gene Proteins 0.000 description 17
- 101150012255 RKI1 gene Proteins 0.000 description 17
- 101100428737 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) VPS54 gene Proteins 0.000 description 17
- 108020001507 fusion proteins Proteins 0.000 description 17
- 102000037865 fusion proteins Human genes 0.000 description 17
- 101150005492 rpe1 gene Proteins 0.000 description 17
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 16
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 16
- 101100351299 Caenorhabditis elegans pdf-1 gene Proteins 0.000 description 16
- 108700010070 Codon Usage Proteins 0.000 description 16
- 238000006467 substitution reaction Methods 0.000 description 16
- 239000006228 supernatant Substances 0.000 description 16
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 16
- 101000807008 Homo sapiens Uracil phosphoribosyltransferase homolog Proteins 0.000 description 15
- 241001138401 Kluyveromyces lactis Species 0.000 description 15
- 102100037717 Uracil phosphoribosyltransferase homolog Human genes 0.000 description 15
- 101710165425 Alpha-enolase Proteins 0.000 description 14
- 101710184673 Enolase 1 Proteins 0.000 description 14
- 101000891113 Homo sapiens T-cell acute lymphocytic leukemia protein 1 Proteins 0.000 description 14
- 101000702553 Schistosoma mansoni Antigen Sm21.7 Proteins 0.000 description 14
- 101000714192 Schistosoma mansoni Tegument antigen Proteins 0.000 description 14
- 102100040365 T-cell acute lymphocytic leukemia protein 1 Human genes 0.000 description 14
- 239000000047 product Substances 0.000 description 14
- 102100038910 Alpha-enolase Human genes 0.000 description 13
- 244000285963 Kluyveromyces fragilis Species 0.000 description 13
- 108091034117 Oligonucleotide Proteins 0.000 description 13
- 101100382629 Schizosaccharomyces pombe (strain 972 / ATCC 24843) cbh1 gene Proteins 0.000 description 13
- 101150048033 cbh gene Proteins 0.000 description 13
- 238000012217 deletion Methods 0.000 description 13
- 230000037430 deletion Effects 0.000 description 13
- 108091035707 Consensus sequence Proteins 0.000 description 12
- 238000004873 anchoring Methods 0.000 description 12
- 230000001580 bacterial effect Effects 0.000 description 12
- 230000002255 enzymatic effect Effects 0.000 description 12
- 239000013604 expression vector Substances 0.000 description 12
- 230000012010 growth Effects 0.000 description 12
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 11
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 11
- 108010084455 Zeocin Proteins 0.000 description 11
- 230000006870 function Effects 0.000 description 11
- 239000002609 medium Substances 0.000 description 11
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 230000001105 regulatory effect Effects 0.000 description 11
- 241000489861 Maximus Species 0.000 description 10
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 10
- 230000003115 biocidal effect Effects 0.000 description 10
- 108010091371 endoglucanase 1 Proteins 0.000 description 10
- 230000007062 hydrolysis Effects 0.000 description 10
- 238000006460 hydrolysis reaction Methods 0.000 description 10
- 239000000203 mixture Substances 0.000 description 10
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 9
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 9
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 9
- 238000007792 addition Methods 0.000 description 9
- 125000000539 amino acid group Chemical group 0.000 description 9
- 239000012153 distilled water Substances 0.000 description 9
- 230000010354 integration Effects 0.000 description 9
- 108020004999 messenger RNA Proteins 0.000 description 9
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 9
- 239000008108 microcrystalline cellulose Substances 0.000 description 9
- 229940016286 microcrystalline cellulose Drugs 0.000 description 9
- 239000000123 paper Substances 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 108700026244 Open Reading Frames Proteins 0.000 description 8
- 108010029485 Protein Isoforms Proteins 0.000 description 8
- 102000001708 Protein Isoforms Human genes 0.000 description 8
- 210000004899 c-terminal region Anatomy 0.000 description 8
- 230000002538 fungal effect Effects 0.000 description 8
- 229910052757 nitrogen Inorganic materials 0.000 description 8
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- PRTGXBPFDYMIJH-KSFLKEQHSA-N 7-[(2s,3r,4r,5s,6r)-3,4-dihydroxy-6-(hydroxymethyl)-5-[(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-4-methylchromen-2-one Chemical compound O([C@@H]1[C@@H](CO)O[C@H]([C@@H]([C@H]1O)O)OC1=CC=2OC(=O)C=C(C=2C=C1)C)[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O PRTGXBPFDYMIJH-KSFLKEQHSA-N 0.000 description 7
- 241000228212 Aspergillus Species 0.000 description 7
- 239000002028 Biomass Substances 0.000 description 7
- 101710121765 Endo-1,4-beta-xylanase Proteins 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 7
- 108010076504 Protein Sorting Signals Proteins 0.000 description 7
- 101150100773 XKS1 gene Proteins 0.000 description 7
- 240000008042 Zea mays Species 0.000 description 7
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 7
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 7
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 7
- 238000004458 analytical method Methods 0.000 description 7
- 230000004071 biological effect Effects 0.000 description 7
- 229910052799 carbon Inorganic materials 0.000 description 7
- 239000001768 carboxy methyl cellulose Substances 0.000 description 7
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 7
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 7
- 235000005822 corn Nutrition 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 7
- 239000010802 sludge Substances 0.000 description 7
- 239000010907 stover Substances 0.000 description 7
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 6
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 6
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 description 6
- 101710139464 Phosphoglycerate kinase 1 Proteins 0.000 description 6
- 241000223252 Rhodotorula Species 0.000 description 6
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 101150052008 TKL-1 gene Proteins 0.000 description 6
- 241000223259 Trichoderma Species 0.000 description 6
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 229940041514 candida albicans extract Drugs 0.000 description 6
- 230000003197 catalytic effect Effects 0.000 description 6
- 239000007979 citrate buffer Substances 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 238000004520 electroporation Methods 0.000 description 6
- 230000005714 functional activity Effects 0.000 description 6
- 238000012239 gene modification Methods 0.000 description 6
- 230000005017 genetic modification Effects 0.000 description 6
- 235000013617 genetically modified food Nutrition 0.000 description 6
- 238000004128 high performance liquid chromatography Methods 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 238000003780 insertion Methods 0.000 description 6
- 230000037431 insertion Effects 0.000 description 6
- 239000002029 lignocellulosic biomass Substances 0.000 description 6
- 244000005700 microbiome Species 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 239000010902 straw Substances 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 210000005253 yeast cell Anatomy 0.000 description 6
- 239000012138 yeast extract Substances 0.000 description 6
- 102000053602 DNA Human genes 0.000 description 5
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 5
- 101710112457 Exoglucanase Proteins 0.000 description 5
- 108091092195 Intron Proteins 0.000 description 5
- 101100285000 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) his-3 gene Proteins 0.000 description 5
- 239000001888 Peptone Substances 0.000 description 5
- 108010080698 Peptones Proteins 0.000 description 5
- 102100028251 Phosphoglycerate kinase 1 Human genes 0.000 description 5
- 241000193448 Ruminiclostridium thermocellum Species 0.000 description 5
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 230000008827 biological function Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 108010091384 endoglucanase 2 Proteins 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 239000002316 fumigant Substances 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 238000011081 inoculation Methods 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 235000019319 peptone Nutrition 0.000 description 5
- 238000012545 processing Methods 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 108091008146 restriction endonucleases Proteins 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 150000008163 sugars Chemical class 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 238000000844 transformation Methods 0.000 description 5
- 229920001817 Agar Polymers 0.000 description 4
- 101100285402 Danio rerio eng1a gene Proteins 0.000 description 4
- 239000005696 Diammonium phosphate Substances 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 241000320412 Ogataea angusta Species 0.000 description 4
- 108010059820 Polygalacturonase Proteins 0.000 description 4
- PXIPVTKHYLBLMZ-UHFFFAOYSA-N Sodium azide Chemical compound [Na+].[N-]=[N+]=[N-] PXIPVTKHYLBLMZ-UHFFFAOYSA-N 0.000 description 4
- 241000228341 Talaromyces Species 0.000 description 4
- 108020004566 Transfer RNA Proteins 0.000 description 4
- 241000235013 Yarrowia Species 0.000 description 4
- 241000193158 [Clostridium] josui Species 0.000 description 4
- 238000009825 accumulation Methods 0.000 description 4
- 230000006978 adaptation Effects 0.000 description 4
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 4
- 230000002411 adverse Effects 0.000 description 4
- 239000008272 agar Substances 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 4
- 108010085318 carboxymethylcellulase Proteins 0.000 description 4
- 210000002421 cell wall Anatomy 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 239000013599 cloning vector Substances 0.000 description 4
- 238000004590 computer program Methods 0.000 description 4
- 239000012228 culture supernatant Substances 0.000 description 4
- MNNHAPBLZZVQHP-UHFFFAOYSA-N diammonium hydrogen phosphate Chemical compound [NH4+].[NH4+].OP([O-])([O-])=O MNNHAPBLZZVQHP-UHFFFAOYSA-N 0.000 description 4
- 229910000388 diammonium phosphate Inorganic materials 0.000 description 4
- 235000019838 diammonium phosphate Nutrition 0.000 description 4
- 230000029087 digestion Effects 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 108010093305 exopolygalacturonase Proteins 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 230000004853 protein function Effects 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 230000001131 transforming effect Effects 0.000 description 4
- 108020004463 18S ribosomal RNA Proteins 0.000 description 3
- IFBHRQDFSNCLOZ-UHFFFAOYSA-N 2-(hydroxymethyl)-6-(4-nitrophenoxy)oxane-3,4,5-triol Chemical compound OC1C(O)C(O)C(CO)OC1OC1=CC=C([N+]([O-])=O)C=C1 IFBHRQDFSNCLOZ-UHFFFAOYSA-N 0.000 description 3
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 3
- 101100011382 Aspergillus niger eglB gene Proteins 0.000 description 3
- 241000235548 Blakeslea Species 0.000 description 3
- 101100459439 Caenorhabditis elegans nac-2 gene Proteins 0.000 description 3
- 229920002299 Cellodextrin Polymers 0.000 description 3
- 241001509964 Coptotermes Species 0.000 description 3
- 241001527609 Cryptococcus Species 0.000 description 3
- 241000235555 Cunninghamella Species 0.000 description 3
- 101150009006 HIS3 gene Proteins 0.000 description 3
- 229920002488 Hemicellulose Polymers 0.000 description 3
- 241001149698 Lipomyces Species 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 241000235575 Mortierella Species 0.000 description 3
- 241000235395 Mucor Species 0.000 description 3
- 241001507755 Neosartorya Species 0.000 description 3
- 241001502335 Orpinomyces Species 0.000 description 3
- 241000235645 Pichia kudriavzevii Species 0.000 description 3
- KWYUFKZDYYNOTN-UHFFFAOYSA-M Potassium hydroxide Chemical compound [OH-].[K+] KWYUFKZDYYNOTN-UHFFFAOYSA-M 0.000 description 3
- 241000233639 Pythium Species 0.000 description 3
- 101100163901 Rattus norvegicus Asic2 gene Proteins 0.000 description 3
- 101100394989 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) hisI gene Proteins 0.000 description 3
- 101100069420 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GRE3 gene Proteins 0.000 description 3
- 108091081024 Start codon Proteins 0.000 description 3
- 241000187310 Streptomyces noursei Species 0.000 description 3
- 241000223230 Trichosporon Species 0.000 description 3
- NRAUADCLPJTGSF-ZPGVOIKOSA-N [(2r,3s,4r,5r,6r)-6-[[(3as,7r,7as)-7-hydroxy-4-oxo-1,3a,5,6,7,7a-hexahydroimidazo[4,5-c]pyridin-2-yl]amino]-5-[[(3s)-3,6-diaminohexanoyl]amino]-4-hydroxy-2-(hydroxymethyl)oxan-3-yl] carbamate Chemical compound NCCC[C@H](N)CC(=O)N[C@@H]1[C@@H](O)[C@H](OC(N)=O)[C@@H](CO)O[C@H]1\N=C/1N[C@H](C(=O)NC[C@H]2O)[C@@H]2N\1 NRAUADCLPJTGSF-ZPGVOIKOSA-N 0.000 description 3
- 230000004075 alteration Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 238000010364 biochemical engineering Methods 0.000 description 3
- 229920001222 biopolymer Polymers 0.000 description 3
- 238000004422 calculation algorithm Methods 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- IQFVPQOLBLOTPF-HKXUKFGYSA-L congo red Chemical compound [Na+].[Na+].C1=CC=CC2=C(N)C(/N=N/C3=CC=C(C=C3)C3=CC=C(C=C3)/N=N/C3=C(C4=CC=CC=C4C(=C3)S([O-])(=O)=O)N)=CC(S([O-])(=O)=O)=C21 IQFVPQOLBLOTPF-HKXUKFGYSA-L 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 238000005520 cutting process Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 238000006073 displacement reaction Methods 0.000 description 3
- 239000000446 fuel Substances 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 150000004676 glycans Polymers 0.000 description 3
- 108010002430 hemicellulase Proteins 0.000 description 3
- 230000003301 hydrolyzing effect Effects 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 239000000543 intermediate Substances 0.000 description 3
- 229930027917 kanamycin Natural products 0.000 description 3
- 229960000318 kanamycin Drugs 0.000 description 3
- 229930182823 kanamycin A Natural products 0.000 description 3
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 238000005457 optimization Methods 0.000 description 3
- 238000011002 quantification Methods 0.000 description 3
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 238000012163 sequencing technique Methods 0.000 description 3
- 229910000029 sodium carbonate Inorganic materials 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000012622 synthetic inhibitor Substances 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 229940035893 uracil Drugs 0.000 description 3
- SBKVPJHMSUXZTA-MEJXFZFPSA-N (2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-5-amino-2-[[2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-indol-3-yl)propanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-4-methylpentanoyl]amino]-5-oxopentanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-5-oxopentanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoic acid Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 SBKVPJHMSUXZTA-MEJXFZFPSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- DLFVBJFMPXGRIB-UHFFFAOYSA-N Acetamide Chemical compound CC(N)=O DLFVBJFMPXGRIB-UHFFFAOYSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- 101100437484 Arabidopsis thaliana BGLU18 gene Proteins 0.000 description 2
- 241000228245 Aspergillus niger Species 0.000 description 2
- 101100354312 Bacillus subtilis (strain 168) licC gene Proteins 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 102100030981 Beta-alanine-activating enzyme Human genes 0.000 description 2
- 229920002498 Beta-glucan Polymers 0.000 description 2
- 241000680806 Blastobotrys adeninivorans Species 0.000 description 2
- 101100342633 Bos taurus LLGL1 gene Proteins 0.000 description 2
- 241000222122 Candida albicans Species 0.000 description 2
- 101100083069 Candida albicans (strain SC5314 / ATCC MYA-2876) PGA62 gene Proteins 0.000 description 2
- 101100106993 Candida albicans (strain SC5314 / ATCC MYA-2876) YWP1 gene Proteins 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 241000221955 Chaetomium Species 0.000 description 2
- 241001508812 Clavispora opuntiae Species 0.000 description 2
- 241000235646 Cyberlindnera jadinii Species 0.000 description 2
- 241000521604 Cyberlindnera mississippiensis Species 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- ZAQJHHRNXZUBTE-WUJLRWPWSA-N D-xylulose Chemical compound OC[C@@H](O)[C@H](O)C(=O)CO ZAQJHHRNXZUBTE-WUJLRWPWSA-N 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- 241000235036 Debaryomyces hansenii Species 0.000 description 2
- 101100410352 Escherichia coli (strain K12) chbC gene Proteins 0.000 description 2
- 101100129092 Escherichia coli hic gene Proteins 0.000 description 2
- 101150054379 FLO1 gene Proteins 0.000 description 2
- 229920001503 Glucan Polymers 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 2
- 101000773364 Homo sapiens Beta-alanine-activating enzyme Proteins 0.000 description 2
- 101001012669 Homo sapiens Melanoma inhibitory activity protein 2 Proteins 0.000 description 2
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 2
- 241000256602 Isoptera Species 0.000 description 2
- 235000014663 Kluyveromyces fragilis Nutrition 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 229920002097 Lichenin Polymers 0.000 description 2
- 108010038049 Mating Factor Proteins 0.000 description 2
- 102100029778 Melanoma inhibitory activity protein 2 Human genes 0.000 description 2
- 241000091577 Mexicana Species 0.000 description 2
- 241000235042 Millerozyma farinosa Species 0.000 description 2
- 241000203988 Nasutitermes Species 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 240000007594 Oryza sativa Species 0.000 description 2
- 235000007164 Oryza sativa Nutrition 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 241001520808 Panicum virgatum Species 0.000 description 2
- 241000081271 Phaffia rhodozyma Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 241000235648 Pichia Species 0.000 description 2
- 241000193632 Piromyces sp. Species 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 241000235070 Saccharomyces Species 0.000 description 2
- 101100008072 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) CWP2 gene Proteins 0.000 description 2
- 101100065855 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) EXG1 gene Proteins 0.000 description 2
- 235000018368 Saccharomyces fragilis Nutrition 0.000 description 2
- 101100058298 Saccharomycopsis fibuligera BGL1 gene Proteins 0.000 description 2
- 241000235060 Scheffersomyces stipitis Species 0.000 description 2
- 241000311088 Schwanniomyces Species 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 108700005078 Synthetic Genes Proteins 0.000 description 2
- 241000897276 Termes Species 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 108700009124 Transcription Initiation Site Proteins 0.000 description 2
- 102100033598 Triosephosphate isomerase Human genes 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- LRQOQMWIEDQCHM-XCJASTIHSA-N Urobiose Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@@H]1O[C@@]1(O)[C@H](CO)O[C@H](O[C@@]2(O)[C@@H](O[C@H](O)[C@@H](O)[C@@H]2O)CO)[C@@H](O)[C@@H]1O LRQOQMWIEDQCHM-XCJASTIHSA-N 0.000 description 2
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 2
- 241000233433 Yamadazyma mexicana Species 0.000 description 2
- 241000235015 Yarrowia lipolytica Species 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 229940126574 aminoglycoside antibiotic Drugs 0.000 description 2
- 239000002647 aminoglycoside antibiotic agent Substances 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 235000011130 ammonium sulphate Nutrition 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 101150100570 bglA gene Proteins 0.000 description 2
- 239000003225 biodiesel Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 229940095731 candida albicans Drugs 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 101150080131 celB gene Proteins 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 239000000306 component Substances 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000012937 correction Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000001035 drying Methods 0.000 description 2
- 238000001952 enzyme assay Methods 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 230000035611 feeding Effects 0.000 description 2
- 239000000835 fiber Substances 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 238000002873 global sequence alignment Methods 0.000 description 2
- 230000002414 glycolytic effect Effects 0.000 description 2
- 229940059442 hemicellulase Drugs 0.000 description 2
- 239000000413 hydrolysate Substances 0.000 description 2
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 239000002054 inoculum Substances 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- 229940031154 kluyveromyces marxianus Drugs 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- XIXADJRWDQXREU-UHFFFAOYSA-M lithium acetate Chemical compound [Li+].CC([O-])=O XIXADJRWDQXREU-UHFFFAOYSA-M 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 239000012092 media component Substances 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 150000004804 polysaccharides Polymers 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 239000002994 raw material Substances 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 235000009566 rice Nutrition 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- KDYFGRWQOYBRFD-UHFFFAOYSA-N succinic acid Chemical compound OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 2
- 230000009469 supplementation Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 239000002699 waste material Substances 0.000 description 2
- 239000000811 xylitol Substances 0.000 description 2
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 2
- 229960002675 xylitol Drugs 0.000 description 2
- 235000010447 xylitol Nutrition 0.000 description 2
- XKKRQPPGOROKBD-UHFFFAOYSA-N (-)-lusitanine Natural products C1CCCC2C(=CNC(=O)C)CCCN21 XKKRQPPGOROKBD-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- YKBGVTZYEHREMT-KVQBGUIXSA-N 2'-deoxyguanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 YKBGVTZYEHREMT-KVQBGUIXSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- IQUPABOKLQSFBK-UHFFFAOYSA-N 2-nitrophenol Chemical class OC1=CC=CC=C1[N+]([O-])=O IQUPABOKLQSFBK-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- PDWZXKSZLRVSEH-UHFFFAOYSA-N 6-chloro-4-n-cyclopropyl-4-n-(thiophen-2-ylmethyl)pyrimidine-2,4-diamine Chemical compound NC1=NC(Cl)=CC(N(CC=2SC=CC=2)C2CC2)=N1 PDWZXKSZLRVSEH-UHFFFAOYSA-N 0.000 description 1
- 101150009903 ATG11 gene Proteins 0.000 description 1
- 101150006236 ATG15 gene Proteins 0.000 description 1
- 101150115055 ATG16 gene Proteins 0.000 description 1
- 101150047432 ATG19 gene Proteins 0.000 description 1
- 101150028385 ATG2 gene Proteins 0.000 description 1
- 102100035972 ATPase GET3 Human genes 0.000 description 1
- 241000776564 Acetobacter cerevisiae Species 0.000 description 1
- 241001019659 Acremonium <Plectosphaerellaceae> Species 0.000 description 1
- 240000004246 Agave americana Species 0.000 description 1
- 108010025188 Alcohol oxidase Proteins 0.000 description 1
- 241000609240 Ambelania acida Species 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 101100520819 Arabidopsis thaliana At5g66631 gene Proteins 0.000 description 1
- 101100496009 Arabidopsis thaliana CIPK11 gene Proteins 0.000 description 1
- 101100036901 Arabidopsis thaliana RPL40B gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 208000002109 Argyria Diseases 0.000 description 1
- 101100382641 Aspergillus aculeatus cbhB gene Proteins 0.000 description 1
- 108010061408 Autophagy-Related Protein 12 Proteins 0.000 description 1
- 102000012035 Autophagy-Related Protein 12 Human genes 0.000 description 1
- 102100020689 Autophagy-related protein 13 Human genes 0.000 description 1
- 229920002749 Bacterial cellulose Polymers 0.000 description 1
- 102100029516 Basic salivary proline-rich protein 1 Human genes 0.000 description 1
- 102100026324 Beclin 1-associated autophagy-related key regulator Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 235000014698 Brassica juncea var multisecta Nutrition 0.000 description 1
- 235000006008 Brassica napus var napus Nutrition 0.000 description 1
- 240000000385 Brassica napus var. napus Species 0.000 description 1
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 1
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 101100184274 Candida albicans (strain SC5314 / ATCC MYA-2876) MNL1 gene Proteins 0.000 description 1
- 101100164184 Candida albicans (strain SC5314 / ATCC MYA-2876) SPO72 gene Proteins 0.000 description 1
- 244000206911 Candida holmii Species 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 101710095524 Cellodextrinase Proteins 0.000 description 1
- 241000186321 Cellulomonas Species 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 108020004638 Circular DNA Proteins 0.000 description 1
- 241001508813 Clavispora lusitaniae Species 0.000 description 1
- 108091033380 Coding strand Proteins 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-Serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 description 1
- 229930195711 D-Serine Natural products 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 241000235035 Debaryomyces Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 101100517598 Dictyostelium discoideum nubp2 gene Proteins 0.000 description 1
- 102100036966 Dipeptidyl aminopeptidase-like protein 6 Human genes 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 101150015836 ENO1 gene Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 101001091269 Escherichia coli Hygromycin-B 4-O-kinase Proteins 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 101150002048 FUR1 gene Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000223195 Fusarium graminearum Species 0.000 description 1
- 241001489200 Fusarium poae Species 0.000 description 1
- 101150081655 GPM1 gene Proteins 0.000 description 1
- 102100033925 GS homeobox 1 Human genes 0.000 description 1
- 102100033924 GS homeobox 2 Human genes 0.000 description 1
- 102100028652 Gamma-enolase Human genes 0.000 description 1
- 102100033713 Gamma-secretase subunit APH-1B Human genes 0.000 description 1
- 102100039955 Gem-associated protein 6 Human genes 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 101150068227 HSP104 gene Proteins 0.000 description 1
- 241001149669 Hanseniaspora Species 0.000 description 1
- 102100032606 Heat shock factor protein 1 Human genes 0.000 description 1
- 241001480224 Heterodera Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101001074983 Homo sapiens ATPase GET3 Proteins 0.000 description 1
- 101000785138 Homo sapiens Autophagy-related protein 13 Proteins 0.000 description 1
- 101001125486 Homo sapiens Basic salivary proline-rich protein 1 Proteins 0.000 description 1
- 101000766227 Homo sapiens Beclin 1-associated autophagy-related key regulator Proteins 0.000 description 1
- 101000804935 Homo sapiens Dipeptidyl aminopeptidase-like protein 6 Proteins 0.000 description 1
- 101001068303 Homo sapiens GS homeobox 1 Proteins 0.000 description 1
- 101001068302 Homo sapiens GS homeobox 2 Proteins 0.000 description 1
- 101001058231 Homo sapiens Gamma-enolase Proteins 0.000 description 1
- 101000733778 Homo sapiens Gamma-secretase subunit APH-1B Proteins 0.000 description 1
- 101000886614 Homo sapiens Gem-associated protein 6 Proteins 0.000 description 1
- 101000867525 Homo sapiens Heat shock factor protein 1 Proteins 0.000 description 1
- 101000994101 Homo sapiens Insulin receptor substrate 4 Proteins 0.000 description 1
- 101100021579 Homo sapiens L1RE1 gene Proteins 0.000 description 1
- 101000941866 Homo sapiens Leucine-rich repeat neuronal protein 2 Proteins 0.000 description 1
- 101001064542 Homo sapiens Liprin-beta-1 Proteins 0.000 description 1
- 101001064870 Homo sapiens Lon protease homolog, mitochondrial Proteins 0.000 description 1
- 101000984710 Homo sapiens Lymphocyte-specific protein 1 Proteins 0.000 description 1
- 101000619708 Homo sapiens Peroxiredoxin-6 Proteins 0.000 description 1
- 101000981455 Homo sapiens Prostate androgen-regulated mucin-like protein 1 Proteins 0.000 description 1
- 101001112424 Homo sapiens RB1-inducible coiled-coil protein 1 Proteins 0.000 description 1
- 101000815628 Homo sapiens Regulatory-associated protein of mTOR Proteins 0.000 description 1
- 101000607335 Homo sapiens Serine/threonine-protein kinase ULK1 Proteins 0.000 description 1
- 101000595531 Homo sapiens Serine/threonine-protein kinase pim-1 Proteins 0.000 description 1
- 101000650857 Homo sapiens Small glutamine-rich tetratricopeptide repeat-containing protein beta Proteins 0.000 description 1
- 101000775102 Homo sapiens Transcriptional coactivator YAP1 Proteins 0.000 description 1
- 101000801742 Homo sapiens Triosephosphate isomerase Proteins 0.000 description 1
- 101000789849 Homo sapiens Ubiquitin-like-conjugating enzyme ATG10 Proteins 0.000 description 1
- 101000650148 Homo sapiens WD repeat domain phosphoinositide-interacting protein 1 Proteins 0.000 description 1
- 101000915742 Homo sapiens Zinc finger protein ZPR1 Proteins 0.000 description 1
- 240000005979 Hordeum vulgare Species 0.000 description 1
- 235000007340 Hordeum vulgare Nutrition 0.000 description 1
- 101150050258 Hsp26 gene Proteins 0.000 description 1
- 241000223198 Humicola Species 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- GRRNUXAQVGOGFE-UHFFFAOYSA-N Hygromycin-B Natural products OC1C(NC)CC(N)C(O)C1OC1C2OC3(C(C(O)C(O)C(C(N)CO)O3)O)OC2C(O)C(CO)O1 GRRNUXAQVGOGFE-UHFFFAOYSA-N 0.000 description 1
- 102100031419 Insulin receptor substrate 4 Human genes 0.000 description 1
- 241000222342 Irpex Species 0.000 description 1
- 241000879186 Kazachstania barnettii Species 0.000 description 1
- 241001465343 Kluyveromyces aestuarii Species 0.000 description 1
- 241000500435 Kluyveromyces dobzhanskii Species 0.000 description 1
- 241000500414 Kluyveromyces wickerhamii Species 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 102100031764 LINE-1 retrotransposable element ORF1 protein Human genes 0.000 description 1
- 241000481961 Lachancea thermotolerans Species 0.000 description 1
- 241000235651 Lachancea waltii Species 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 241000209082 Lolium Species 0.000 description 1
- 102100031955 Lon protease homolog, mitochondrial Human genes 0.000 description 1
- 102100027105 Lymphocyte-specific protein 1 Human genes 0.000 description 1
- 241000721710 Mastotermes Species 0.000 description 1
- 229920001340 Microbial cellulose Polymers 0.000 description 1
- 240000003433 Miscanthus floridulus Species 0.000 description 1
- 101100243377 Mus musculus Pepd gene Proteins 0.000 description 1
- 101100533725 Mus musculus Smr3a gene Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 101100380548 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) apg-2 gene Proteins 0.000 description 1
- 101100436302 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) apg-8 gene Proteins 0.000 description 1
- 101710149086 Nuclease S1 Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 241000357199 Octolasion lacteum Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 101100066912 Oryza sativa subsp. japonica FLO6 gene Proteins 0.000 description 1
- 101100408299 Oryza sativa subsp. japonica PIL13 gene Proteins 0.000 description 1
- 101150029183 PEP4 gene Proteins 0.000 description 1
- 101150023963 PIL1 gene Proteins 0.000 description 1
- 241000228143 Penicillium Species 0.000 description 1
- 241000228150 Penicillium chrysogenum Species 0.000 description 1
- 241000228129 Penicillium janthinellum Species 0.000 description 1
- 102100022239 Peroxiredoxin-6 Human genes 0.000 description 1
- 244000081757 Phalaris arundinacea Species 0.000 description 1
- 241000222393 Phanerochaete chrysosporium Species 0.000 description 1
- 241000235400 Phycomyces Species 0.000 description 1
- 241000209504 Poaceae Species 0.000 description 1
- 101100505672 Podospora anserina grisea gene Proteins 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102100024055 Prostate androgen-regulated mucin-like protein 1 Human genes 0.000 description 1
- 108010009736 Protein Hydrolysates Proteins 0.000 description 1
- 229920001131 Pulp (paper) Polymers 0.000 description 1
- 102100023588 RB1-inducible coiled-coil protein 1 Human genes 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101100149716 Rattus norvegicus Vcsa1 gene Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102100040969 Regulatory-associated protein of mTOR Human genes 0.000 description 1
- 241001509970 Reticulitermes <genus> Species 0.000 description 1
- 241000282849 Ruminantia Species 0.000 description 1
- 101150075334 SLG1 gene Proteins 0.000 description 1
- 101150037481 SMR1 gene Proteins 0.000 description 1
- 101100057245 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) ENA1 gene Proteins 0.000 description 1
- 101100333438 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) ENO1 gene Proteins 0.000 description 1
- 101100389403 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) ENO2 gene Proteins 0.000 description 1
- 101100191082 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GLC7 gene Proteins 0.000 description 1
- 101100352598 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GPM1 gene Proteins 0.000 description 1
- 101100123443 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HAP4 gene Proteins 0.000 description 1
- 101100071588 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HSP12 gene Proteins 0.000 description 1
- 101100286750 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) ILV2 gene Proteins 0.000 description 1
- 101100288519 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) LCB5 gene Proteins 0.000 description 1
- 101100075458 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) LRE1 gene Proteins 0.000 description 1
- 101100078102 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MSN2 gene Proteins 0.000 description 1
- 101100078103 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) MSN4 gene Proteins 0.000 description 1
- 101100293632 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) NBP2 gene Proteins 0.000 description 1
- 101100136444 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) PGK1 gene Proteins 0.000 description 1
- 101100256977 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) SIP4 gene Proteins 0.000 description 1
- 101100477706 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) SLN1 gene Proteins 0.000 description 1
- 101100120905 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) TDH1 gene Proteins 0.000 description 1
- 101100174606 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) TDH2 gene Proteins 0.000 description 1
- 101100174613 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) TDH3 gene Proteins 0.000 description 1
- 101100046763 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) TPI1 gene Proteins 0.000 description 1
- 101100428878 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) WHI2 gene Proteins 0.000 description 1
- 101100156780 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) WSC2 gene Proteins 0.000 description 1
- 101100156781 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) WSC3 gene Proteins 0.000 description 1
- 101100376036 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) YDC1 gene Proteins 0.000 description 1
- 244000206963 Saccharomyces cerevisiae var. diastaticus Species 0.000 description 1
- 241000582914 Saccharomyces uvarum Species 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 241000233671 Schizochytrium Species 0.000 description 1
- 241000235346 Schizosaccharomyces Species 0.000 description 1
- 241000235347 Schizosaccharomyces pombe Species 0.000 description 1
- 101100436308 Schizosaccharomyces pombe (strain 972 / ATCC 24843) taf1 gene Proteins 0.000 description 1
- 241001123650 Schwanniomyces occidentalis Species 0.000 description 1
- 241001123649 Schwanniomyces polymorphus Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102100039988 Serine/threonine-protein kinase ULK1 Human genes 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 102100027721 Small glutamine-rich tetratricopeptide repeat-containing protein beta Human genes 0.000 description 1
- 241000746413 Spartina Species 0.000 description 1
- 241000519995 Stachys sylvatica Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 101001091268 Streptomyces hygroscopicus Hygromycin-B 7''-O-kinase Proteins 0.000 description 1
- 102100029338 Suppressor of SWI4 1 homolog Human genes 0.000 description 1
- 101150032817 TPI1 gene Proteins 0.000 description 1
- 108010006785 Taq Polymerase Proteins 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 241000751880 Tetrapisispora blattae Species 0.000 description 1
- 241000183045 Tetrapisispora phaffii Species 0.000 description 1
- 241000228178 Thermoascus Species 0.000 description 1
- 241001647802 Thermobifida Species 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 241000233675 Thraustochytrium Species 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 108700029229 Transcriptional Regulatory Elements Proteins 0.000 description 1
- 102100031873 Transcriptional coactivator YAP1 Human genes 0.000 description 1
- 241000223261 Trichoderma viride Species 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- 108010028230 Trp-Ser- His-Pro-Gln-Phe-Glu-Lys Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100028060 Ubiquitin-like-conjugating enzyme ATG10 Human genes 0.000 description 1
- 241000500449 Vanderwaltozyma yarrowii Species 0.000 description 1
- 102100027543 WD repeat domain phosphoinositide-interacting protein 1 Human genes 0.000 description 1
- 102100028959 Zinc finger protein ZPR1 Human genes 0.000 description 1
- 241001231403 [Nectria] haematococca Species 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000002154 agricultural waste Substances 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 229940126575 aminoglycoside Drugs 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000005016 bacterial cellulose Substances 0.000 description 1
- 239000010905 bagasse Substances 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 235000013405 beer Nutrition 0.000 description 1
- 239000003782 beta lactam antibiotic agent Substances 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 235000008429 bread Nutrition 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 229920003090 carboxymethyl hydroxyethyl cellulose Polymers 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 235000013339 cereals Nutrition 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 230000000112 colonic effect Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 239000013256 coordination polymer Substances 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 239000005549 deoxyribonucleoside Substances 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 101150059880 dsdA gene Proteins 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 108010092450 endoglucanase Z Proteins 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 238000003205 genotyping method Methods 0.000 description 1
- 125000002791 glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- 101150084612 gpmA gene Proteins 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 230000002363 herbicidal effect Effects 0.000 description 1
- 239000004009 herbicide Substances 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 101150029559 hph gene Proteins 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- GRRNUXAQVGOGFE-NZSRVPFOSA-N hygromycin B Chemical compound O[C@@H]1[C@@H](NC)C[C@@H](N)[C@H](O)[C@H]1O[C@H]1[C@H]2O[C@@]3([C@@H]([C@@H](O)[C@@H](O)[C@@H](C(N)CO)O3)O)O[C@H]2[C@@H](O)[C@@H](CO)O1 GRRNUXAQVGOGFE-NZSRVPFOSA-N 0.000 description 1
- 229940097277 hygromycin b Drugs 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 235000000396 iron Nutrition 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000012978 lignocellulosic material Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- ZLNQQNXFFQJAID-UHFFFAOYSA-L magnesium carbonate Chemical compound [Mg+2].[O-]C([O-])=O ZLNQQNXFFQJAID-UHFFFAOYSA-L 0.000 description 1
- 239000001095 magnesium carbonate Substances 0.000 description 1
- 229910000021 magnesium carbonate Inorganic materials 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 238000007620 mathematical function Methods 0.000 description 1
- 239000012533 medium component Substances 0.000 description 1
- 238000012269 metabolic engineering Methods 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- XKKRQPPGOROKBD-LMMOQWNQSA-N n-[(e)-[(9ar)-2,3,4,6,7,8,9,9a-octahydroquinolizin-1-ylidene]methyl]acetamide Chemical compound C1CCC[C@@H]2C(=C/NC(=O)C)/CCCN21 XKKRQPPGOROKBD-LMMOQWNQSA-N 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- OQUKIQWCVTZJAF-UHFFFAOYSA-N phenol;sulfuric acid Chemical compound OS(O)(=O)=O.OC1=CC=CC=C1 OQUKIQWCVTZJAF-UHFFFAOYSA-N 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 230000019525 primary metabolic process Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- ULBKMFLWMIGVOJ-CFXUUZMDSA-M propicillin potassium Chemical compound [K+].N([C@@H]1C(N2[C@H](C(C)(C)S[C@@H]21)C([O-])=O)=O)C(=O)C(CC)OC1=CC=CC=C1 ULBKMFLWMIGVOJ-CFXUUZMDSA-M 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000030788 protein refolding Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000026206 response to starvation Effects 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 239000002342 ribonucleoside Substances 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 230000001523 saccharolytic effect Effects 0.000 description 1
- 238000009938 salting Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 101150101769 sip5 gene Proteins 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000007974 sodium acetate buffer Substances 0.000 description 1
- 239000011122 softwood Substances 0.000 description 1
- 238000010563 solid-state fermentation Methods 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000001384 succinic acid Substances 0.000 description 1
- ZDXMLEQEMNLCQG-UHFFFAOYSA-N sulfometuron methyl Chemical group COC(=O)C1=CC=CC=C1S(=O)(=O)NC(=O)NC1=NC(C)=CC(C)=N1 ZDXMLEQEMNLCQG-UHFFFAOYSA-N 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 101150107181 tax-4 gene Proteins 0.000 description 1
- 101150063973 tdh1 gene Proteins 0.000 description 1
- 101150003389 tdh2 gene Proteins 0.000 description 1
- 101150088047 tdh3 gene Proteins 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000005809 transesterification reaction Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 1
- 239000012137 tryptone Substances 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 239000007222 ypd medium Substances 0.000 description 1
- 150000008495 β-glucosides Chemical class 0.000 description 1
- 239000002132 β-lactam antibiotic Substances 0.000 description 1
- 229940124586 β-lactam antibiotics Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/02—Preparation of oxygen-containing organic compounds containing a hydroxy group
- C12P7/04—Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic
- C12P7/06—Ethanol, i.e. non-beverage
- C12P7/08—Ethanol, i.e. non-beverage produced as by-product or from waste or cellulosic material substrate
- C12P7/10—Ethanol, i.e. non-beverage produced as by-product or from waste or cellulosic material substrate substrate containing cellulosic material
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/80—Vectors or expression systems specially adapted for eukaryotic hosts for fungi
- C12N15/81—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts
- C12N15/815—Vectors or expression systems specially adapted for eukaryotic hosts for fungi for yeasts for yeasts other than Saccharomyces
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2405—Glucanases
- C12N9/2434—Glucanases acting on beta-1,4-glucosidic bonds
- C12N9/2437—Cellulases (3.2.1.4; 3.2.1.74; 3.2.1.91; 3.2.1.150)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
- C12N9/2402—Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
- C12N9/2405—Glucanases
- C12N9/2434—Glucanases acting on beta-1,4-glucosidic bonds
- C12N9/2445—Beta-glucosidase (3.2.1.21)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P39/00—Processes involving microorganisms of different genera in the same process, simultaneously
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P7/00—Preparation of oxygen-containing organic compounds
- C12P7/02—Preparation of oxygen-containing organic compounds containing a hydroxy group
- C12P7/04—Preparation of oxygen-containing organic compounds containing a hydroxy group acyclic
- C12P7/06—Ethanol, i.e. non-beverage
- C12P7/14—Multiple stages of fermentation; Multiple types of microorganisms or re-use of microorganisms
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01004—Cellulase (3.2.1.4), i.e. endo-1,4-beta-glucanase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01021—Beta-glucosidase (3.2.1.21)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y302/00—Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
- C12Y302/01—Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)
- C12Y302/01091—Cellulose 1,4-beta-cellobiosidase (3.2.1.91)
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
Definitions
- Lignocellulosic biomass is widely recognized as a promising source of raw material for production of renewable fuels and chemicals.
- the primary obstacle impeding the more widespread production of energy from biomass feedstocks is the general absence of low-cost technology for overcoming the recalcitrance of these materials to conversion into useful fuels.
- Lignocellulosic biomass contains carbohydrate fractions (e.g., cellulose and hemicellulose) that can be converted into ethanol. In order to convert these fractions, the cellulose and hemicellulose must ultimately be converted or hydrolyzed into monosaccharides; it is the hydrolysis that has historically proven to be problematic.
- Biomass processing schemes involving enzymatic or microbial hydrolysis commonly involve four biologically mediated transformations: (1) the production of saccharolytic enzymes (cellulases and hemicellulases); (2) the hydrolysis of carbohydrate components present in pretreated biomass to sugars; (3) the fermentation of hexose sugars (e.g., glucose, mannose, and galactose); and (4) the fermentation of pentose sugars (e.g., xylose and arabinose).
- saccharolytic enzymes cellulases and hemicellulases
- carbohydrate components present in pretreated biomass to sugars
- hexose sugars e.g., glucose, mannose, and galactose
- pentose sugars e.g., xylose and arabinose
- CBP consolidated bioprocessing
- CBP offers the potential for lower cost and higher efficiency than processes featuring dedicated cellulase production.
- the benefits result in part, from avoided capital costs, substrate and other raw materials, and utilities associated with cellulase production.
- several factors support the realization of higher rates of hydrolysis, and hence reduced reactor volume and capital investment using CBP, including enzyme-microbe synergy and the use of thermophilic organisms and/or complexed cellulase systems.
- cellulose-adherent cellulolytic microorganisms are likely to compete successfully for products of cellulose hydrolysis with non-adhered microbes, e.g., contaminants, which could increase the stability of industrial processes based on microbial cellulose utilization.
- Endoglucanases (1,4- ⁇ -D-glucan 4-glucanohydrolase; EC 3.2.1.4). Endoglucanases cut at random in the cellulose polysaccharide chain of amorphous cellulose, generating oligosaccharides of varying lengths and consequently new chain ends.
- exoglucanases including cellodextrinases (1,4- ⁇ -D-glucan glucanohydrolases; EC 3.2.1.74) and cellobiohydrolases (1,4- ⁇ -D-glucan cellobiohydrolases; EC 3.2.1.91), Exoglucanases act in a processive manner on the reducing or non-reducing ends of cellulose polysaccharide chains, liberating either glucose (glucanohydrolases) or cellobiose (cellobiohydrolase) as major products. Exogfucanases can also act on microcrystalline cellulose, presumably peeling cellulose chains from the microcrystalline structure.
- the third type are ⁇ -glucosidases ( ⁇ -glucoside glucohydrolases; EC 3.2.1.21). ⁇ -Glucosidases hydrolyze soluble cellodextrins and cellobiose to glucose units.
- Bakers' yeast Saccharomyces cerevisiae remains the preferred micro-organism for the production of ethanol (Hahn-Hägerdal, B., et al., Adv. Biochem. Eng. Biotechnol. 73, 53-84 (2001)).
- Favorable attributes of this microbe include (i) high productivity at close to theoretical yields (0.51 g ethanol produced/g glucose used), (ii) high osmo- and ethanol tolerance, (iii) natural robustness in industrial processes, and (iv) being generally regarded as safe (GRAS) due to its long association with wine and bread making, and beer brewing.
- GRAS safe
- S. cerevisiae exhibits tolerance to inhibitors commonly found in hydrolyzates resulting from biomass pretreatment.
- S. cerevisiae One major shortcoming of S. cerevisiae is its inability to utilize complex polysaccharides such, as cellulose, or its break-down products, such as cellobiose and cellodextrins.
- complex polysaccharides such as cellulose
- cellobiose and cellodextrins such as cellobiose and cellodextrins.
- heterologous cellulases from bacterial and fungal sources have been transferred to S. cerevisiae , enabling the degradation of cellulosic derivatives (Van Rensburg, P., et al. Yeast 14, 67-76 (1998)), or growth on cellobiose (Van Rooyen, R., et al., J. Biotech. 120, 284-295 (2005)); McBride, J. E., et al., Enzyme Microb. Techol.
- S. cerevisiae Another major shortcoming of the use of S. cerevisiae is that externally produced cellulases function optimally at a higher temperature than the temperature at which S. cerevisiae function optimally. Thus, either the processing must be carried out in a two step process at two different temperatures or one temperature can be selected where both processes function to some extent, but at least one of the processes does not occur at optimal efficiency.
- the present invention provides for heterologous expression of wild-type and codon-optimized combinations of heterologous cellulases in yeast that allows efficient production of ethanol from cellulose sources.
- the invention also provides for expression of such heterologous cellulases in thermotolerant yeast and methods of using such transformed yeast for ethanol production.
- the present invention is directed to cellulytic host cells.
- the host cells of the invention expressing heterologous cellulases and are able to produce ethanol from cellulose.
- the invention provides a transformed thermotolerant yeast, host ceil comprising at least one heterologous polynucleotide comprising a nucleic acid encoding a cellulase, wherein the yeast host cell is capable of producing ethanol when grown using cellulose as a carbon source.
- the invention provides a transformed thermotolerant yeast host cell comprising: (a) at least one heterologous polynucleotide comprising a nucleic acid which encodes an endoglucanase; (b) at least, one heterologous polynucleotide comprising a nucleic acid which encodes a ⁇ -glucosidase; (c) at least one heterologous polynucleotide comprising a nucleic acid which encodes a first cellobiohydrolase; and (d) at least one heterologous polynucleotide comprising a nucleic acid which encodes a second cellobiohydrolase.
- the invention provides a transformed yeast host cell comprising: (a) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is an endoglucanase; (b) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a ⁇ -glucosidase; (c) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a first cellobiohydrolase; and (d) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a second cellobiohydrolase, wherein at least two of the cellulases are secreted by the cell.
- the invention provides a transformed yeast host cell comprising at least six heterologous polynucleotides, wherein each heterologous polynucleotide comprises a nucleic acid which encodes a cellulase.
- the invention provides a transformed yeast host cell comprising at least four heterologous polynucleotides, wherein each heterologous polynucleotide comprises a nucleic acid which encodes an endoglucanase.
- the invention provides a co-culture comprising at least two yeast host cells wherein (a) at least one of the host cells comprises a first heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is an endoglucanase; (b) at least one of the host cells comprises a second heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a ⁇ -glucosidase; (c) at least one of the host cells comprises a third heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a first cellobiohydrolase; (d) at least one of the host cells comprises a fourth heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a second cellobiohydrolase; wherein the first polynucleotide, the second poly
- the cellulose carbon source is insoluble cellulose, crystalline cellulose, cellulose derived from lignocellulose, hardwood, phosphoric acid swollen cellulose or microcrystalline cellulose.
- the host cells of the invention comprise a heterologous polynucleotide comprising a nucleic acid encoding a first cellobiohydrolase, a polynucleotide comprising a nucleic acid encoding an endoglucanase, a polynucleotide comprising a nucleic acid encoding a ⁇ -glucosidase and/or a polynucleotide comprising a nucleic acid encoding a second cellobiohydrolase.
- the cellulase, endoglucanase, ⁇ -glucosidase or cellobiohydrolase is a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R.
- speratus Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas firni, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- the cellobiohydrolase is an H. grisea CBH1, a T. aurantiacus CBH1, a T. emersonii CBH1, a T. reesei CBH1, a T. emersonii CBH2, a C. lucknowense CBH2 or a T. reesei CBH2.
- the heterologous polynucleotide comprising a nucleic acid which encodes a cellobiohydrolase encodes a fusion protein comprising a cellobiohydrolase and a cellulose binding module (CBM).
- the CBM is the CBM of T.
- the CBM is fused to the cellobiohydrolase via a linker sequence.
- the host cell expresses a first and a second cellobiohydrolase, wherein the first cellobiohydrolase is a T. emersonii CBH1 and CBD fusion, and the second cellobiohydrolase is a C. lucknowense CBH2b.
- the ⁇ -glucosidase is a S. fibuligera ⁇ -glucosidase.
- the endoglucanase is a C. formosanus endoglucanase.
- the endoglucanase is a T. reesei endoglucanase, e.g. T. reesei EG2.
- At least one or at least two of the cellulases is tethered. In other embodiments of the invention, at least one of the cellulases is secreted. In another embodiment, at least one of the cellulases is tethered and at least one of the cellulases is secreted. In another embodiment, all of the cellulases are secreted.
- the nucleic acid encoding, a cellulase is codon optimized.
- the host cell can be a thermotolerant host cell.
- the host cell is a Issatchenkia orientalis, Pichia mississippiensis, Pichia mexicana, Pichia farinosa, Clavispora opuntiae, Clavispora lusitaniae, Candida mexicana, Hansenula polymorpha or Kluyveromyces host cell.
- the host cell is a K. lactis or K. maximus host cell.
- the thermotolerant host cell is an S. cerevisiae host cell, wherein the S. cerevisiae is selected to be thermotolerant.
- the host cell can be an oleaginous yeast cell.
- the oleaginous yeast cell is a Blakeslea, Candida, Cryptococcus, Cunninghamella, Lipomyces, Mortierella, Mucor, Phycomces, Pythium, Rhodosporidium, Rhodotorula, Trichosporon or Yarrowia cell.
- the host cell is a Saccharomyces cerevisiae cell.
- the host cell can produce ethanol from cellulose at temperatures above about 30° C., 35° C., 37° C., 42° C., 45° C. or 50° C.
- the host cell can produce ethanol at a rate of at least about 10 mg per hour per liter, at least about 30 mg per hour per liter, at least about 40 mg per hour per liter, at least about 50 mg per hour per liter, at least about 60 mg per hour per liter, at least about 70 mg per hour per liter, at least about 80 mg per hour per liter, at least about 90 mg per hour per liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, at least about 500 mg per hour per liter, at least about 600 mg per hour per liter, at least about 700 mg per hour per liter, at least about 800 mg per hour per liter, at least about 900 mg per hour per liter, or at least about 1 g per hour per liter.
- the present invention also provides methods of using the host cells and co-cultures of the invention.
- the present invention is also directed to a method for hydrolyzing a cellulosic substrate, comprising contacting said cellulosic substrate with a host cell or co-culture of the invention.
- the invention is also directed to a method of fermenting cellulose comprising culturing a host cell or co-culture of the invention in medium that contains insoluble cellulose under suitable conditions for a period sufficient to allow saccharification and fermentation of the cellulose.
- the methods further comprise contacting, the cellulosic substrate with externally produced cellulase enzymes.
- the cellulosic substrate is a lignocellulosic biomass selected from the group consisting of grass, switch grass, cord grass, rye grass, reed canary grass, miscanthus , sugar-processing residues, sugarcane bagasse, agricultural wastes, rice straw, rice hulls, barley straw, corn cobs, cereal straws wheat straw, canola straw, oat straw, oat hulls, coni fiber, stover, soybean stover, corn stover, forestry wastes, recycled wood pulp fiber, paper sludge, sawdust, hardwood, softwood, Agave, and combinations thereof.
- lignocellulosic biomass selected from the group consisting of grass, switch grass, cord grass, rye grass, reed canary grass, miscanthus , sugar-processing residues, sugarcane bagasse, agricultural wastes, rice straw, rice hulls, barley straw, corn cobs, cereal straws wheat straw, canola straw, oat straw,
- the host cell or co-culture produces ethanol.
- the ethanol can be produced at a rate of at least about 10 mg per hour per liter, at least, about 30 mg per hour per liter, at least about 40 mg per hour per liter, at least about 50 mg per hour per liter, at least about 60 mg per hour per liter, at least about 70 mg per hour per liter, at least about 80 mg per hour per liter, at least about 90 mg per hour pea-liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, at least about 500 mg per hour per liter, at least about 600 mg per hour per liter, at least about 700 mg per hour per liter, at least about 800 mg per hour per liter, at least about 900 mg per hour per liter, or at least about 1 g per hour per liter.
- the host cell or co-cultures contact a cellulosic substance at a temperature of at least about 37° C., least about 42° C., from about 42° C. to about. 45° C., or from about 42° C. to about 50° C.
- FIG. 1 shows an image of a CMC plate assay to detect endoglucanase I activity in K. lactis (colonies numbered 1-8) and K. maximus strains (colonies numbered 9-16) transformed with heterologous cellulases. Strains 8 and 16 are untransformed negative controls. The plate on the left shows colony growth, and the plate on the right shows CMCase activity, indicated by the presence of a clearance zone. Clearance zones appear as white spots in the image.
- FIG. 2 depicts the results of an MU-lac assay to detect CBH1 activity in K. maximus strains transformed with heterologous cellulases.
- FIG. 3 depicts the percent of Avicel converted by several strains of K. maximus expressing heterologous cellulases.
- FIG. 4 depicts the ethanol production/consumption from Avicel by several strains of K. maximus expressing heterologous cellulases.
- FIG. 5 depicts the growth of S. cerevisiae expressing heterologous cellulases on bacterial microcrystalline cellulose (BMCC).
- BMCC bacterial microcrystalline cellulose
- FIG. 6 depicts the ethanol production from Avicel by an S. cerevisiae strain expressing heterologous cellulases.
- FIG. 7 depicts the ethanol production from pretreated hardwood (5% based on a dry weight percentage) by an S. cerevisiae strain expressing heterologous cellulases.
- FIG. 8 depicts the ethanol production from pretreated hardwood (5% based on a dry weight percentage) by an S. cerevisiae expressing heterologous cellulases in the presence of various concentrations of exogenously added cellulases.
- FIG. 9 depicts the ethanol production from Avicel by MO288 (circles) and a control strain (triangles) in both YP media and YNB media.
- FIG. 10 depicts the ethanol yield from Avicel (15% based on a dry weight percentage) by a small scale simultaneous saccharification and fermentation (SSF) process using S. cerevisiae supplemented with external cellulases.
- SSF simultaneous saccharification and fermentation
- the yield from a yeast strain expressing heterologous cellulases (MO288) is compared to the yield from a control strain (MO249) at a variety of external cellulase concentrations over 150 hours. (100% cellulase loading indicates 25 mg/g total solids; initial solids concentration was 15%.)
- FIG. 11 depicts the theoretical ethanol yield from a simultaneous saccharification and fermentation (SSF) process using S. cerevisiae supplemented with external cellulases.
- SSF simultaneous saccharification and fermentation
- FIG. 12 illustrates the predicted cellulase enzyme savings based on ethanol yield at 168 hours of simultaneous saccharification and fermentation (SSF) process.
- FIG. 13 shows the activity of an artificial cellulase in the Avicel conversion assay as described in Example 9.
- the MO429 strain was transformed the CBH1 consensus sequence “CBH1cons,” and the MO419 strain was transformed with empty pMU451 vector as a negative control. Descriptions of other strains are found in Table 8 of Example 9.
- FIG. 14 demonstrates the activity of yeast expressing various combinations of CBH1 and CBH2 enzymes on Avicel as described in Example 10.
- FIG. 15 demonstrates the activity of yeast expressing various cellulase enzymes on Avicel as described in Example 10.
- FIG. 16 depicts the ethanol production front Avicel by a co-culture of live S. cerevisiae strains expressing heterologous cellulases.
- FIG. 17 depicts the ethanol production from Avicel by a co-culture of four S. cerevisiae strains expressing heterologous cellulases as well as the ethanol production from strain MO288, which is expressing four cellulases.
- FIG. 18 depicts the ethanol production from Avicel by a co-culture of four S. cerevisiae strains expressing heterologous cellulases in combination with externally added cellulase.
- FIG. 19 depicts the calculated enzyme savings using a co-culture of four S. cerevisiae strains expressing heterologous cellulases or MO288 as compared to untransformed S. cerevisiae.
- FIG. 20 depicts the xylose utilization and ethanol production of M0509 freezer stock, YPX-isolate and YPD-isolate.
- FIG. 21 depicts the growth of M1105 (labeled “colony C2”) and MO1046 in the presence of tire same medium and 8 g/L acetate at 40° C.
- FIG. 22 depicts the ethanol production by M1105 (triangles) and M1088 (squares) on 18% TS MS419.
- the experiment with M1105 had 10% lower enzyme dose and half the inoculated cell density, but produced a higher ethanol titer.
- the experiment with MO1105 was performed at 40° C., and the experiment with M1088 was performed at 35° C.
- FIG. 23 depicts the ethanol production of M1105 where the fermentation was only inoculated with 0.15 g/L DCW and resulted in some sugar accumulation and 29 g/L ethanol.
- FIG. 24 depicts the ethanol production of M1254 is standard IFM (circles) and low ammonium IFM (squares) conditions.
- FIG. 25 depicts the specific growth rate of single colonies compared to M1254 and M1339 on complex xylose medium supplemented with a synthetic inhibitor mixture (which included 8 g/L acetate) at 40° C.
- the single colonies were screened at the same conditions as the evolution occurred.
- Colony C1 was renamed M1360.
- FIG. 26 depicts the fermentation performance of M1360 at 40° C. on industrially relevant fermentation medium supplemented with glucose. The fermentation was inoculated with 60 mg/L dry cell weight of M1360.
- FIG. 27 depicts the ethanol production in SSF runs on PHW (1827 solids, unwashed MS149) at 35° C. and 40° C. by several strains. All reactions were loaded with 4 mg/g “zoomerase” (Novozyme 22c).
- FIG. 28 depicts cultures spotted on SC URA plates containing 0.2% of either CMC or lichenin or barley- ⁇ -glucan.
- the top two row's of each plate were Y294 based cultures, and the bottom two rows contained MO749 based strains. Numbers indicate the plasmid contained by each strain.
- pMU471 contains the C.f.EG and served as positive control. Plates were incubated for 24 hours at 30° C. (pictured on the left), after which colonies were washed of and the plates were stained with 0.1% congo red and destained with 1% NaCl (pictured on the right),
- FIG. 29 depicts SDS-PAGE analysis of the supernatants of Cel5 cellulase producing strains.
- a strain containing a plasmid with no foreign gene was used as reference strain (REF).
- the strain containing the plasmid pMU471 expressing C.f.EG, tire most successful EG previously found was also included.
- FIG. 30 depicts the activity of strains expressing EGs on (A) PASC (2 hours) and (R) avicel (24 hours).
- a strain containing a plasmid with no foreign gene was used as reference strain (REF) and the strain expressing C.f.EG (pMU471) was included as positive control.
- FIG. 31 depicts the distribution of avicel conversion ability of yeast supernatants from transformation with TrEG2 and additional TeCBH1w/TrCBD. M1088 conversion is presented as a dark vertical line, and the dotted lines flanking this line represent the standard deviation of the measurement.
- FIG. 32 depicts the conversion of Avicel in the HTP avicel assay (48 hour time point) by supernatants of cellulase expressing yeast strains.
- M0509 is the negative control expressing no cellulases.
- Strain 1088 is the parental strain expressing only CBH1, CBH12, and BGL, whereas 1179, 1180, and 1181 are transformants of 1088 also expressing TrEG2.
- FIG. 33 depicts ethanol production in paper sludge CBP/SSF with cellulolytic strain M1403 and non-cellulolytic background strain M1254 with various amounts of commercial enzyme supplementation.
- FIG. 34 depicts fermentation of two types of paper sludge by CBP yeast. (M1179) and a control strain M0509, not expressing cellulases. Experimental conditions; 18% solids, cells loaded at 10 or 1 g/L, pH 5.5, Temp: 35 C, 1 mg/g BGL and 1 mg/g Xyl loaded.
- BGL AB Enzymes EL2Q08044L BGL preparation
- Xyl AB Enzymes EL2007020L xylanase preparation.
- FIG. 35 depicts the performance of cellulolytic yeast strain M0963 and non-cellulolytic control strain (M0509) on 22% unwashed solids of pretreated hardwood (PHW) (MS149) at various external cellulase concentrations.
- Experimental conditions 22% solids fed batch, pH 5.4, temperature 35° C., all enzyme protein (EP) was “zoomerase” (Novozymes 22C).
- FIG. 36 depicts the performance of cellulolytic yeast strain MI284 on 30% solids of washed pretreated hardwood at various initial cell loadings.
- Zoomerase Novozymes 22C cellulase preparation
- BGL AB Enzymes EL2008Q44L BGL preparation
- Xyl AB Enzymes EL2007020L xylanase preparation
- Pectinase Genencor Multifeet pectinase FE.
- FIG. 37 depicts the ethanol production in washed corn stover CBP/SSF with cellulolytic strain M1284 and non-cellulolytic background strain M0509 with various amounts of commercial enzyme supplementation.
- Experimental conditions 18%; solids fed batch, 10 g/l cell inoculation, pH 5.0 and temperature 35° C., 1 mg/g BGL and 1 mg/g xylanase loaded in each case.
- BGL AB Enzymes EL2008044L BGL preparation
- Xyl AB Enzymes EL2007020L xylanase preparation.
- FIG. 38A depicts the activity on Avicel of yeast culture supernatants expressing different CBM genes.
- the host strain was either Y294 or M0749.
- the CBH1 genes are: Te, Talaromyces emersonii ; Ct, Chaetomium thermophilum : At, Acremonium thermophilum ; Tr, Trichoderma reesei ; Hg, Humicola grisea : Ta, Thermoascus aurantiacus .
- the plasmid names are indicated.
- Yeast were cultivated in YPD in triplicate for 3 days. The data are means ⁇ standard deviation.
- FIG. 38B depicts the activity on Avicel of yeast culture supernatants expressing different CBH1 genes.
- the host strain is M0749.
- the CBM genes are: Te, Talaromyces emersonii ; Ct, Chaetomium thermophilum ; At, Acremonium thermophilum ; Tr, Trichoderma reesei : Hg, Humicola grisea ; Ta, Thermoascus aurantiacus .
- the plasmid names are indicated.
- Yeast were cultivated in YPD in triplicate for 3 days. The data are means ⁇ standard deviation.
- FIG. 38C depicts the activity on MU Lac of yeast culture supernatants expressing different CBM genes.
- the host strain is Y294.
- the CBM genes are: Te, Talaromyces emersonii : Ct, Chaetomium thermophilum ; At, Acremonium thermophilum ; Tr, Trichoderma reesei : Hg, Humicola grisea : Ta, Thermoascus aurantiacus .
- the plasmid names are indicated.
- Yeast were cultivated in YPD in triplicate for 3 days. The data are means ⁇ standard deviation.
- FIG. 38D depicts the activity on MULac of yeast culture supernatants expressing different CBM genes.
- the host strain is M0749.
- the CBM genes are: Te, Talaromyces emersonii ; Ct, Chaetomium thermophilum : At, Acremonium thermophilum ; Tr, Trichoderma reesei : Hg, Humicola grisea : Ta, Thermoascus aurantiacus .
- the plasmid names are indicated.
- Yeast were cultivated in YPD in triplicate for 3 days. The data are means ⁇ standard deviation.
- FIG. 38E depicts the activity on estimated CBM concentration (mg/L) based on MULac.
- the host strain is Y294.
- the CBH1 genes are: 7V, Talaromyces emersonii : Ct, Chaetomium thermophilum : At, Acremonium thermophilum : Tr, Trichoderma reesei : Hg, Humicola grisea : Ta, Thermoascus aurantiacus .
- the plasmid names are indicated.
- Yeast were cultivated in YPD in triplicate for 3 days. The data are means ⁇ standard deviation.
- FIG. 38F depicts the activity on estimated CBH1 concentration (mg/L) based on MULae.
- the host is M0749.
- the CBH1 genes are: Te, Talaromyces emersonii ; Ct, Chaetomium thermophilum , At, Acremonium thermophilum ; Tr, Trichoderma reesei ; Hg, Humicola grisea ; Ta, Thermoascus aurantiacus .
- the plasmid names are indicated.
- Yeast were cultivated in YPD in triplicate for 3 days. The data are means ⁇ standard deviation.
- FIG. 39 show's the genes modified in yeast, strain M0509.
- FIG. 40 shows the yeast strains used to contract M0509 and the relevant genetic modifications.
- FIG. 41 show's the genealogy of yeast strain M1105.
- FIG. 42 show's the genealogy of yeast strain M1254.
- the disclosed methods and materials are useful generally in the field of engineered yeast.
- a “vector,” e.g., a “plasmid” or “YAC” (yeast artificial chromosome) refers to an extrachromosomal element often carrying one or more genes that are not part of the central metabolism of the cell, and is usually in the form of a circular double-stranded DNA molecule.
- Such elements may be autonomously replicating sequences, genome integrating sequences, phage or nucleotide sequences, linear, circular, or supercoiled, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a promoter fragment and DNA sequence for a selected gene product along with appropriate 3′ untranslated sequence into a cell.
- the plasmids or vectors of the present invention are stable and self-replicating.
- An “expression vector” is a vector that is capable of directing the expression of genes to which it is operably associated.
- heterologous refers to an element of a vector, plasmid or host cell that is derived from a source other than the endogenous source.
- a heterologous sequence could be a sequence that is derived from a different gene or plasmid from the same host, from a different strain of host cell, or from an organism of a different taxonomic group (e.g., different kingdom, phylum, class, order, family genus, or species, or any subgroup within one of these classifications).
- taxonomic group e.g., different kingdom, phylum, class, order, family genus, or species, or any subgroup within one of these classifications.
- heterologous is also used synonymously herein with the term “exogenous.”
- domain refers to a part of a molecule or structure that shares common physical or chemical features, for example hydrophobic, polar, globular, helical domains or properties, e.g., a DNA binding domain or an ATP binding domain. Domains can be identified by their homology to conserved structural or functional motifs. Examples of cellobiohydrolase (CBH) domains include the catalytic domain (CD) and the cellulose binding domain (CBD).
- CBH cellobiohydrolase
- nucleic acid is a polymeric compound comprised of covalently linked subunits called nucleotides.
- Nucleic acid includes polyribonucleic acid (RNA) and polydeoxyribonucleic acid (DNA), both of which may be single-stranded or double-stranded.
- DNA includes cDNA, genomic DNA, synthetic DNA, and semi-synthetic DNA.
- isolated nucleic acid molecule refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; “RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxyeytidine; “DNA molecules”), or any phosphoester analogs thereof, such as phosphorothioates and thioesters, in either single stranded form, or a double-stranded helix. Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible.
- nucleic acid molecule refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms.
- this term includes double-stranded DNA found, inter alia, in linear or circular DNA molecules (e.g., restriction fragments), plasmids, and chromosomes.
- sequences may be described herein according to the normal convention of giving only the sequence in the 5′ to 3′ direction along the non-transcribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA).
- a “gene” refers to an assembly of nucleotides that encode a polypeptide, and includes cDNA and genomic DNA nucleic acids. “Gene” also refers to a nucleic acid fragment that expresses a specific protein, including intervening sequences (introns) between individual coding segments (exons), as well as regulatory sequences preceding (5′ non-coding sequences) and following (3′ non-coding sequences) the coding sequence. “Native gene” refers to a gene as found in nature with its own regulatory sequences.
- a nucleic acid molecule is “hybridizable” to another nucleic acid molecule, such as a cDNA, genomic DNA, or RNA, when a single stranded form of the nucleic acid molecule can anneal to the other nucleic acid molecule under the appropriate conditions of temperature and solution ionic strength.
- Hybridization and washing conditions are well known and exemplified, e.g., in Sambrook, J., Fritsch, E. F. and Maniatis, T. MOLECULAR CLONING: A LABORATORY MANUAL, Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor (1989), particularly Chapter 11 and Table 11.1 therein (hereinafter “Maniatis”, entirely incorporated herein by reference).
- Stringency conditions can be adjusted to screen for moderately similar fragments, such as homologous sequences from distantly related organisms, to highly similar fragments, such as genes that duplicate functional enzymes from closely related organisms.
- Post-hybridization washes determine stringency conditions. One set of conditions uses a series of washes starting with 6 ⁇ SSC, 0.5% SDS at room temperature for 15 min, then repeated with 2 ⁇ SSC, 0.5% SDS at 45° C. for 30 min, and then repeated twice with 0.2 ⁇ SSC, 0.5% SDS at 50° C. for 30 min.
- washes are performed at higher temperatures in which the washes are identical to those above except for the temperature of the final two 30 min washes in 0.2 ⁇ SSC, 0.5% SDS are increased to 60° C.
- Another set of highly stringent conditions uses two final washes in 0.1 ⁇ SSC, 0.1% SDS at 65° C.
- An additional set of highly stringent conditions are defined by hybridization at 0.1 ⁇ SSC, 0.1% SDS, 65° C. and washed with 2 ⁇ SSC, 0.1% SDS followed by 0.1 ⁇ SSC, 0.1% SDS.
- Hybridization requires that the two nucleic acids contain complementary sequences, although depending on the stringency of the hybridization, mismatches between bases are possible.
- the appropriate stringency for hybridizing nucleic acids depends on the length of the nucleic acids and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the greater the value of Tm for hybrids of nucleic acids having those sequences.
- the relative stability (corresponding to higher Tm) of nucleic acid hybridizations decreases in the following order: RNA:RNA, DNA:RNA, DNA:DNA.
- equations for calculating Tm have been derived (see, e.g., Maniatis at 9.50-9.51).
- the position of mismatches becomes more important, and the length of the oligonucleotide determines its specificity Gee, e.g., Maniatis, at 11.7-11.8).
- the length for a hybridizable nucleic acid is at least about 10 nucleotides.
- a minimum length for a hybridizable nucleic acid is at least about 15 nucleotides; more preferably at least about 20 nucleotides; and most preferably the length is at least 30 nucleotides.
- the temperature and wash solution salt concentration may be adjusted as necessary according to factors such as length of tire probe.
- identity is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences.
- identity also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences.
- similarity between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide.
- Suitable nucleic acid sequences or fragments thereof encode polypeptides that, are at least about 70% to 75% identical to the anti no acid sequences reported herein, at least about 80%, 85%, or 90% identical to the amino acid sequences reported herein, or at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequences reported herein.
- Suitable nucleic acid fragments are at least about 70%, 75%, or 80% identical to the nucleic acid sequences reported herein, at least, about 80%, 85%, or 90% identical to the nucleic acid sequences reported herein, or at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequences reported herein.
- Suitable nucleic acid fragments not only have the above identities/similarities but typically encode a polypeptide having at least 50 amino acids, at least 100 amino acids, at least 150 amino acids, at least 200 amino acids, or at least 250 amino acids.
- a DNA or RNA “coding region” is a DNA or RNA molecule which is transcribed and/or translated into a polypeptide in a ceil in vitro or in vivo when placed under the control of appropriate regulatory sequences.
- Suitable regulatory regions refer to nucleic acid regions located upstream (5′ non-coding sequences), within, or downstream (3′ non-coding sequences) of a coding region, and which influence the transcription, RNA processing or stability, or translation of the associated coding region. Regulatory regions may include promoters, translation leader sequences, RNA processing site, effector binding site and stem-loop structure.
- a coding region can include, but is not limited to, prokaryotic regions, cDNA from mRNA, genomic DNA molecules, synthetic DNA molecules, or RNA molecules. If the coding region is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3′ to the coding region.
- isoform is a protein that has the same function as another protein but which is encoded by a different gene and may have small differences in its sequence.
- a “paralogue” is a protein encoded by a gene related by duplication within a genome.
- orthologue is gene from a different species that has evolved from a common ancestral gene by speciation. Normally, orthologues retain the same function in the course of evolution as the ancestral gene.
- ORF Open reading frame
- Promoter refers to a DNA fragment capable of controlling the expression of a coding sequence or functional RNA.
- a coding region is located 3′ to a promoter. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even comprise synthetic DNA segments. It is understood by those skilled in the art that different promoters may direct, the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental or physiological conditions. Promoters which cause a gene to be expressed in most cell types at most times are commonly referred to as “constitutive promoters”.
- a promoter is generally bounded at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background.
- a transcription initiation site (conveniently defined for example, by mapping with nuclease S1), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase.
- a coding region is “under the control” of transcriptional and translational control elements in a cell when RNA polymerase transcribes the coding region into mRNA, which is then trans-RNA spliced (if the coding region contains introns) and translated into the protein encoded by the coding region.
- Transcriptional and translational control regions are DNA regulatory regions, such as promoters, enhancers, terminators, and the like, that provide for the expression of a coding region in a host cell.
- polyadenylation signals are control regions.
- operably associated refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other.
- a promoter is operably associated with a coding region when it is capable of affecting the expression of that coding region (i.e., that the coding region is under the transcriptional control of the promoter).
- Coding regions can be operably associated to regulatory regions in sense or antisense orientation.
- expression refers to the transcription and stable accumulation of sense (mRNA) or antisense RNA derived from the nucleic acid fragment of the invention. Expression may also refer to translation of mRNA into a polypeptide,
- the present invention provides host cells expressing heterologous cellulases that can be effectively and efficiently utilized to produce ethanol from cellulose.
- the host cells can be a yeast.
- the yeast host cell can be, for example, from the genera Saccharomyces, Kluyveromyces, Candida, Pichia, Schizosaccharomyces, Hansenula, Kloeckera, Schwanniomyces , and Yarrowia .
- Yeast species as host cells may include, for example, S. cerevisiae, S. bulderi, S. barnetti, S. exiguus, S. uvarum, S. diastaticus, K. lactis, K.
- the yeast is selected from the group consisting of Saccharomyces cerevisiae, Schizzosaccharomyces pombe, Candida albicans, Pichia pastoris, Pichia stipitis, Yarrowia lipolytica, Hansenula polymorpha, Phaffia rhodozyma, Candida utilis, Arxula adeninivorans, Debaryomyces hansenii, Debaryomyces polymorphic, Schizosaccharomyces pombe and Schwanniomyces occidentalis .
- the yeast is Saccharomyces cerevisiae .
- the yeast is a thermotolerant Saccharomyces cerevisiae . The selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein.
- the host ceil Is an oleaginous cell.
- the oleaginous host cell can be an oleaginous yeast cell.
- the oleaginous yeast host cell can be front the genera Blakeslea, Candida, Cryptococcus , Cunninghamella, Lipomyces, Mortierella, Mucor, Phycomyces, Pythium, Rhodosporidium, Rhodotorula, Trichosporon or Yarrowia .
- the oleaginous host cell can be an oleaginous microalgae host cell.
- the oleaginous microalgea host cell can be front the genera Thraustochytrium or Schizochytrium. Biodiesel could then be produced from the triglyceride produced by the oleaginous organisms using conventional lipid transesterification processes.
- the oleaginous host cells can be induced to secrete synthesized lipids.
- Embodiments using oleaginous host ceils are advantageous because they can produce biodiesel from lignocellulosic feedstocks which, relative to oilseed substrates, are cheaper, can be grown more densely, show lower life cycle carbon dioxide emissions, and can be cultivated on marginal lands.
- the host cell is a thermotolerant host cell.
- Thermotolerant host cells can be particularly useful in simultaneous saccharification and fermentation processes by allowing externally produced cellulases and ethanol-producing host cells to perform optimally in similar temperature ranges.
- Thermotolerant host cells of the invention can include, for example, Issatchenkia orientalis, Pichia mississippiensis, Pichia mexicana, Pichia farinosa, Clavispora opuntiae, Clovispora lusitanine, Candida mexicana, Hansenula polymorpha and Kluyveromyces host cells.
- the thermotolerant cell is an S. cerevisiae strain, or other yeast strain, that has been adapted to grow in high temperatures, for example, by selection for growth at high temperatures in a cytostat.
- the host cell is a Kluyveromyces host cell.
- the Kluyveromyces host cell can be a K. lactis, K. marxianus, K. blattae, K. phaffii, K. yarrowii, K. aestuarii, K. dobzhanskii, K. wickerhamii K. thermotolerans , or K. waltii host cell.
- the host cell is a K. lactis , or K. marxianus host cell.
- the host cell is a K. marxianus host cell.
- thermotolerant host cell can grow at temperatures above about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C., about 40° C., about 41° C. or about 42° C.
- thermotolerant host cell can produce ethanol from cellulose at temperatures above about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C., about 40° C., about 41° C., about 42° C., or about 43° C., or about 44° C., or about 45° C., or about 50° C.
- the thermotolerant host cell can grow at temperatures from about 30° C. to 60° C., about 30° C. to 55° C., about 30° C. to 50° C., about 40° C. to 60° C., about 40° C. to 55° C. or about 40° C. to 50° C.
- the thermotolerant host cell can produce ethanol from cellulose at temperatures from about 30° C. to 60° C., about 30° C. to 55° C., about 30° C. to 50° C., about 40° C. to 60° C., about 40° C. to 55° C. or about 40° C. to 50° C.
- the host cell has the ability to metabolize xylose.
- xylose-utilizing technology can be found in the following publications: Kuyper M et al. FEMS Yeast Res. 4: 655-64 (2004), Kuyper M et al. FEMS Yeast Res. 5:399-409 (2005), and Kuyper M et al. FEMS Yeast Res. 5:925-34 (2005), which are herein incorporated by reference in their entirety.
- xylose-utilization can be accomplished in S. cerevisiae by heterologously expressing the xylose isomerase gene, XylA, e.g.
- the host cells can contain antibiotic markers or can contain no antibiotic markers.
- Host cells are genetically engineered (transduced or transformed or transfected) with the polynucleotides encoding cellulases of this invention which are described in more detail below.
- the polynucleotides encoding cellulases can be introduced to the host cell on a vector of the invention, which may be, for example, a cloning vector or an expression vector comprising a sequence encoding a heterologous cellulase.
- the host cells can comprise polynucleotides of the invention as integrated copies or plasmid copies.
- the present invention relates to host cells containing the polynucleotide constructs described below.
- the host cells of the present invention can express one or more heterologous cellulase polypeptides.
- the host cell comprises a combination of polynucleotides that encode heterologous cellulases or fragments, variants or derivatives thereof.
- the host cell can, for example, comprise multiple copies of the same nucleic acid sequence, for example, to increase expression levels, or the host ceil can comprise a combination of unique polynucleotides.
- the host cell comprises a single polynucleotide that encodes a heterologous cellulase or a fragment, variant or derivative thereof.
- such host ceils expressing a single heterologous cellulase can be used in co-culture with other host cells of the invention comprising a polynucleotide that encodes at least one other heterologous cellulase or fragment, variant or derivative thereof.
- Introduction of a polynucleotide encoding a heterologous cellulase into a host cell can be done by methods known in the art.
- Introduction of polynucleotides encoding heterologous cellulases into, for example yeast host cells can be effected by lithium acetate transformation, spheroplast transformation, or transformation by electroporation, as described in Current Protocols in Molecular Biology, 13.7.1-13.7.10.
- Introduction of tire construct in other host cells can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation. (Davis, L., et al., Basic Methods in Molecular Biology, (1986)).
- the transformed host cells or cell cultures, as described above, can be examined for endoglucanase, cellobiohydrolase and/or ⁇ glucosidase protein content.
- protein content can be determined by analyzing the host (e.g., yeast) cell supernatants.
- host e.g., yeast
- high molecular weight material can be recovered from the yeast cell supernatant either by acetone precipitation or by buffering the samples with disposable de-salting cartridges.
- Proteins, including tethered heterologous cellulases can also be recovered and purified from recombinant yeast, cell cultures by methods including spheroplast preparation and lysis, cell disruption using glass beads, and cell disruption using liquid nitrogen for example.
- Additional protein purification methods include ammonium sulfate, or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, gel filtration, and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the mature protein. Finally, high performance liquid chromatography (HPLC) can be employed for final purification steps.
- HPLC high performance liquid chromatography
- Protein analysis methods include methods such as the traditional Lowry method or the protein assay method according to BioRad's manufacturer's protocol. Using such methods, the protein content of saccharolylic enzymes can be estimated. Additionally, to accurately measure protein concentration a heterologous cellulase can be expressed with a tag, for example a His-tag or HA-tag and purified by standard methods using, for example, antibodies against the tag, a standard nickel resin purification technique or similar approach.
- a tag for example a His-tag or HA-tag
- purified using, for example, antibodies against the tag, a standard nickel resin purification technique or similar approach.
- the transformed host cells or cell cultures, as described above, can be further analyzed for hydrolysis of cellulose (e.g., by a sugar detection assay), for a particular type of cellulose activity (e.g., by measuring the individual endoglucanase, cellobiohydrolase or ⁇ glycosylase activity) or for total cellulase activity.
- Endoglucanase activity can be determined, for example, by measuring an increase of reducing ends in an endoglucanase specific CMC substrate.
- Cellobiohydrolase activity can be measured, for example, by using insoluble cellulosic substrates such as the amorphous substrate phosphoric acid swollen cellulose (PASC) or microcrystalline cellulose (Avicel) and determining the extent of the substrate's hydrolysis.
- PASC amorphous substrate phosphoric acid swollen cellulose
- Avicel microcrystalline cellulose
- ⁇ -glucosidase activity can be measured by a variety of assays, e.g., using cellobiose.
- a total cellulase activity which includes the activity of endoglucanase, cellobiohydrolase and ⁇ -glucosidase, can hydrolyze crystalline cellulose synergistically.
- Total cellulase activity can thus be measured using insoluble substrates including pure cellulosic substrates such as Whatman No. 1 filter paper, cotton linter, microcrystalline cellulose, bacterial cellulose, algal cellulose, and cellulose-containing substrates such as dyed cellulose, alpha-cellulose or pretreated lignocellulose.
- Specific activity of cellulases can also be detected by methods known to one of ordinary skill in the art, such as by the Avicel assay (described supra) that would be normalized by protein (cellulase) concentration measured for the sample.
- a cellulase can be any enzyme involved in cellulase digestion, metabolism and/or hydrolysis, including an endoglucanase, oxogluconate, or ⁇ -glucosidase.
- the transformed host cells or cell cultures are assayed for ethanol production.
- Ethanol production can be measured by techniques known to one or ordinary skill in the art e.g. by a standard HPLC refractive index method.
- heterologous cellulases in a host cell can be used advantageously to produce ethanol from cellulosic sources.
- Cellulases from a variety of sources can be heterologously expressed to successfully increase efficiency of ethanol production.
- the cellulases can be front fungi, bacteria, plant, protozoan or termite sources.
- the cellulase is a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R.
- speratus Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- multiple cellulases from a single organism are co-expressed in the same host cell.
- multiple cellulases from different organisms are co-expressed in the same host cell.
- cellulases from two, three, four, five, six, seven, eight, nine or more organisms can be co-expressed in the same host cell.
- the invention can encompass co-cultures of yeast strains, wherein the yeast strains express different cellulases.
- Co-cultures can include yeast strains expressing heterologous cellulases from the same organisms or from different organisms.
- Co-cultures can include yeast strains expressing cellulases from two, three, four, five, six, seven, eight, nine or more organisms.
- Cellulases of the present invention include both endoglucanases or exoglucanases.
- the cellulases can be, for example, endoglucanases, ⁇ -glucosidases or cellobiohydrolases.
- the endoglucanase(s) can be an endoglucanase I or an endoglucanase II isoform, paralogue or orthologue.
- the endoglucanase expressed by the host cells of the present invention can be recombinant endo-1,4- ⁇ -glucanase.
- the endoglucanase is a T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinerisis, N. walkeri, R.
- the endoglucanase comprises an amino acid sequence selected from SEQ ID MOs: 30-39 or 52-56, as shown in Table 1 below.
- the endoglucanase comprises an amino acid sequence that is at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 30-39 or 52-56.
- polypeptide sequence identity As a practical matter, whether any polypeptide is at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to a polypeptide of the present invention can be determined conventionally using known computer programs. Methods for determining percent identity, as discussed in more detail below in relation to polynucleotide identity, are also relevant for evaluating polypeptide sequence identity.
- the endoglucanase is an endoglucanase I (“eg1.”) from Trichoderma reesei .
- the endoglucanase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100%; identical to SEQ ID NO:39.
- the endoglucanase is an endoglucanase from C. formosanus .
- the endoglucanase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:31.
- the endoglucanase is an endoglucanase from H. jecorina .
- the endoglucanase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100%; identical to SEQ ID NO:54.
- the ⁇ -glucosidase is a ⁇ -glucosidase I or a ⁇ -glucosidase II isoform, paralogue or orthologue.
- the ⁇ -glucosidase is derived from Saccharomycopsis fibuligera .
- the ⁇ -glucosidase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:40.
- the cellobiohydrolase(s) can be a cellobiohydrolase I and/or a cellobiohydrolase II isoform, paralogue or orthologue.
- the cellobiohydrolase comprises an amino acid sequence selected from SEQ ID NOs: 21-29 or 46, as shown in Table 1 below.
- the cellobiohydrolase is a cellobiohydrolase I or II from Trichoderma reesei .
- the cellobiohydrolase comprises a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO: 27 or SEQ ID NO:28.
- the cellobiohydrolase is a cellobiohydrolase I or II from T. emersonii .
- the cellobiohydrolase comprises a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:23 or SEQ ID NO:24.
- the cellobiohydrolase of the invention is a C. lucknowense cellobiohydrolase.
- the cellobiohydrolase is C. lucknowense cellobiohydrolase Cbh2h.
- the cellobiohydrolase comprises a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:25.
- the cellulase comprises a sequence selected from the sequences in Table 1 below.
- the cellulases of the invention also include cellulases that comprise a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99 or 100% identical to the sequences of Table 1.
- Some embodiments of the invention encompass a polypeptide comprising at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, or 500 or more consecutive amino acids of any of SEQ ID NOs:21-40, 46 or 52-56, or domains, fragments, variants, or derivatives thereof.
- polypeptides and polynucleotides of the present invention are provided in an isolated form, e.g., purified to homogeneity.
- the present invention also encompasses polypeptides which comprise, or alternatively consist of, an amino acid sequence which is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% similar to the polypeptide of any of SEQ ID NOs: 21-40, 46, or 52-56 and to portions of such polypeptide with such portion of the polypeptide generally containing at least 30 amino acids and more preferably at least 50 amino acids.
- similarity between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide.
- the present invention further relates to a domain, fragment, variant, derivative, or analog of the polypeptide of any of SEQ ID NOs: 21-40, 46, or 52-56.
- Fragments or portions of the polypeptides of the present invention may be employed for producing the corresponding full-length polypeptide by peptide synthesis.
- fragments may be employed as intermediates for producing the full-length polypeptides.
- Fragments of cellobiohydrolase, endoglucanase or beta-glucosidase polypeptides encompass domains, proteolytic fragments, deletion fragments and in particular, fragments of H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walked, S. fibuligera, C. lucknowense, R.
- speratus Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- the variant, derivative or analog of the polypeptide of any of SEQ ID NOs: 21-40, 46, or 52-56 may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the mature polypeptide for purification of the polypeptide or (v) one in which a fragment of the polypeptide is soluble, i.e., not membrane bound, yet still binds ligands to the membrane bound receptor,
- Such variants, derivatives and analogs are deemed to be within
- the polypeptides of the present invention further include variants of the polypeptides.
- a “variant” of the polypeptide can be a conservative variant, or an allelic variant.
- a conservative variant refers to alterations in the amino acid sequence that do not adversely affect the biological functions of the protein, A substitution, insertion or deletion is said to adversely affect the protein when the altered sequence prevents or disrupts a biological function associated with the protein.
- the overall charge, structure or hydrophobic-hydrophilic properties of the protein can be altered without adversely affecting a biological activity.
- the amino acid sequence can be altered, for example to render the peptide more hydrophobic or hydrophilic, without adversely affecting the biological activities of the protein.
- an “allelic variant” is intended alternate forms of a gene occupying a given focus on a chromosome of an organism. Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced rising art-known mutagenesis techniques. Allelic variants, though possessing a slightly different amino acid sequence than those recited above, will still have the same or similar biological functions associated with the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M.
- darwinensis N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- allelic variants, the conservative substitution variants, and members of the endoglucanase, cellobiohydrolase or ⁇ -glucosidase protein families can have an amino acid sequence having at least 75%, at least 80%, at least 90%, at least 95% amino add sequence identity with a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walked, S. fibuligera, C. lucknowense, R.
- speratus Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, R. flavipes , or Neosartorya fischeri cellobiohydrolase, endoglucanase or beta-glucosidase amino acid sequence set forth in any one of SEQ ID NOs: 21-40, 46, or 52-56.
- Identity or homology with respect to such sequences is defined herein as tire percentage of amino acid residues in the candidate sequence that are identical with the known peptides, alter aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. N-terminal, C-terminal or internal extensions, deletions, or insertions into the peptide sequence shall not be construed as affecting homology.
- proteins and peptides of the present invention include molecules comprising the amino acid sequence of SEQ ID NOs: 21-40, 46 and 52-56 or fragments thereof having a consecutive sequence of at least about 3, 4, 5, 6, 10, 15, 20, 25, 30, 35 or more amino acid residues of the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R.
- speratus Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, R. flavipes , or Neosartorya fischeri cellobiohydrolase, endoglucanase or beta-glucosidase polypeptide sequences; amino acid sequence variants of such sequences wherein at least one amino acid residue has been inserted N- or C-terminal to, or within, the disclosed sequence; amino acid sequence variants of the disclosed sequences, or their fragments as defined above, that have been substituted by another residue.
- Contemplated variants further include those containing predetermined mutations by, e.g., homologous recombination, site-directed or PCR mutagenesis, and the corresponding proteins of other animal species, including but not limited to bacterial, fungal, insect, rabbit, rat, porcine, bovine, ovine, equine and non-human primate species, the alleles or other naturally occurring variants of the family of proteins; and derivatives wherein the protein has been covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid (for example, a detectable moiety such as an enzyme or radioisotope).
- a detectable moiety such as an enzyme or radioisotope
- variants may be generated to improve or alter the characteristics of the cellulase polypeptides. For instance, one or more amino acids can be deleted from the N-terminus or C-terminus of the secreted protein without substantial loss of biological function.
- the invention further includes H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R.
- speratus Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- the first strategy exploits the tolerance of amino acid substitutions by natural selection during the process of evolution. By comparing amino acid sequences in different species, conserved amino acids can be identified. These conserved amino acids are likely important for protein function. In contrast, the amino acid positions where substitutions have been tolerated by natural selection indicates that these positions are not critical for protein function. Thus, positions tolerating amino acid substitution could be modified while still maintaining biological activity of the protein.
- the second strategy uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene to identify regions critical for protein function. For example, site directed mutagenesis or alanine-scanning mutagenesis (introduction of single alanine mutations at every residue in the molecule) can be used. (Cunningham and Wells, Science 244:1081-1085 (1989).) The resulting mutant molecules can then be tested for biological activity.
- tolerated conservative amino acid substitutions involve replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and lie; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gin, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Tip, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly.
- derivatives and analogs refer to a polypeptide differing from the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R.
- Clostridum thermocellum Clostridium cellulolyticum
- Clostridum josui Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- endoglucanase or beta-glucosidase polypeptides include any polypeptides which retain at least some of the activity of the corresponding native polypeptide, e.g., the exoglucanase activity, or the activity of the catalytic domain.
- speratus Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- Derivatives can be covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid (for example, a detectable moiety such as an enzyme or radioisotope).
- a detectable moiety such as an enzyme or radioisotope.
- Examples of derivatives include fusion proteins.
- An analog is another form of a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R.
- Clostridum thermocellum Clostridium cellulolyticum
- Clostridum josui Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- An “analog” also retains substantially the same biological function or activity as the polypeptide of interest, e.g., functions as a cellobiohydrolase.
- An analog includes a proprotein which can be activated by cleavage of the proprotein portion to produce an active mature polypeptide.
- the polypeptide of the present invention may be a recombinant polypeptide, a natural polypeptide or a synthetic polypeptide.
- the polypeptide is a recombinant polypeptide.
- allelic variants, orthologs, and/or species homologs are also provided in the present invention. Procedures known in the art can be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any of SEQ ID NOs: 1-40, using information from the sequences disclosed herein or the clones deposited with the ATCC. For example, allelic variants and/or species homologs may be isolated and identified by making suitable probes or primers from the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homologue.
- the host cells express at least one heterologous cellulase that is not derived from any one particular organism, but instead has an artificial amino acid sequence that is a consensus cellulase sequence.
- the consensus cellulase sequence can be an endoglucanase consensus sequence, a ⁇ -glucosidase consensus sequence, or a cellobiohydrolase consensus sequence.
- the heterologous cellulase is a CBH1 consensus sequence. Therefore, in one embodiment, the invention is directed to a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98% or 99% identical to the consensus CBH1 sequence of SEQ ID NO: 43. In some embodiments, the invention is directed to a polypeptide which comprises the sequence of SEQ ID NO: 43.
- the invention is also directed to host cells that comprise a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98% 99% or 100% identical to the consensus CBH1 sequence of SEQ ID NO: 43.
- the invention further directed to host cells that comprise a polynucleotide that encodes a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98% 99% or 100% identical to the consensus CBH1 sequence of SEQ ID NO: 43.
- the host cell comprises at least one polynucleotide that encodes a polypeptide sequence which comprises a sequence that is at least.
- the second polynucleotide can encode a endoglucanase, a ⁇ -glucosidase, a cellobiohydrolase, an endoglucanase consensus sequence, a ⁇ -glucosidase consensus sequence, or a cellobiohydrolase consensus sequence.
- the host cell comprising the polynucleotide that encodes a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98%, 99%, or 100% identical to the consensus CBH1 sequence of SEQ ID NO: 43 is capable of producing ethanol when grown using cellulose as a carbon source.
- the host cells express a combination of heterologous cellulases.
- the host cell can contain at least two heterologous cellulases, at least three heterologous cellulases, at least four heterologous cellulases, at least five heterologous cellulases, at least six heterologous cellulases, at least seven heterologous cellulases, at least eight heterologous cellulases, at least nine heterologous cellulases, at least ten heterologous cellulases, at least eleven heterologous cellulases, at least twelve heterologous cellulases, at least thirteen heterologous cellulases, at least fourteen heterologous cellulases or at least fifteen heterologous cellulases.
- the heterologous cellulases in the host cell can be from the same or from different species.
- the host cells express a combination of heterologous cellulases which includes at least, one endoglucanase, at least one ⁇ -glucosidase and at least one cellobiohydrolase. In another embodiment of the invention, the host cells express a combination of heterologous cellulases which includes at least one endoglucanase, at least one ⁇ -glucosidase and at least two cellobiohydrolases.
- the at least two cellobiohydrolases can be both be cellobiohydrolase I, can both be cellobiohydrolase II, or can be one cellobiohydrolase I and one cellobiohydrolase II.
- the host cells express a combination of cellulases that includes a C. formosanus endoglucanase I and an S. fibuligera ⁇ -glucosidase I.
- the host ceils express a combination of cellulases that includes a T. emersonii cellobiohydrolase I, and a T. reesei cellobiohydrolase II.
- the host cells express a combination of cellulases that includes a C. formosanus endoglucanase I, an S. fibuligera ⁇ -glucosidase I, a T. emersonii cellobiohydrolase I, and a C. lucknowense cellobiohydrolase IIb.
- the host cells express a combination of cellulases that includes a C. formosanus endoglucanase I, an S. fibuligera ⁇ -glucosidase I, a T. emersonii cellobiohydrolase I, and a T. reesei cellobiohydrolase II.
- the host cells express a combination of cellulases that includes an H. jecorina endoglucanase 2, an S. fibuligera ⁇ -glucosidase I, a T. emersonii cellobiohydrolase I, and a T. reesei cellobiohydrolase II.
- the host cells express a combination of cellulases that includes an H. jecorina endoglucanase 2, an S. fibuligera ⁇ -glucosidase I, a T. emersonii cellobiohydrolase I, and a C. lucknowense cellobiohydrolase II.
- the cellulases may be either tethered or secreted.
- a protein is “tethered” to an organism's cell surface if at least one terminus of the protein is bound, covalently and/or electrostatically for example, to the cell membrane or cell wall.
- a tethered protein may include one or more enzymatic regions that may be joined to one or more other types of regions at the nucleic acid and/or protein levels (e.g., a promoter, a terminator, an anchoring domain, a linker, a signaling region, etc.). While the one or more enzymatic regions may not be directly bound to the ceil membrane or cell wall (e.g., such as when binding occurs via an anchoring domain), the protein is nonetheless considered a “tethered enzyme” according to the present specification.
- Tethering may, for example, be accomplished by incorporation of an anchoring domain into a recombinant protein that is heterologously expressed by a cell, or by prenylation, Tatty acyl linkage, glycosyl phosphatidyl inositol anchors or oilier suitable molecular anchors which may anchor the tethered protein to the cell membrane or cell wall of the host cell.
- a tethered protein maybe tethered at its amino terminal end or optionally at its carboxy terminal end.
- secreted means released into the extracellular milieu, for example into the media.
- tethered proteins may have secretion signals as part of their immature amino acid sequence, they are maintained as attached to the cell surface, and do not fall within the scope of secreted proteins as used herein.
- flexible linker sequence refers to an amino acid sequence which links two amino acid sequences, for example, a cell wall anchoring amino acid sequence with an amino acid sequence that contains the desired enzymatic activity.
- the flexible linker sequence allows for necessary freedom for the amino acid sequence that contains the desired enzymatic activity to have reduced steric hindrance with respect to proximity to the ceil and may also facilitate proper folding of the amino acid sequence that contains the desired enzymatic activity.
- the tethered cellulase enzymes are tethered by a flexible linker sequence linked to an anchoring domain.
- the anchoring domain is of CWP2 (for carboxy terminal anchoring) or FLO1 (for amino terminal anchoring) from S. cerevisiae.
- heterologous secretion signals may be added to the expression vectors of the present invention to facilitate the extra-cellular expression of cellulase proteins.
- the heterologous secretion signal is the secretion signal from T. reesei Xyn2.
- the present invention also encompasses fusion proteins.
- the fusion proteins can be a fusion of a heterologous cellulase and a second peptide.
- the heterologous cellulase and the second peptide can be fused, directly or indirectly, for example, through a linker sequence.
- the fusion protein can comprise for example, a second peptide that is N-terminal to the heterologous cellulase and/or a second peptide that is C-terminal to the heterologous cellulase.
- the polypeptide of the present invention comprises a first, polypeptide and a second polypeptide, wherein the first polypeptide comprises a heterologous cellulase.
- the fusion protein can comprise a first and second polypeptide wherein the first polypeptide comprises a heterologous cellulase and Ore second polypeptide comprises a signal sequence.
- the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous cellulase and the second polypeptide comprises a polypeptide used to facilitate purification or identification or a reporter peptide.
- the polypeptide used to facilitate purification or identification or the reporter peptide can be, for example, a HIS-tag, a GST-tag, an HA-tag, a FLAG-tag, a MYC-tag, or a fluorescent protein.
- the fusion protein can comprise a first and second polypeptide, wherein the first, polypeptide comprises a heterologous cellulase and the second polypeptide comprises an anchoring peptide.
- the anchoring domain is of CWP2 (for carboxy terminal anchoring) or FLO1 (for amino terminal anchoring) from S. cerevisiae.
- the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous cellulase and the second polypeptide comprises a cellulose binding module (CBM).
- CBM is from, for example, T. reesei Cbh1 or Cbh2, from H. grisea Cbh1, or from C. lucknowense Cbh2b.
- the CBM is fused to a cellobiohydrolase.
- the fusion protein comprises a first and second polypeptide, wherein the first polypeptide comprises a heterologous cellobiohydrolase and the second polypeptide comprises a CBM.
- the cellobiohydrolase is T. emersonii cellobiohydrolase I and the CBM is a T. reesei cellobiohydrolase CBM.
- the cellobiohydrolase is T. emersonii cellobiohydrolase I and the CBM is a H. grisea cellobiohydrolase CBM,
- the CBM of H. grisea comprises amino acids 492-525 of SEQ ID NO: 21.
- the polypeptide of the present invention encompasses a fusion protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide is a cellobiohydrolase, and the second polypeptide is a domain or fragment of a cellobiohydrolase.
- the polypeptide of the present invention encompasses a fusion protein comprising a first polypeptide, where the first polypeptide is a T. emersonii Cbh1 , H. grisea Cbh1 , T. aurantiancusi Cbh1 , T. emersonii Cbh2, T. reesei Cbh1 T. reesei Cbh2, C.
- the second polypeptide is a T. emersonii Cbh1 , H. grisea Cbh1, or T. aurantiancusi Cbh1 , T. emersonii Cbh2, T. reesei Cbh1 or T. reesei Cbh2, C. lucknowense Cbh2b, or domain, fragment, variant, or derivative thereof.
- the first polypeptide is T. emersonii Cbh1 and the second polynucleotide is a CBM from T.
- the first polypeptide is either N-terminal or C-terminal to the second polypeptide.
- the first polypeptide and/or the second polypeptide are encoded by codon-optimized polynucleotides, for example, polynucleotides codon-optimized for S. cerevisiae or Kluyveromyces .
- the first polynucleotide is a codon-optimized T. emersonii cbh1 and the second polynucleotide encodes for a codon-optimized CBM from T.
- the first polynucleotide is a codon-optimized T. emersonii cbh1 and the second polynucleotide encodes for a codon-optimized CBM from C. lucknowense or Cbh2b.
- the first polypeptide and the second polypeptide are fused via a linker sequence.
- the linker sequence can, in some embodiments, be encoded by a codon-optimized polynucleotide.
- Codon-optimized polynucleotides are described in more detail below.
- An amino acid sequence corresponding to a codon-optimized linker 1 according to the invention is a flexible linker-strep tag-TEV site-FLAG-flexible linker fusion and corresponds to GGGGSGGGGS AWHPQFGG ENLYFQG DYKDDDK GGGGSGGGGS (SEQ ID NO:57)
- the DNA sequence is as follows:
- An amino acid sequence corresponding to optimized linker 2 is a flexible linker-strep tag-linker-TEV site-flexible linker and corresponds to GGGGSGGGGS WSHPQFEK GG ENLYFQG GGGGSGGGGS (SEQ ID NO:58),
- the DNA sequence is as follows:
- the present invention is also directed to co-cultures comprising at least two yeast host cells wherein the at least two yeast host ceils each comprise an isolated polynucleotide encoding a heterologous cellulase.
- co-culture refers to growing two different strains or species of host cells together in the same vessel.
- one host cell of the co-culture comprises a heterologous polynucleotide comprising a nucleic acid which encodes an endoglucanase
- at least one host cell of the co-culture comprises a heterologous polynucleotide comprising a nucleic acid which encodes a ⁇ -glucosidase
- at least one host cell comprises a heterologous polynucleotide comprising a nucleic acid which encodes a cellobiohydrolase.
- the co-culture further comprises a host cell comprising a heterologous polynucleotide comprising a nucleic acid which encodes a second cellobiohydrolase.
- the co-culture can comprise two or more strains of yeast host cells and the heterologous cellulases can be expressed in any combination in the two or more strains of host cells.
- the co-culture can comprise two strains: one strain of host cells that expresses an endoglucanase and a second strain of host: cells that expresses a ⁇ -glucosidase, a cellobiohydrolase and a second cellobiohydrolase.
- the co-culture can also comprise four strains: one strain of host cells which expresses an endoglucanase, one strain of host cells that expresses a ⁇ -glucosidase, one strain of host cells which expresses a first cellobiohydrolase, and one strain of host cells which expresses a second cellobiohydrolase.
- the co-culture can comprise one strain of host cells that expresses two celluloses, for example an endoglucanase and a beta-glucosidase and a second strain of host cells that expresses one or more celluloses, for example one or more cellobiohydrolases.
- the co-culture can, in addition to the at least two host cells comprising heterologous cellulases, also include other host cells which do not comprise heterologous cellulases.
- the various host cell strains in the co-culture can be present in equal numbers, or one strain or species of host cell can significantly outnumber another second strain or species of host cells.
- the ratio of one host cell to another can be about 1:1, 1:2, 1:3, 1:4, 1:5, 1:10, 1:100, 1:500 or 1:1000.
- the strains or species of host cells may be present in equal or unequal numbers.
- the co-cultures of the present invention can include tethered cellulases, secreted cellulases or both tethered and secreted cellulases.
- the co-culture comprises at least one yeast host cell comprising a polynucleotide encoding a secreted heterologous cellulase.
- the co-culture comprises at least one yeast host cell comprising a polynucleotide encoding a tethered heterologous cellulase.
- all of the heterologous cellulases in tire co-culture are secreted, and in another embodiment, all of the heterologous cellulases in the co-culture are tethered.
- other cellulases such as externally added cellulases may be present in the co-culture.
- the present invention also includes isolated polynucleotides encoding cellulases of the present invention.
- the polynucleotides of tire invention can encode endoglucanases or exoglucanases.
- the polynucleotides can encode endoglucanases, ⁇ -glucosidases or cellobiohydrolases.
- the polynucleotide encodes an endoglucanase which is an endo-1,4- ⁇ -glucanase.
- the polynucleotide encodes an endoglucanase I from Trichoderma reesei .
- the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:19.
- the polynucleotide encodes an endoglucanase I from C. formosanus .
- the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NOTE
- the polynucleotide encodes an endoglucanase I from Trichoderma reesei .
- the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO: 19.
- the polynucleotide encodes an endoglucanase 2 from H. jecorina .
- the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:54.
- the polynucleotide encodes a ⁇ -glucosidase I or a ⁇ -glucosidase II isoform, paralogue or orthologue. In certain embodiments of the present invention the polynucleotide encodes a ⁇ -glucosidase derived from Saccharomycopsis fibuligera . In particular embodiments, the ⁇ -glucosidase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:20.
- the polynucleotide encodes a cellobiohydrolase 1 and/or an cellobiohydrolase II isoform, paralogue or orthologue. In particular embodiments of the present invention, the polynucleotide encodes the cellobiohydrolase I or II from Trichoderma reesei . In particular embodiments of the present invention, the polynucleotide encodes the cellobiohydrolase I or II from Trichoderma emersonii .
- the cellobiohydrolase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:7 or SEQ ID NO:8.
- the polynucleotide encodes a cellobiohydrolase from C. lucknowense .
- the cellobiohydrolase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:5.
- polynucleotide is a polypeptide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to a nucleotide sequence listed in Table 1.
- polynucleotide can encode an endoglucanase, cellobiohydrolase or ⁇ -glucosidase derived from, for example, a fungal, bacterial, protozoan or termite source.
- the present invention relates to a polynucleotide comprising a nucleic acid encoding a functional or structural domain of T. emersonii, H. grisea, T. aurantiacus, C. lucknowense or T. reesei Cbh1 or Cbh2.
- the domains of T. reesei Cbh 1 include, without limitation; (1) a signal sequence, front amino acid 1 to 33 of SEQ ID NO: 27; (2) a catalytic domain (CD) from about amino acid 41 to about amino acid 465 of SEQ ID NO: 27; and (3) a cellulose binding module (CBM) from about amino acid 503 to about amino acid 535 of SEQ ID NO: 27.
- the domains of T. reesei Cbh 2 include, without limitation: (1) a signal sequence, from amino acid 1 to 33 of SEQ ID NO: 27; (2) a catalytic domain (CD) from about amino acid 145 to about amino acid 458 of SEQ ID NO: 27; and (3) a cellulose binding module (CBM) from about amino acid 52 to about amino acid 83 of SEQ ID NO: 27.
- a signal sequence from amino acid 1 to 33 of SEQ ID NO: 27
- CD catalytic domain
- CBM cellulose binding module
- the present invention also encompasses an isolated polynucleotide comprising a nucleic acid that is at least about 70%, 75%, or 80% identical, at least about 90% to about 95% identical, or at least about 96%, 97%, 98%, 99% or 100% identical to a nucleic acid encoding a T. emersonii, H. grisea, T. aurantiacus, C. lucknowense or T. reesei Cbh1 or Cbh2 domain, as described above.
- the present invention also encompasses variants of the cellulase genes, as described above.
- Variants may contain alterations in the coding regions, non-coding regions, or both. Examples are polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide.
- nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code.
- darwinerisis N. walkeri, S. fibuligera, C. lucknowense R. speratus, Thermobifida fischeri, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- the present invention also encompasses an isolated polynucleotide encoding a fusion protein.
- the nucleic acid encoding a fusion protein comprises a first polynucleotide encoding for a T. emersonii chh1 , H. grisea cbh1 , T. aurantiacus cbh1 or T. emersonii cbh1 and a second polynucleotide encoding for the CBM domain of T. reesei cbh1 or T. reesei cbh2 or C. lucknowense cbh2b.
- the first polynucleotide encodes T. emersonii cbh1 and the second polynucleotide encodes for a CBM from T. reesei Cbh1 or Cbh2.
- first and second polynucleotides are in the same orientation, or the second polynucleotide is in the reverse orientation of the first polynucleotide.
- first polynucleotide encodes a polypeptide that is either N-terminal or C-terminal to the polypeptide encoded by the second polynucleotide.
- first polynucleotide and/or the second polynucleotide are encoded by codon-optimized polynucleotides, for example, polynucleotides codon-optimized for S. cerevisiae, Kluyveromyces or for both S.
- the first polynucleotide is a codon-optimized T. emersonii cbh1 and the second polynucleotide encodes for a codon-optimized CBM from T. reesei Cbh1 or Cbh2.
- allelic variants, orthologs, and/or species homologs are also provided in the present invention. Procedures known in the art can be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any of SEQ ID NOs: 1-20, using information from the sequences disclosed herein or the clones deposited with the ATCC. For example, allelic variants and/or species homologs may be isolated and identified by making suitable probes or primers from the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homologue.
- nucleic add having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence of the present invention, it is intended that tire nucleotide sequence of the nucleic acid is identical to the reference sequence except that the nucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the particular polypeptide.
- nucleic acid having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
- the query sequence may be an entire sequence shown of any of SEQ ID NOs:1-20, or any fragment or domain specified as described herein.
- nucleic acid molecule or polypeptide is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence or polypeptide of the present invention can be determined conventionally using known computer programs.
- a method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci. (1990) 6:237-245.) In a sequence alignment the query and subject sequences are both DNA sequences.
- RNA sequence can be compared by converting U's to T's.
- the result of said global sequence alignment is in percent identity.
- the percent identity is corrected by calculating the number of bases of the query sequence that are 5′ and 3′ of the subject sequence, which are not matched/aligned, as a percent of the total bases of the query sequence. Whether a nucleotide is matched/aligned is determined by results of the FASTDB sequence alignment.
- This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to arrive at a final percent identity score.
- This corrected score is what is used for the purposes of the present invention. Only bases outside the 5′ and 3′ bases of the subject sequence, as displayed by the FASTDB alignment, which are not matched/aligned with the query sequence, are calculated for the purposes of manually adjusting the percent identity score.
- a 90 base subject sequence is aligned to a 100 base query sequence to determine percent identity.
- the deletions occur at the 5′ end of the subject sequence and therefore, the FASTDB alignment does not show a matched/alignment of the first 10 bases at 5′ end.
- the 10 unpaired bases represent 10% of the sequence (number of bases at the 5′ and 3′ ends not matched/total number of bases in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 bases were perfectly matched the final percent identity would be 90%.
- a 90 base subject sequence is compared with a 100 base query sequence.
- deletions are internal deletions so that there are no bases on the 5′ or 3′ of the subject sequence which are not matched/aligned with the query.
- percent identity calculated by FASTDB is not manually corrected.
- bases 5′ and 3′ of the subject sequence which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are to be made for the purposes of the present invention.
- nucleic acid molecule comprising at least 10, 20, 30, 35, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, or 800 consecutive nucleotides or more of any of SEQ ID NOs: 1-20, or domains, fragments, variants, or derivatives thereof.
- the polynucleotide of the present invention may be in the form of RNA or in the form of DNA, which DNA includes cDNA, genomic DNA, and synthetic DNA.
- the DMA may be double stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
- the coding sequence which encodes the mature polypeptide can be identical to the coding sequence encoding SEQ ID NO:21-40, 46, or 52-56, or may be a different coding sequence which coding sequence, as a result, of the redundancy or degeneracy of the genetic code, encodes the same mature polypeptide as the DNA of any one of SEQ ID NOs:21-40, 46, or 52-56.
- the present, invention provides an isolated polynucleotide comprising a nucleic acid fragment which encodes at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 95, or at least 100 or more contiguous amino acids of SEQ ID NOs: 21-40, 46, or 52-56.
- the polynucleotide encoding for the mature polypeptide of SEQ ID NOs: 21-40, 46, or 52-56 may include: only the coding sequence for the mature polypeptide; the coding sequence of any domain of the mature polypeptide; and the coding sequence for the mature polypeptide (or domain-encoding sequence) together with non coding sequence, such as introns or non-coding sequence 5′ and/or 3′ of the coding sequence for tire mature polypeptide.
- polynucleotide encoding a polypeptide encompasses a polynucleotide which includes only sequences encoding for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences.
- nucleic acid molecules having sequences at least about 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid sequences disclosed herein encode a polypeptide having cellobiohydrolase (“Cbh”), endoglucanase (“Eg”) or beta-gluconase (“Bgl”) functional activity.
- Cbh cellobiohydrolase
- Eg endoglucanase
- Bgl beta-gluconase
- a Cbh, Eg or Bgl functional activity can routinely be measured by determining the ability of a Cbh, Eg or Bgl polypeptide to hydrolyze cellulose, or by measuring the level of Cbh, Eg or Bgl activity.
- nucleic acid molecules having a sequence at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence of any of SEQ ID NOs: 1-20, or fragments thereof will encode polypeptides having Cbh, Eg or Bgl functional activity.
- degenerate variants of any of these nucleotide sequences ail encode the same polypeptide, in many instances, this will be clear to the skilled artisan even without performing the above described comparison assay.
- St will be further recognized in the art that, for such nucleic acid molecules that are not degenerate variants, a reasonable number will also encode a polypeptide having Cbh, Eg or Bgl functional activity.
- the polynucleotides of the present invention also comprise nucleic acids encoding a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R.
- Clostridum thermocellum Clostridium cellulolyticum
- Clostridum josui Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- the marker sequence may be a yeast selectable marker selected from the group consisting of URA3, HIS3, LEU2, TRP1, LYS2 or ADE2. Casey, G. P. et al. “A convenient dominant selection marker for gene transfer in industrial strains of Saccharomyces yeast: SMR1 encoded resistance to the herbicide sulfometuron methyl,” J. Inst. Brew. 94:93-97 (1988).
- the polynucleotides encoding heterologous celluloses can be codon-optimized.
- codon-optimized coding region means a nucleic acid coding region that has been adapted for expression in the cells of a given organism by replacing at least one, or more than one, or a significant number, of codons with one or more codons that are more frequently used in the genes of that organism.
- CAI codon adaptation index
- the CAI of codon optimized sequences of the present invention corresponds to between about 0.8 and 1.0, between about 0.8 and 0.9, or about 1.0.
- a codon optimized sequence may be further modified for expression in a particular organism, depending on that organism's biological constraints. For example, large runs of “As” or “Ts” (e.g., runs greater than 4, 4, 5, 6, 7, 8, 9, or 10 consecutive bases) can be removed from the sequences if these are known to effect transcription negatively.
- specific restriction enzyme sues may be removed for molecular cloning purposes. Examples of such restriction enzyme sites include Pad, AscI, BamHI, BglII, EcoRI and XhoI.
- the DMA sequence can be checked for direct repeats, inverted repeats and mirror repeats with lengths of ten bases or longer, which can be modified manually by replacing codons with “second best” codons, codons that occur at the second highest frequency within the particular organism for which the sequence is being optimized.
- Deviations in the nucleotide sequence that comprise the codons encoding tire amino acids of any polypeptide chain allow for variations in the sequence coding for the gene. Since each codon consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific bases, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codons encode signals ending translation).
- the “genetic code” which shows which codons encode which amino acids is reproduced herein as Table 2. As a result, many amino acids are designated by more than one codon.
- amino acids alanine and proline are coded for by four triplets, serine and arginine by six, whereas tryptophan and methionine are coded by just one triplet.
- This degeneracy allows for DNA base composition to vary over a wide range without altering the amino acid sequence of the proteins encoded by the DNA.
- Codon preference or codon bias differences in codon usage between organisms, is afforded by degeneracy of the genetic code, and is well documental among many organisms. Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules.
- mRNA messenger RNA
- tRNA transfer RNA
- the predominance of selected tRNAs in a cell is generally a ret lection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
- Codon usage tables are readily available, for example, at http://phenotype.biosci.umbc.edu/codon/sgd/index.php (visited May 7, 2008) or at http://www.kazusa.or.jp/codon/ (visited Mar. 20, 2008), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000 ” Nucl. Acids Res. 28:292 (2000).
- Codon usage tables for yeast calculated from GenBank Release 128.0 [15 Feb. 2002], are reproduced below as Table 3.
- This table uses mRNA nomenclature, and so instead of thymine (T) which is found in DNA, the tables use uracil (U) which is found in RNA.
- T thymine
- U uracil
- the Table has been adapted so that frequencies are calculated for each amino acid, rather than for all 64 codons.
- Codon-optimized coding regions can be designed by various different methods.
- a codon usage table is used to find the single most frequent codon used for any given amino acid, and that codon is used each time that particular amino acid appears in the polypeptide sequence. For example, referring to Table 3 above, for leucine, the most frequent codon is UUG, which is used 27.2% of the time. Thus ail the leucine residues in a given amino acid sequence would be assigned the codon UUG.
- the actual frequencies of the codons are distributed randomly throughout the coding sequence.
- Table 3 for frequency of usage in the S. cerevisiae , about 5, or 5% of the leucine codons would be CUC, about 11, or 11% of the leucine codons would be CUG, about 12, or 12% of the leucine codons would be CUU, about 13, or 13% of the leucine codons would be CUA, about 26, or 26% of the leucine codons would be UUA, and about 27, or 27% of the leucine codons would be UUG.
- the term “about” is used precisely to account for fractional percentages of codon frequencies for a given amino acid.
- “about” is defined as one amino acid more or one amino acid less than the value given. The whole number value of amino adds is rounded up if the fractional frequency of usage is 0.50 or greater, and is rounded down if the fractional frequency of use is 0.49 or less.
- the fractional frequency of codon usage would be calculated by multiplying 62 by the frequencies for the various codons. Thus, 7.28 percent of 62 equals 4.51 UUA codons, or “about 5,” i.e., 4, 5.
- Randomly assigning codons at an optimized frequency to encode a given polypeptide sequence can be done manually by calculating codon frequencies for each amino acid, and then assigning the codons to the polypeptide sequence randomly.
- various algorithms and computer software programs are readily available to those of ordinary skill in the art. For example, the “EditSeq” function in the Lasergene Package, available from DNAstar, Inc., Madison, Wis., the back translation function in the VectorNTI Suite, available from InforMax, Inc., Bethesda, Md., and the “backtranslate” junction in the GCG—Wisconsin Package, available from Accelrys, Inc., San Diego, Calif.
- a number of options are available for synthesizing codon optimized coding regions designed by any of the methods described above, using standard and routine molecular biological manipulations well known to those of ordinary skill in the art.
- a series of complementary oligonucleotide pairs of 80-90 nucleotides each in length and spanning the length of the desired sequence is synthesized by standard methods.
- oligonucleotide pairs are synthesized such that upon annealing, they form double stranded fragments of 80-90 base pairs, containing cohesive ends, e.g., each oligonucleotide in the pair is synthesized to extend 3, 4, 5, 6, 7, 8, 9, 10, or more bases beyond the region that is complementary to the other oligonucleotide in the pair.
- the single-stranded ends of each pair of oligonucleotides is designed to anneal with the single-stranded end of another pair of oligonucleotides.
- the oligonucleotide pairs are allowed to anneal, and approximately five to six of these double-stranded fragments are then allowed to anneal together via the cohesive single stranded ends, and then they ligated together and cloned into a standard bacterial cloning vector, for example, a TOPO® vector available from Invitrogen Corporation, Carlsbad, Calif.
- the construct is then sequenced by standard methods. Several of these constructs consisting of 5 to 6 fragments of 80 to 90 base pair fragments ligated together, i.e., fragments of about 500 base pairs, are prepared, such that the entire desired sequence is represented in a series of plasmid constructs.
- an entire polypeptide sequence, or fragment, variant, or derivative thereof is codon optimized by any of the methods described herein.
- Various desired fragments, variants or derivatives are designed, and each is then codon-optimized individually.
- partially codon-optimized coding regions of the present invention can be designed and constructed.
- the invention includes a nucleic acid fragment of a codon-optimized coding region encoding a polypeptide in which at least about 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the codon positions have been codon-optimized for a given species.
- they contain a codon that is preferentially used in the genes of a desired species, e.g., a yeast species such as Saccharomyces cerevisiae or Kluyveromyces , in place of a codon that is normally used in the native nucleic acid sequence.
- a desired species e.g., a yeast species such as Saccharomyces cerevisiae or Kluyveromyces
- a full-length polypeptide sequence is codon-optimized for a given species resulting in a codon-optimized coding region encoding the entire polypeptide, and then nucleic acid fragments of the codon-optimized coding region, which encode fragments, variants, and derivatives of the polypeptide are made from the original codon-optimized coding region.
- nucleic acid fragments encoding fragments, variants, and derivatives would not necessarily be fully codon optimized for the given species.
- the codon-optimized coding regions can be, for example, versions encoding a cellobiohydrolase, endoglucanase or beta-glucosidase from H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R.
- Clostridum thermocellum Clostridium cellulolyticum
- Clostridum josui Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- Codon optimization is carried out for a particular species by methods described herein, for example, in certain embodiments codon-optimized coding regions encoding polypeptides of H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R.
- Clostridum thermocellum Clostridium cellulolyticum
- Clostridum josui Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- yeast codon usage e.g., Saccharomyces cerevisiae, Kluyveromyces lactis and/or Kluyveromyces maximus .
- polynucleotides, vectors, and other expression constructs comprising codon-optimized coding regions encoding polypeptides of H. grisea, T. aurantiacus, T. emersonii, T, reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R.
- Clostridum thermocellum Clostridium cellulolyticum
- Clostridum josui Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H.
- a codon-optimized coding region encoding any of SEQ ID NOs:21-40, 46, or 52-56 or domain, fragment, variant, or derivative thereof, is optimized according to codon usage in yeast ( Saccharomyces cerevisiae, Kluyveromyces lactis or Kluyveromyces marxianus ).
- the sequences are codon-optimized specifically for expression in Saccharomyces cerevisiae .
- the sequences are codon-optimized for expression in Kluyveromyces .
- a sequence is simultaneously codon-optimized tor optimal expression in both Saccharomyces cerevisiae and in Kluyveromyces .
- a codon-optimized coding region encoding any of SEQ ID NOs: 21-40, 46, or 52-56 may be optimized according to codon usage in any plant, animal, or microbial species.
- the present invention also relates to vectors which include polynucleotides of the present invention, host cells which are genetically engineered with vectors of the invention and the production of polypeptides of the invention by recombinant techniques.
- Host cells are genetically engineered (transduced or transformed or transfected) with the vectors of this invention which may be, for example, a cloning vector or an expression vector,
- the vector may be, for example, in the form of a plasmid, a viral particle, a phage, etc.
- H engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes of the present invention.
- the culture conditions such as temperature, pH and the like, are those previously used with the host cell selected tor expression, and will be apparent to the ordinarily skilled artisan.
- the polynucleotides of the present invention may be employed for producing polypeptides by recombinant techniques.
- Titus for example, the polynucleotide may be included in any one of a variety of expression vectors for expressing a polypeptide.
- Such vectors include chromosomal, nonchromosomal and synthetic DNA sequences, e.g., derivatives of SV40; bacterial plasmids; and yeast plasmids.
- any other vector may be used as long as it is replicable and viable in the host.
- the appropriate DNA sequence may be inserted into the vector by a variety of procedures.
- the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art. Such procedures and others are deemed to be within the scope of those skilled in the art.
- the DNA sequence in the expression vector is operatively associated with an appropriate expression control sequence(s) (promoter) to direct mRNA synthesis.
- promoter an appropriate expression control sequence(s) to direct mRNA synthesis.
- promoters are as follows:
- promoter sequences front stress and starvation response genes are useful in the present invention.
- promoter regions from the S. cerevisiae genes GAC1, GET3, GLC7, GSH1, GSH2, HSF1, HSP12, LCB5, LRE1, LSP1, NBP2, PIL1, PIM1, SGT2, SLG1, WHI2, WSC2, WSC3, WSC4, YAP1, YDC1, HSP104, HSP26, ENA1, MSN2, MSN4, SIP2, SIP4, SIP5, DPL1, IRS4, KOG1, PEP4, HAP4, PRB1, TAX4, ZPR1, ATG1, ATG2, ATG10, ATG11, ATG12, ATG13, ATG14, ATG15, ATG16, ATG17, ATG18, and ATG19 may be used.
- Any suitable promoter to drive gene expression in the host cells of the invention may be used.
- the expression vectors may contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells such as URA3, HIS3, LEU2, TRP1, LYS2 or ADE2, dihydrofolate reductase, neomycin (G418) resistance or zeocin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in E. coli.
- selectable marker genes such as URA3, HIS3, LEU2, TRP1, LYS2 or ADE2, dihydrofolate reductase, neomycin (G418) resistance or zeocin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in E. coli.
- the expression vector may also contain a ribosome binding site for translation Initiation and/or a transcription terminator.
- the vector may also include appropriate sequences for amplifying expression, or may include additional regulatory regions.
- the vector containing the appropriate DNA sequence as herein, as well as an appropriate promoter or control sequence, may be employed to transform an appropriate host to permit the host to express the protein.
- the present invention relates to host ceils containing the above-described constructs.
- the host cell can be a host cell as described elsewhere in the application.
- the host cell can be, for example, a lower eukaryotic cell, such as a yeast cell, e.g., Saccharomyces cerevisiae or Kluyveromyces , or the host cell can be a prokaryotic cell, such as a bacterial cell.
- bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium ; thermophilic or mesophilic bacteria; fungal cells, such as yeast; and plant ceils, etc.
- the selection of an appropriate host is deemed to be within the scope of those skilled in the art front the teachings herein.
- yeast is selected from the group consisting of Saccharomyces cerevisiae, Kluyveromyces lactis, Schizzosaccharomyces pombe, Candida albicans, Pichia pastoris, Pichia stipitis, Yarrowia lipolytica, Hansenula polymorpha, Phaffia rhodozyma, Candida utilis, Arxula adeninivorans, Debaryomyces hansenii, Debaryomyces polymorphus, Schwanniomyces occidental, Issatchenkia orientalis, Kluyveromyces maximus, Blakeslea, Candida, Cryptococcus, Cunninghamella, Lipomyces, Mortierella, Mucor, Phycomces, Pythium, Rhodosporidium, Rhodotorula, Trichosporon and Yarrowia.
- the present invention is also directed to use of host cells and co-cultures to produce ethanol from cellulosic substrates. Such methods can be accomplished, for example, by contacting a cellulosic substrate with a host cell or a co-culture of the present invention.
- Soluble substrates include cellodextrins or derivatives, carboxymethyl cellulose (CMC), or hydroxyethyl cellulose (HEC).
- Insoluble substrates include crystalline cellulose, microcrystalline cellulose (Avicel), amorphous cellulose, such as phosphoric acid swollen cellulose (PASC), dyed or fluorescent cellulose, and pretreated lignocellulosic biomass. These substrates are generally highly ordered cellulosic material and thus only sparingly soluble.
- suitable lignocellulosic material may be any feedstock that, contains soluble and/or insoluble cellulose, where the insoluble cellulose may be in a crystalline or non-crystalline form.
- the lignocellulosic biomass comprises, for example, wood, corn, corn stover, sawdust, bark, leaves, agricultural and forestry residues, grasses such as switchgrass, ruminant digestion products, municipal wastes, paper mill effluent, newspaper, cardboard or combinations thereof.
- the invention is directed to a method for hydrolyzing a cellulosic substrate, for example a cellulosic substrate as described above, by contacting the cellulosic substrate with a host cell of the invention. In some embodiments, the invention is directed to a method for hydrolyzing a cellulosic substrate, for example a cellulosic substrate as described above, by contacting the cellulosic substrate with a co-culture comprising yeast cells expressing heterologous cellulases.
- the invention is directed to a method for fermenting cellulose. Such methods can be accomplished, for example, by culturing a host cell or co-culture in a medium that contains insoluble cellulose to allow saccharification and fermentation of the cellulose.
- the production of ethanol can, according to the present invention, be performed at temperatures of at least about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C., about 40° C., about 41° C., about 42° C., about 43° C., about 44° C., about 45° C., about 46° C., about 47° C., about 48° C., about 49° C., or about 50° C.
- the thermotolerant host cell can produce ethanol from cellulose at temperatures above about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C. about 40° C., about 41° C., about 42° C., or about 43° C., or about 44° C., or about 45° C., or about 50° C.
- the thermotolerant host cell can produce, ethanol from cellulose at temperatures from about 30° C. to 60° C., about 30° C. to 55° C., about 30° C. to 50° C., about 40° C. to 60° C., about 40° C. to 55° C. or about 40° C. to 50° C.
- methods of producing ethanol can comprise contacting a cellulosic substrate with a host cell or co-culture of the invention and additionally contacting the cellulosic substrate with externally produced cellulase enzymes.
- exemplary externally produced cellulase enzymes are commercially available and are known to those of skill in the art.
- the invention is also directed to methods of reducing the amount of externally produced cellulase enzymes required to produce a given amount of ethanol front cellulose comprising contacting the cellulose with externally produced cellulases and with a host cell or co-culture of the invention.
- the same amount of ethanol production can be achieved using at least about 5%, 10%, 15%, 20%, 25%, 30%, or 50% less externally produced cellulases.
- no external cellulase is added, or less than about 5% of the cellulase is externally added cellulase, or less than about 10% of the cellulase is externally added cellulase, or less than about 15% of the cellulase is externally added cellulase.
- the methods comprise producing ethanol at a particular rate.
- ethanol is produced at a rate of at least about 0.1 mg per hour per liter, at least about 0.25 mg per hour per liter, at least about 0.5 mg per hour per liter, at least about 0.75 mg per hour per liter, at least about 1.0 mg per hour per liter, at least about 2.0 mg per hour per liter, at least about 5.0 mg per hour per liter, at least about 10 mg per hour per liter, at least about 15 mg per hour per liter, at least about 20.0 mg per hour per liter, at least about 25 mg per hour per liter, at least about 30 mg per hour per liter, at least about 50 mg per hour per liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, or at least about 500 mg per hour per liter.
- the host cells of the present invention can produce ethanol at a rate of at least about 0.1 mg per hour per liter, at least about 0.25 mg per hour per liter, at least about 0.5 mg per hour per liter, at least about 0.75 mg per hour per liter, at least about 1.0 mg per hour per liter, at least about 2.0 mg per hour per liter, at least about 5.0 mg per hour per liter, at least about 10 mg per hour per liter, at least about 15 mg per hour per liter, at least about 20.0 mg per hour per liter, at least about 25 mg per hour per liter, at least about 30 mg per hour per liter, at least about 50 mg per hour per bier, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, or at least about 500 mg per hour per liter more than a control strain (lacking heterologous cellulases) and grown under the same conditions.
- a control strain lacking hetero
- Ethanol production can be measured using any method known in the art. For example, the quantity of ethanol in fermentation samples can be assessed using HPLC analysis. Many ethanol assay kits are commercially available that use, for example, alcohol oxidase enzyme based assays. Methods of determining ethanol production are within the scope of those skilled in the art from the teachings herein.
- the present invention presents a number of important steps forward for creating a yeast capable of consolidated bioprocessing. It describes improved cellulolytic yeast created by expressing combinations of heterologous cellulases.
- the present invention demonstrates for the first time, the ability of transformed Kluyveromyces to produce ethanol from cellulose, the ability of yeast strains expressing only secreted heterologous cellulases to produce ethanol from cellulose, and the ability of co-cultures of multiple yeast strains expressing different cellulases to produce ethanol from cellulose.
- yeast strains and co-cultures of yeast strains can increase the efficiency of simultaneous saccharification and fermentation (SSF) processes.
- SSF simultaneous saccharification and fermentation
- Escherichia coli strain DH5 ⁇ (Invitrogen), or NEB 5 alpha (New England Biolabs) was used for plasmid transformation and propagation.
- Cells were grown in LB medium (5 g/L yeast extract, 5 g/L NaCl, 10 g/L tryptone) supplemented with ampicillin (100 mg/L), kanamycin (50 mg/L), or zeocin (20 mg/L). When zeocin selection was desired LB was adjusted to pH 7.0. Also, 15 g/L agar was added when solid media was desired.
- Yeast strains were routinely grown in YPD (10 g/L yeast extract, 20 g/L peptone, 20 g/L glucose), YPC (10 g/L yeast extract, 20 g/L peptone, 20 g/L cellobiose), or YNB+glucose (6.7 g/L Yeast: Nitrogen Base without amino acids, and supplemented with appropriate amino acids for strain, 20 g/L glucose) media with either G418 (250 mg/L unless specified) or zeocin (20 mg/L unless specified) for selection. 15 g/L, agar was added for solid media.
- PCR was performed using Phusion polymerase (New England Biolabs) for cloning, and Taq polymerase (New England Biolabs) for screening transformants, and in some cases Advantage Polymerase (Clontech) for PCR of genes for correcting auxotrophies. Manufacturers guidelines were followed as supplied. Restriction enzymes were purchased from New England Biolabs and digests were set up according to the supplied guidelines. Ligations were performed using the Quick ligation kit (New England Biolabs) as specified by the manufacturer.
- a backbone vector (pRS426), able to replicate in yeast, and with the Ura3 gene for selection, was then transformed into yeast by standard methods with the target sequences for cloning. Transformed yeast recombine these fragments to form a whole construct and the resulting plasmid allows selection on media without uracil.
- Plasmid constructs vectors in the experiments detailed below are summarized in Table 4, and the primers used in vector construction are shown in Table 5.
- YML yeast mediated ligation
- CBH2 derived from pBKD_20641 with tether removed (from example 1) inserted into pMU451 (PacI/AscI digest of both pieces) pMU499 synthetic construct for M.d.
- EG inserted into pMU451 (PacI/AscI digest of both pieces)
- pMU500 synthetic construct for R.s. EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU503 synthetic construct for N.w. EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU624/pMI529 2 micron vector for expression of T.e.
- CBH1 w/CBD (PCR fragments for chimeric enzyme with PmlI-XhoI digested pRDH105)
- pMU326 synthetic construct for R.s. EG from Codon Devices pMU784/pMI574 2 micron vector for expression of C.l.(b) CBH2 (synthetic construct for C.l.(b) CBH2 inserted into PacI/AscI digested pMU624)
- pMU576 ENO1p- T.r.cbh1-ENO1 T from pMU291
- pMU562 (PacI/AscI digest of both pieces) pMU66
- EG1-ENO1 T (from pMU463) in pMU562 (PacI/AscI digest of both pieces) pMU662 ENO1p- C.l.(a) EG1-ENO1 T (from pMU465) in pMU562 (PacI/AscI digest of both pieces) pMU663 ENO1p- C.f. EG1-ENO1 T (from pMU471) in pMU562 (PacI/AscI digest of both pieces) pMU664 ENO1p- N.t.
- EG1-ENO1 T (from pMU472) in pMU562 (PacI/AscI digest of both pieces) pMU665 ENO1p- C.a. EG1-ENO1 T (from pMU473) in pMU562 (PacI/AscI digest of both pieces) pMU666 ENO1p- T.r.CBH2-ENO1 T (from pMU475) in pMU562 (PacI/AscI digest of both pieces) pMU667 ENO1p- M.d.-EG1-ENO1 T (from pMU499) in pMU562 (PacI/AscI digest of both pieces) pMU668 ENO1p- N.w.-EG1-ENO1 T (from pMU503) in pMU562 (PacI/AscI digest of both pieces) pMU755 ENO1p- T.e.CBH1 w
- CBH2 and T.e. CBH1 + CBM pMI568 2 micron vector for expression of T.r. EG1 please see text for description of how this construct was built.
- the yeast expression vector YEpENO-BBH was created to facilitate heterologous expression under control of the S. cerevisiae enolase 1 (ENO1) gene promoter and terminator.
- the vector was also useful because the expression cassette from this vector could be simply excised using a BamHI, BglII digest.
- YEpENO1 (Den Haan et al., Metabolic Engineering. 9: 87-942007) contains the YEp352 backbone with the ENO1 gene promoter and terminator sequences cloned into the BamHI and HindIII sites. This plasmid was digested with BamHI and the overhang filled in with Klenow polymerase and dNTPs to remove the BamHI site.
- YEpENO-BBHtemplate was used as template for a PCR reaction with primers ENOBB-left (5′-GATCGGATCCCAATTAATGTGAGTTACCTCA-3′ (SEQ ID NO: 70)) and ENOBB-right (5GTACAAGCTTAGATCTCCTATGCGGTGTGAAATA-3′ (SEQ ID NO; 71)) in which the ENO1 cassette was amplified together with a 150 bp flanking region upstream anti 220 bp downstream.
- This product was digested with BamHI and HindIII and the over hangs filled in by treatment with Klenow polymerase and dNTPs and cloned between the two PvuII sites on yENO1 effectively replacing the original ENO1 cassette and generating YEpENO-BBH.
- Codon optimized versions of Humicola grisea cbh1 Hgcbh1
- Thermoascus aurantiacus cbh1 Tacbh1
- Talaromyces emersonii cbh1 and cbh2 Tecbh1 and Tecbh1
- GenScript Corporation Procataway, N.J., USA.
- These four synthetic cbh encoding genes received from GenScript Corporation were cloned onto the plasmid pUC57.
- the resulting vectors were digested with EcoRI and XhoI to excise the cbh genes which were subsequently cloned into an EcoRI and XhoI digested YEpENO-BBH.
- pRDH101 was created to express the T. reesei CBH1 from pBZD_10631_20641.
- Takara ExTaq enzyme was used as directed and to amplify the sTrcbh1 from pBZD_10631_20641 using primers sCBH1/2 L and sCBH1R. The fragment was then isolated and digested with EcoRI and XhoI. YEpENO-BBH was also digested with EcoRI and XhoI and the relevant bands were isolated and ligated. A 1494 bp fragment encoding the T.
- reesei cbh1 gene was amplified from the plasmid pBZD_10631_20641, with primers sCBH1/2-L and sCBH2 R (5′-CAGTCTCGAGTTACAAGAAAGATGGGTTAGC-3′ (SEQ ID NO: 61)). digested with EcoRI and XhoI and cloned into the EcoRI and XhoI sites of pJC 1 (Crouse el ah, Curr. Gen. 28: 467-473 (1995)) placing if under transcriptional control of S. cerevisiae phosphoglycerate kinase 1 (PGK1) gene promoter and terminator. This plasmid was designated pRDH107.
- pRDH1109 contains the same expression cassettes as pRDH105 but in pRDH105 the gene expression cassettes are in the reverse orientation relative to each other.
- a PCR product was amplified with the oligonucleotides 395 Te cbhI Syntl PacI-ATG and 398 Te chhI synt core SmaI using pRDH105 as the template, digested with PmlI and SmaI and the 800 bp fragment was Isolated.
- a second PCR product was amplified with oligonucleotides 399 Trcbh1 synt CBM5 MlyHIincII and 400 Trcbh1 synt CBM AscIXhoI with pRDH101 as the template, digested with MlyI and XhoI and the 180 bp fragment was isolated.
- the two PCR fragments were ligated with the 6.9 kb PmlI-XhoI fragment of pRDH105 resulting in pMU624.
- the genomic 3900 bp DNA sequence of Chrysosporium lucknowense cbh2b gene was analyzed for putative in Irons using the NetAspGene 1.0 Server (http://www.cbs.dtu.dk/services/NetAspGene/). Removal of the predicted introns from the genomic sequence resulted in an open reading frame of 482 amino acids which was synthesized at Codon Devices and codon optimized for expression in S. cerevisiae and cloned into pUC57 vector. Plasmid pAJ401 (Saloheimo et al. Mol. Microbiol.
- reesei cbh2 ORF was amplified from pTTc01 (Teeri et al., Gene 57:43-52, 1987) with oligonucleotides 381 CBH2 WT EcoRI-PacI-ATG and 386 CBH2 WT TAA-AscI-EcoRI, digested with Pad and EcoRI, and ligated with the SacI-EcoRI digested pAJ401 resulting in pMI508.
- the Pact-AscI fragment in pMI508 was replaced by a synthetic 1.4 kb T. reesei eglI gene resulting in pM1522.
- pMI568 was digested with Pad and AscI and the 7 kb fragment was ligated to the 1.5 kb fragment of pMI558 producing pMU784 for the expression of C. lucknowense cbh2b.
- pMU451 was created as a control vector and for cloning the cellulases under control of the ENO1 promoter and terminator. This was done by adding a Pad/AscI linker into the EcoRI/XhoI site of pMU451. Synthetic genes ordered from Codon Devices and received in pUC57 were cloned into this vector as PacI/AscI fragments.
- Vectors created this way and listed in Table 4 are: pMU458, pMU463, pMU465, pMU469, pMU471, pMU472, pMU473, pMU475, pMU499, pMU500, and pMU503.
- Vectors for integrating secreted versions of cellulases at the delta integration sites in S. cerevisiae , or for integration into the genome of K. marxianus were created from the pBKD_1 and pBKD_2 constructs.
- the S. fibuligera BGL1 (SfBGLI) was cloned by PCR from ySFI (van Rooyen el al., J. Biotechnol 120: 284-95 (2005)).
- the endoglucanase (TrEGI) used was the sequence give in Table 1.
- the cellulase encoding genes were cloned via PCR (using Pad and AscI sites) into pBKD_1 and pRKD_2—to create pBKD1-BGL1 and pBKD2-sEG1.
- the ENO1P-sEG1-ENO1T cassette from pBKD2-sEG1 was subsequently sub cloned as a SpeI, NotI fragment to pBKD1-BGL1 to create pBKD1-BGL1-sEG1.
- pMU562 used for integrating cellulases into K. maximus , was generated by cutting with pMU185 (pUG66) with NotI and isolating a 1190 bp lox P ZeoR containing insert. This insert was ligated into a NotI digested 4.5 Kb delta-integration vector to produce pMU562.
- pMU576 was generated by cutting T. reesei CBH2 containing plasmid pMU291 with AscI/PacI, isolating a 1491 bp CBH12 gene and ligating it into delta-integration vector pMU562 cut with AscI/PacI.
- pMU577 was generated by cutting T.
- emersonii CBH1 from pMU398 with AscI/PacI, isolating a 1380 bp CBH1 gene and ligating into delta-integration vector pMU562 cut with AscI/PacI.
- a set of recombinant cellulase constructs (pMU661 to pMU668 and pMU750, pMU755, pMU809—see Table 4), including a variety of endoglucanases and cellobiohydrolases, was incorporated into pMU562 for co-transformation. Synthetic sequences for these cellulase genes were originally obtained from Codon Devices and subsequently cloned into 2 ⁇ expression vectors for use in S.
- S. cerevisiae cells for transformation were prepared by growing to saturation in 5 mL YPD cultures, 4 mL of the culture was sampled, washed 2 ⁇ with cold distilled water, and resuspended in 640 ⁇ L cold distilled water. 80 ⁇ L of 100 mM Tris-HCl, 10 nM EDTA, pH 7.5 (10 ⁇ TE buffer—filter sterilized) and 80 ⁇ L of 1 M lithium acetate, pH 7.5 (10 ⁇ LiAc—filter sterilized) were added, and the cell suspension was incubated at 30° C. for 45 min. with gentle shaking. 20 ⁇ L of 1M DTT was added and incubation continued for 15 min.
- the cells were then centrifuged, washed once with cold distilled water, and once with electroporation buffer (1M sorbitol, 20 mM HEPES), and finally resuspended in 267 ⁇ L electroporation buffer.
- electroporation buffer (1M sorbitol, 20 mM HEPES)
- the same protocol was used for transforming K. lactis and K. marxianus strains, except that 50 mLs of YPD was inoculated with 0.5 mL from an overnight culture, grown for 4 hours at 37° C., and then centrifuged and prepared as above. Additionally, incubations and recovery steps were carried out at 37° C.
- yeast strains listed in Table 6 were created using the vectors and transformation protocols as described.
- the plasmid pBKD1-BGL1-sEG1 (pMU276) was digested with AccI and transformed to S. cerevisiae Y294 by electrotransformation to create a strain with delta integrated copies of the SfBGLI and TrEGI, designated M0243. Episomal plasmids were then transformed to S. cerevisiae Y294 and/or M0243.
- M0282 was created by transforming M0248 with AccI digested pBKD1-BGL1-sEGI, as described above, except that the transformation mixture was spread on plated containing 10 g/L BMCC with 10 g/L yeast extract and 20 g/L peptone.
- BMCC Bacterial microcrystalline cellulose
- Pretreated mixed hardwoods were generated by autohydrolysis of the substrate at 160 PSI for 10 minutes. Pretreated material was washed 5 times to remove inhibitors and soluble sugars and resuspended in distilled water. Samples were dried overnight at 105 C to determine the dry weight. Analysis of sugar content by quantitative saccharification showed a 50% glucan content.
- Phosphoric acid swollen cellulose was prepared as in Zhang and Lynd (2006), with only slight modifications.
- Avicel PIT 105 (10 g) was wetted with 100 mL of distilled water in a 4 L flask. 800 mL of 86.2% phosphoric acid was added slowly to the flask with a first addition of 300 mL followed by mixing and subsequent additions of 50 mL aliquots. The transparent solution was kept at 4° C. for 1 hour to allow complete solubilization of the cellulose, until no lumps remained. In the reaction mixture. Next, 2 L of ice-cooled distilled water was added in 500 mL aliquots with mixing between additions.
- ⁇ -glucosidase activity was measured in a manner similar to McBride, J. E., et ah, ( Enzyme Microb. Techol. 37: 93-101 (2005)), except that the volume of the assay was decreased and the reaction performed in a microliter plate. Briefly, yeast strains were grown to saturation in YPD or YPC media with or without appropriate antibiotics, the optical density at 600 nm (OD(600)) was measured, and an 0.5 ml, sample of the cultures was taken. This sample was centrifuged, the supernatant was separated and saved, and the cell pellet was washed 2 ⁇ 50 mM citrate buffer, pH 5.0.
- Reactions for supernatants were made up of 50 ⁇ L sample, 50 ⁇ L citrate buffer, and 50 ⁇ L 20 mM p-nitrophenyl- ⁇ -D-glucopyranoside (PNPG) substrate.
- Reactions with washed cells consisted of 25 ⁇ L of cells, 75 ⁇ L citrate buffer, and 50 ⁇ L PNPG substrate. If the activity was too high for the range of the standard curve, a lower cell concentration was used and the assay was re-run.
- the standard curve consisted of a 2-fold dilution series of nitrophenol (PNP) standards, starting at 500 nM, and ending at 7.8 nM, and a buffer blank was included.
- the microtiter plate was incubated at 37° C. for 10 minutes along with the reaction substrate. The reaction was carried out by adding the substrate, incubating for 30 min., and stopping with 150 ⁇ L of 2M Na 2 CO 3 . The plate was then centrifuged at 2500 rpm for 5 minutes, and 150 ⁇ L of supernatant was transferred to another plate. The absorbance at 405 nm was read for each well.
- Endoglucanase activity was qualitatively detected by observing clearing zones on synthetic complete media (as above, but including 20 g/L glucose) plates with 0.1% carboxymethyl cellulose (CMC) stained with congo red (Beguin, Anal. Biochem. 131: 333-6 (1983)), Cells were grown for 2-3 days on the plates and were washed off the plate with 1M Tris-HCL buffer pH 7.5. The plates were then stained for 10 minutes with a 0.1% Congo red solution, and extra dye was subsequently washed off with 1M NaCl.
- CMC carboxymethyl cellulose
- CBH1 activity was detected using the substrate 4-Methylumbelliferyl- ⁇ -D-lactoside (MULac). Assays were carried out by mixing 50 ⁇ L of yeast supernatant with 50 ⁇ L of a 4 mM MUlac substrate solution made in 50 mM citrate buffer pH 5.5. The reaction was allowed to proceed for 30 minutes and then stopped with 1M Na 2 CO 3 . The fluorescence in each well was read in a microtiter plate reader (ex. 355 nm and em. 460 nm).
- Enzyme activity on PASC and Avicel were measured using the protocol described in Den Haan el al., Enzyme and Microbiol Technology 40: 1291-1299 (2007). Briefly, yeast supernatants were incubated with cellulose at 4° C. to bind the cellulase. The cellulose was then filtered from the yeast supernatant, resuspended in citrate buffer and sodium azide, and incubated at 37° C. Accumulation of sugar was measured in the reaction by sampling and performing a phenol-sulfuric acid assay. (See Example 10 and Table 9.)
- Avicel activity levels were also generated using a 96-well plate method. (See Example 2.) Strains to be tested were grown in YPD in deep-well 96 well plates at 35° C. with shaking at 900 RPM. After growing, plates were centrifuged at 4000 rpm for 10 min. 300 ⁇ L substrate (2% avicel, 50 mM sodium acetate buffer, 0.02% sodium azide, 8-glucosidase—1 ⁇ L per mL) was added to a new 96-well deep well plate, without allowing the avicel to settle. 300 ⁇ L of yeast supernatant was added to this substrate, and 100 ⁇ L was taken for an initial sample.
- substrate 2% avicel, 50 mM sodium acetate buffer, 0.02% sodium azide, 8-glucosidase—1 ⁇ L per mL
- Tire assay plate is incubated at 35° C., with shaking at 800 rpm. and samples were taken at 24 and 48 hours. Samples were placed in 96-well PCR plates, and spun at 2000 rpm for 2 minutes. 50 ⁇ L of supernatant was then added to 100 ⁇ L of DNS reagent previously placed in a separate 96 well PCR plate, mixed, and heated to 99° C. for 5 minutes in a PCR machine, followed by cooling to 4° C. 50 ⁇ L was transferred to a microtiter plate and the absorbance was measured at 565 nm. The conversion of avicel was calculated as follows:
- Example 1 Production of Kluyveromyces Expressing Heterologous ⁇ -Glucosidase and Endoglucanase
- Kluyveromyces marxianus ATCC strain #10606; MO157
- Kluyveromyces lactis ATCC strain #34440
- FIG. 1 Vectors containing yeast delta integration sequences, the KanMX marker and sequences encoding Sf. BGLI and T.r. EGI (pBKD-BFLI-sEG1) were transformed into Kluyveromyces according to the yeast transformation protocol as described above, and selected on G418. Transformants were verified by PCR and then tested by CMC assay. The results are shown in FIG. 1 . The presence of the heterologous cellulase activity is indicated by a clearing zone on the CMC plate. As shown in FIG. 1 , neither an untransformed K. lactis strain (colony 8) or an untransformed K. marxianus strain (colony 16) showed endoglucanase activity. However, 6 of 7 transformed K. lactis colonies showed CMCase activity, and all 7 transformed K. marxianus colonies showed CMCase activity. MO413 and MO414 were identified as two K. marxianus colonies showing CMCase activity.
- K marxianus (MO157) was transformed with constructs containing T. reesei CBH2 . T. emersonii CBH1 or both.
- MO414 (K, marxianus transformed with Sf BGLI and T.r, EGI) was transformed with constructs containing T. reesei CBH2, T. emersonii CBH3 or both.
- Transformations were performed as described in above. CBH1 activity was then detected using the substrate 4-Methylumbelliferyl- ⁇ -D-lactoside (MU-Lac) as described above. The assay was performed on eight colonies of each transformant and the three colonies showing the highest activity were averaged. The results are shown in FIG. 2 and demonstrate that strains transformed with T. emersonii CBH1 had high MU-lac activity.
- MU-Lac 4-Methylumbelliferyl- ⁇ -D-lactoside
- the activity of Kluyveromyces strains expressing heterologous cellobiohydrolases on Avicel was also assessed.
- MO413 was transformed with vectors containing T. reesei CBH2 and T. emersonii CBH1 coding sequences along with a zeocin marker. Novel strain MO491 was created by this transformation and showed MU-lactoside activity.
- MO413 was transformed with vectors containg T. reesei CBH2 and T. emersonii CBH1 coding sequences along with a hygromycin marker, and strains MO599 and MO600 were isolated from this transformation.
- Activity on Avicel was assessed at 48 hours as described above, and the results, shown in FIG. 3 , demonstrate that Kluyveromyces expressing heterologous cellulases have Avicelase activity at 35° C. Avicelase activity at 45° C. was also demonstrated (data not shown).
- Kluyveromyces strains were also created by transforming yeast with a library of cellulases (creation of library was described above). For example, MO413 was transformed with a library of cellulases containing a zeocin marker to produce novel strains MO601-MO604 and MO611-MO617. In addition, MO157 ( K. maximus ) was transformed with the same library and novel strains MO618-MO625 were identified. Activity on Avicel was assessed at 48 hours as described above, and the results, shown in FIG. 3 , demonstrate that Kluyveromyces transformed with a library of heterologous cellulases also have Avicelase activity at 35° C. Transformants oi MO157 with the library showed the highest activity. Avicelase activity at 45° C. was also demonstrated (data not shown).
- BMCC bacterial microcrystalline cellulose
- T. emersonii CBH1 and T. reesei CBH2 were transformed with a construct allowing T. reesei EGI and S. fibuligera BGLI expression (pKD-BGLI-sEGI). That transformation was plated on a BMCC solid agar plate and five colonies appeared on the plate after seven days (data not shown). Yeast from the largest of the five colonies was isolated as strain MO282. (MO282 is described in more detail above.) The three control strains were tested for growth on the same plates. One strain expressed with T. emersonii CBH1 and T. reesei CBH2, and two strains expressed T. reesei EGI and S. fibuligera BGLI. No colonies appeared on plates with control yeast strains (data not shown).
- FIG. 5 shows that MO2S2. which expresses all 4 secreted cellulases grew to a much greater extent on BMCC than a plasmid only control (MO249), a strain expressing only T emersonii CBH1 and T. reesei CBH2 (MO249), and a strain expressing 4 tethered cellulases (MO144).
- Example 6 S. cerevisiae Expressing Heterologous Cellulases can Produce Ethanol from Avicel and Pretreated Hardwood
- transformed S. cerevisiae can produce ethanol directly from cellulose without exogenously added cellulase enzymes
- transformed strains were grown on Avicel as the sole carbon source.
- Avicel PH105 FMC Biopolymers
- Avicel media was made using the non-glucose components of synthetic complete medium for yeast including, yeast nitrogen base without amino acids—6.7 g/L, and supplemented with a complete amino acid mix (complete supplemental mixture), In some cases yeast extract (10 g/L) and peptone (20 g/L) (YP) were used as supplements in growth experiments. Cultivation conditions were anaerobic and were maintained by Hushing sealed glass bottles with N2 alter carbon source addition and before autoclaving. Non-carbon media components were added as 10 ⁇ solutions by filter sterilizing after autoclaving. Inoculation into Avicel cultures was done at 20% by volume. Quantification of ethanol in fermentation samples was carried out by HPLC analysis, and initial ethanol concentrations in bottles (from precultures) was subtracted from all subsequent data points.
- Strain MO288 (expressing S. fibuligera BOLT, T. reesei EGI, T. reesei CBH2, and 71 emersonii CBH1) was able to produce ethanol directly from avicel PH105 as compared to the control strain (MO249) when YNB media components were used.
- the data presented in FIG. 7 demonstrates that MO288 was also able to make ethanol from pretreated hardwoods without added enzyme.
- the strain made ⁇ 0.5 g/L more than the control when YP was used as media, and ⁇ 0.2 g/i, when YNB was used.
- Example 7 Transformed Yeast Strains and Externally Added Cellulases Act Synergistically to Produce Ethanol from Pretreated Mixed Hardwoods
- ethanol production at different external cellulase concentrations was evaluated in two different types of media using pretreated mixed hardwood. The results are shown in FIG. 9 .
- MO288 makes 6-9% more ethanol at the higher cellulase loadings, only 1% more at a 25% loading, and 100% more when no cellulase is loaded.
- MO288 makes 20-40% more ethanol at low cellulase loadings, and ⁇ 10% more ethanol at higher cellulase loadings.
- cellulase loading can be reduced ⁇ 15% compared to the control, and for YNB media, cellulase loading can be reduced ⁇ 5%.
- ethanol productivity was increased between 5 and 20% for strains expressing cellulases in YP media as compared to the control. It was increased between 10 and 20% for strains cultured in YNB media compared to the control.
- Example 8 Transformed Yeast Strains Also Increase Efficiency of Externally Added Cellulases in the Production of Ethanol from Avicel
- FIG. 12 presents cellulase enzyme savings based on theoretical ethanol yield at 168 hours in an SSF experiment. SSF was performed in 30 ml of nitrogen purged YP+15% Avicel in pressure bottles. External cellulase mix at a ratio of 5 Spyzme:1 Novozyme-188 was used. The experiment was continued for 168 hours and sampling was done each day for ethanol estimation by HPLC.
- the arrows in the figure depict the necessary cellulase loading needed to achieve the same ethanol production from cellulose as the control. This loading is consistently lower than for the control (i.e. the ethanol yield is consistently higher). For data at 168 hours, the average cellulase displacement (amount less that needs to be loaded) is 13.3% ⁇ 4.9%.
- Organism Genbank# Neosartorya fischeri XM_001258277 Gibberella zeae AY196784 Penicillium janthinellum X59054 Nectria haematococca AY502070 Fusarium poae AY706934 Chaetomium thermophilum AY861347 Aspergillus terreus XM_001214180 Penicillium chrysogenum AY790330 Neurospora crassa X77778 Trichoderma viride AY368686 Humicola grisea X17258 Thermoascus aurantiacus AF421954 Talaromyces emersonii AAL89553 Trichoderma reesei P62694 Phanerochaete chrysosporium Z29653 Aspergillus niger XM_001391971 Aspergillus niger X
- the artificial protein sequence was designed as a consensus (the most common) sequence for these proteins.
- the predicted signal sequence was exchanged by S. cerevisiae alpha mating factor pre signal sequence, and the sequence of the consensus CBH1 protein is shown below. Capital letters indicate the S. cerevisiae alpha mating factor pre signal sequence.
- the codon optimized sequence was inserted into the episomal yeast expression vector (pMU451) under control of ENO1 promoter and terminator into PacI/AscI sites.
- the resulting expression constructs (pMU505) was transformed into MO375 host strain that derived from Y294 (MOO 13) in which His3 and Trp1 auxotrophies were rescued by transformation with S. cerevisiae His3 and Trp1 PGR products.
- the resulting strain expressing the CBH1 consensus sequence was named MO429.
- MO429 had cellulase activity.
- an Avicel conversion assay was performed as described above and measured at 24 hours.
- S. cerevisiae expressing the consensus Cbh1 sequence (MO429) showed cellulase activity as compared to a negative control transformed with an empty vector (MO419).
- the cellulase activity of MO429 was also compared to that of yeast strains expressing other heterologous cellulases. The strains tested are summarized in Table 8 below.
- the avicel activity data for endoglucanases tested in S. cerevisiae is shown in FIG. 15 .
- the data demonstrate that among the EGs tested the C. formosanus EG demonstrated the highest avicel activity when expressed in S. cerevisiae.
- Example 11 Co-Cultures of Yeast Strains Expressing Different Heterologous Cellulases Produce Ethanol from Avicel
- a co-culture of a number of cellulase, producing yeast strains also showed the ability to make ethanol from Avicel PH105 in YNB media ( FIG. 16 ).
- 5 strains independently producing T. emersonii CBH1 (M0247), T. aurantiacus CBH1 (M0266), H. grisea CBH1 (M0265), a combination of T. emersonii CBH1 and T. reesei CBH2 (M0248), and a combination of T. reesei EGI and S. fibuligera BGLI (M0244) were mixed in equal proportion by volume and then inoculated at 20% by volume.
- heterologously expressed cellulases in each of these strains was secreted. Media and culture conditions were as described above for Avicel experiments.
- the data in FIG. 16 demonstrate that heterologous cellulases do not need to be expressed in an individual yeast strain in order to produce ethanol from cellulose. Instead, yeast strains expressing different secreted heterologous cellulases can be cultured together in order to produce ethanol from cellulose without the addition of any exogenous cellulases.
- FIG. 17 demonstrates that the co-cultured strains are capable of producing ethanol directly from avicel in the absence of any added cellulose enzyme.
- the co-culture produces about 4-fold more ethanol after 168 hours as compared to the control strain, and about 3-fold more than MO288.
- This co-culture was also used in SSF experiments where Zoomerase cellulase enzyme cocktail was used at 5 different loadings (10 mg protein/g avicel, 7.5 mg/g, 5 mg/g, and 2.5 mg/g, and 0 mg/g), and strains were inoculated at 10% by volume,
- FIG. 18 presents the raw data for ethanol production at a variety of cellulase loadings by the co-culture, MO288, and MO249.
- FIG. 18A shows that at all cellulase loadings tested, the co-cultured strains produced significantly more ethanol than a control not producing cellulase.
- FIG. 18B shows that at all cellulase loadings tested, the co-culture produced more ethanol than the previously tested strain MO288.
- FIG. 19 shows the percentage of the theoretical yield of ethanol that could be achieved with each of these cultures after 168 hours of SSF using a variety of cellulase loadings. The data demonstrate that the co-cultured strains would achieve about a 2-fold reduction in cellulase relative to the control strain, and approximately a 35% reduction compared to MO288.
- Example 12 Construction of a Robust Xylose-Utilizing Strain
- M0509 (ATCC deposit designation ______, deposited on Nov. 23, 2009) is a strain of Saccharomyces cerevisiae that combines the ability to metabolize xylose with the robustness required to ferment sugars in the presence of pretreated hardwood inhibitors. M0509 was created in a three-step process. First, industrial strains of S. cerevisiae were benchmarked to identify strains possessing a level of robustness/hardiness sufficient for simultaneous saccharification and fermentation (SSF) of pretreated mixed hardwood substrates. Strain M0086, a diploid strain of strain of S. cerevisiae , satisfied this first requirement. Second, M0086 was genetically engineered with the ability to utilize xylose, resulting in strain M0407. Third, M0407 was adapted for several weeks in a chemostat containing xylose media with pretreatment inhibitors, generating strain M0509.
- SSF simultaneous saccharification and fermentation
- Strain M0407 was genetically engineered from M0086 to utilize xylose. This engineering required seven genetic modifications. The primary modification was the functional expression of the heterologous xylose isomerase gene, XylA, isolated from the anaerobic fungus Piromyces sp. E2. The S. cerevisiae structural genes coding for all five enzymes involved in the conversion of xylulose to glycolytic intermediates were also overexpressed: xylulokinase, ribulose 5-phosphate isomerase, ribulose 5-phosphate epimerase, transketolase and transaldolase. In addition, the GRES gene encoding aldose reductase was deleted to minimise xylitol production.
- FIG. 39 The seven modified genes are listed in FIG. 39 .
- the genetic modifications at the GRE3, RKI1, RPE1, TAL1, and TKL1 loci were designed to leave behind minimal vector DMA and no antibiotic markers. Each locus' DNA was sequenced to confirm the expected results. Each of the seven genetic modifications were sequentially introduced into strain M0086.
- FIG. 40 shows the progression of modifications from top to bottom together with the designations for the strain at each step in the process, starting with M0086 and finishing with M0407.
- GRES The deletion of GRES and the increased expression of RKI1, RPE1, TAL1, and TKL1 involve modifications of the endogenous S. cerevisiae loci. In the case of GRES, both alleles were deleted. For the other four loci, only a single allele was modified.
- RKI1, RPE1, TAL1, and TKL1 were achieved by placing the S. cerevisiae Loose phosphate isomerase promoter, TP1, immediately 5′ of each of the four ORFs.
- TP1 S. cerevisiae Loose phosphate isomerase promoter
- small portions of their endogenous promoters were deleted.
- the introduction of the TP1 promoter at the RPE1 and TKL1 loci was done such that the RPE1 and TKL1 loci were duplicated with the duplicate copies of both loci being regulated by the TPI promoter.
- M0407 “adapted” colonies were screened in YPDXi media (100 g/L glucose, 50 g/L xylose, 25% MS149 pressate).
- M0407 and M0228 (a xylose-utilizing strain created at Mascoma containing XlyA and XKS1 on plasmids) were included as controls.
- the glucose had been entirely consumed by all strains, M0407 and M0228 had utilized 30 and 25 g/L of xylose respectively.
- All nine M0407 “adapted” colonics had utilized more than 44 g/L, of xylose. The highest amount of xylose consumed was 48 g/L. This strain was designated M0509.
- 18S rDNA sequencing was used to confirm strain M0509 as Saccharomyces cerevisiae (Kurtzman C P and Robnett, C J; FEMS Yeast Research 3 (2003) 417-432).
- a 1774 bp fragment spanning the 18S rDNA was amplified from M0509 genomic ON A and sent for sequencing.
- the 1753 bp of M0509 18S rDNA sequence exhibited a 100% match to the NCBI sequence for S. cerevisiae 18S (nucleotide accession #Z75578).
- strain M0509 was obtained by cultivating M0407 in a chemostat for four weeks, the length of cultivation separating tire two strains provides a means to asses the stability of the engineered genetic modifications. Comparison of the DNA sequence of M0407 and M0509 at the GRE3, RKI1, RPE1, TALL and TKL1 loci showed no changes.
- M0509 was cultivated for ⁇ 50 generations in liquid media with either glucose or xylose as the sole carbon source. After 50 generations, an individual colony was isolated from each culture and the number of XylA/XKS1 integrations quantified and compared to the original M0509 freezer stock. The colony isolated from the xylose-culture had ⁇ 20 copies of XylA/XKS1, the same as the freezer stock. The glucose-cultured colony exhibited a slightly decreased copy number, ⁇ 16.
- the freezer and xylose-propagated isolates utilized all of the xylose in 24 hours and produced identical amounts of ethanol, but the glucose-propagated strain consumed only half as much xylose.
- FIG. 20 The freezer and xylose-propagated isolates utilized all of the xylose in 24 hours and produced identical amounts of ethanol, but the glucose-propagated strain consumed only half as much xylose.
- Example 13 Selection of a Thermotolerant, Robust, Xylose-Utilizing Strain
- M1105 is capable of fermentation at temperatures above 40° C. in the presence of 8 g/L acetate. M1105 was constructed in a M0509 background and is therefore an industrially robust strain capable of converting both glucose and xylose into ethanol.
- M1105 was isolated following four rounds of selection/adaptation in a cytostat as outlined in FIG. 41 and described as follows. The temperature was increased from 38° C. to 41° C. during the course of the experiment. M1017 (ATCC deposit designation ______, deposited on Nov. 23, 2009) was isolated from this first cytostat nan and was later confirmed by PCR of the GRE3 locus to be a descendant of M0509. M1017 was used to inoculate a second cytostat run using YMX media (yeast nitrogen base, 2 g/L xylose) at 41° C. M1046 was isolated from this second cytostat run. At 42° C.
- YMX media yeast nitrogen base, 2 g/L xylose
- M1046 grew slowly yet with a doubling time 36% shorter than M1017.
- M1080 was isolated from a cytostat inoculated with M1046 and YMX media at 40° C., M1080 grew with a specific growth rate of 0.22 h ⁇ 1 on YMX at 40° C.
- M1105 was isolated from M1080 based on selection in the cytostat using YPD2 ⁇ 10+acetate media (2 g/L glucose, 10 g/L xylose, 8 g/L acetate, pH 5.4) at 39° C.
- M1105 grows 10-20% faster than M0509 in rich media at 35° C.
- M1105 has increased acetate tolerance as the strain can grow more quickly than its ancestral strains in the presence of acetate.
- FIG. 21 While, the parental strains required glucose for tolerance to acetate at high temperatures, M1105 does not require glucose or complex medium components to grow in the presence of 7 g/L acetate at pH 5.4.
- M1105 was inoculated at approximately 0.7 g/L DCW in 18% MS419 using 3.8 mg Zoomerase/g feedstock at 40° C. M1105 produced 3.55% (w/v) ethanol by 168 hours.
- the time course is presented in FIG. 22 along with a similar run performed with M1088 (described below) for comparison.
- a similar run using only 0.15 g/L DCW for inoculum resulted in 2.9% (w/v) ethanol and some sugar accumulation during the experiment.
- FIG. 23 .
- Example 14 Adaptation of a Thermotolerant, Robust, Xylose-Utilizing Strain
- M1254 is capable of fermentation at temperatures above 40° C. in the presence of 12 g/L acetate, exhibiting an increased robustness relative to the thermotolerant strain M1105.
- M1254 was isolated following three rounds of selection/adaptation in a cytostat as outlined in Table 11 and FIG. 42 and described as follows.
- the first cytostat run was inoculated with M1105.
- YMX media yeast nitrogen base w/o amino acids, 20 g/L xylose
- 8 g/L acetate was used at pH 5.5 and 40° C.
- M1155 was isolated from this first cytostat run and used to inoculate a second cytostat containing YPD media (yeast extract, peptone, 20 g/L glucose) plus 12 g/L acetate at pH 5.4 and 41° C.
- M1202 was isolated from this second cytostat run.
- M1254 was isolated from a third cytostat run inoculated with both M1155 and M1202 in yeast nitrogen base w/o amino acids+5% solids equivalent MS419 hydrolysate media at pH 4.8, 39° C.
- M1254 grows 7.3 ⁇ 0.9% faster than M1202 and 17 ⁇ 2.0% faster than M1155 in 5% solids equivalent MS419 hydrolysate, which is the condition under which strain M1254 was selected.
- standard fermentation medium limits fermentation performance. Accordingly, use of this strain should be with lower ammonium concentrations, such as 1.1 g/L diammonium phosphate (DAP) or lower than 3 g/L DAP.
- DAP diammonium phosphate
- Figure. 24 demonstrates the higher fermentation rate using the lower DAP concentration. The fermentations were performed using 18% MS149, 4 mg external cellulase/g IS, 40° C. 0.5 g/L inoculation DCW M1254 and pH 5.4.
- the pH was controlled using 5 M potassium hydroxide, and 1 g/L magnesium carbonate was fed with each solids feeding. All enzyme was front loaded, while the solids were fed at five time points (0, 3, 6, 24, and 48 hours) in equal size feedings of 0.3.6% TS.
- MO1360 was created from M1254 using the evolutionary conditions described in Table 12 below.
- M1360 while still substantially inhibited by the synthetic inhibitor mixture, grows at 40° C. with a doubling time of approximately 5 hours.
- FIG. 25 In industrially relevant medium, M1360 is able to generate over 60 g/L ethanol from glucose along with 5 g/L dry cell weight in 48 h at 40° C. beginning with only 60 mg/L dry cell weight.
- FIG. 26 In industrially relevant medium, M1360 is able to generate over 60 g/L ethanol from glucose along with 5 g/L dry cell weight in 48 h at 40° C. beginning with only 60 mg/L dry cell weight.
- FIG. 27 shows three equivalent SSFs with 18% PHW solids loaded. The reactions carried out at 40° C. show approximately 17% more ethanol produced than the control reaction carried out at 35° C., when both reactions were earned out at the same external enzyme loading (4 mg/g). This increased performance represents a substantial cost savings for the process.
- Example 15 Expression of Cellulases in a Robust Xylose-Utilizing Strain
- M1088 is capable of secreting three distinct cellulolytic enzymes: ⁇ -glucosidase from S. fibuligera (SfBGL), cellobiohydrolase 2b from C. lucknowense (ClCBU2b), and cellobiohydrolase 1 from T emersonii fused to the T. reesei cellobiohydrolase I cellulose binding domain (TeCBH1+CBDTrCBH1).
- the M1088 genome also contains genes that encode for polypeptides capable of providing resistance to the following antibiotics: kanamycin, nourseothricin, and hygromycin B.
- Plasmid pMU624, which is also present in M1088, contains a gene encoding for a polypeptide capable of providing resistance to ampicillin.
- the steps used to generate M1088 and M0963 from M0509 are summarized in Table 13 below.
- the KanMX gene RPEI+/loxP-PTPI-RPEI cassette provides resistance to TKL+/loxP-PTPI-TKL delta::PTPI- kanamycin (an aminoglycoside xylA PADH1-XKS::delta antibiotic).
- M0544 ura-3::kanMX/ura-3::kanMX M0539 The second copy of the genomic gre3::loxP/gre3::loxP TAL1+/loxP- URA-3 gene was deleted and PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 replaced with a kanMX cassette.
- the nat1 gene cassette provides TKL+/loxP-PTPI-TKL delta::PTPI- resistance to the antibiotic xylA PADH1-XKS::delta nourseothricin/clonNAT (an (pMU782)fur1::nat aminoglycoside antibiotic).
- PADH1-XKS::delta nourseothricin/clonNAT an (pMU782)fur1::nat aminoglycoside antibiotic.
- the plasmid pMU624 was 3::kanMX gre3::loxP/gre3::loxP transformed into the strain.
- pMU624 TAL1+/loxP-PTPI-TAL1 can replicate in S.
- xylA PADH1-XKS::delta pMU624 also carries the T. emersonii (pMU782)fur1::nat; [pMU624] CBH1 + CBDTrCBH1 gene regulated by the ENO1 promoter and terminator.
- the PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 hygMX gene cassette encodes for a RPE1+/loxP-PTPI-RPE1 hygromycin B phosphotransferase TKL+/loxP-PTPI-TKL delta::PTPI- that confers resistance to hygromycin xylA PADH1-XKS::delta B (an aminoglycoside antibiotic).
- the other (pMU1260) delta::PGKprom- cassette contained the cellulolytic SfBGL-PGKterm, ENO1prom- genes S. fibuligeria BGL and a TeCBH + TrCBD-ENO1term T. emersonii chimeric CBH1.
- gre3::loxP/gre3::loxP TAL1+/loxP- 24 of the resulting colonies were then PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 passaged for a week in YPD media RPE1+/loxP-PTPI-RPE1 containing zeocin at a low level (50 TKL+/loxP-PTPI-TKL delta::PTPI- ug/mL), and assayed.
- the resulting xylA PADH1-XKS::delta strain M0963 was the best of those (pMU782) fur1::nat; [pMU624]; found in the avicel assay.
- Endoglucanases augment the activity of cellobiohydrolases, and therefore, the ability of family 5 endoglucanases to complement the previously identified CBH1 and CBH2 was investigated. Five family 5 endoglucanases were selected and cloned under control of the ENO1 promoter/terminator using the pRDH122 expression plasmid as shown in Table 14.
- FIG. 28 shows several of the M0749 strains that were spotted on SC ⁇ URA plates containing 0.2% of either CMC or lichenin or barley- ⁇ -glucan.
- the M0749 reference strain yielded small zones on the CMC containing plates.
- Both pMU471 ( Coptotermes formosanus EG) and pRDH147 based strains yielded very good clearing zones on all the tested substrates.
- the five eg2 expressing strains ware tested for avicel and PASC hydrolysis while the cbh2 expressing strains were tested for activity on avicel.
- the strains were grown in double strength SC ⁇ URA medium (3.4 g/L YNB; 3 g/L amino acid dropout pool without uracil; 10 g/L ammonium sulfate; 20 g/L glucose) that was buffered to pH 6 (20 g/L succinic acid; 12 g/L NaOH, set pH to 6 with NaOH). 10 mL Cultures in 125 mL Erlenmeyer flasks were grown at 30° C.
- the H. jecorina EG2 produced by Y294 and M0749 was visible as ⁇ 57 kDa bands.
- the increased weight compared to the predicted 44 kDA size may represent hyperglycosylation.
- the A. kawachii EGA produced by Y294 was visible as a ⁇ 42 kDa band.
- the A. kawachii EGA produced by M0749 was clearly visible as a ⁇ 120 kDa band.
- the extra weight may signify hyperglycosylation.
- the M0749 strain expressing H.j.eg2 produced the highest levels of secreted activity as measured on PASC or avicel of the EG2s tested.
- the activity of this enzyme was higher on PASC and avicel than C.f.EG (pMU471).
- the synthetic A.k.EGA (pRDH145) also gave appreciable activity on both substrates. This product seems to have been produced at higher levels in M0749 than in Y294 and yielded greater activity than C.f.EG on avicel and PASC when produced in this strain.
- Example 17 Expression of an Endoglucanase in Robust Xylose-Utilizing Yeast
- M1088 was transformed with a construct to integrate TrEG2 at the rDNA locus using the Sh-ble gene as a marker (pMU1409).
- a similar transformation was done, but integrating TeCBH1 w/TrCBD to increase the copy number of that gene, 43 transformants front both transformations along with duplicate M1088 cultures were grown in 20 ug/ml, zeocin containing YPD and the avicel assay was performed.
- FIG. 31 shows the results of those assays. The data show that a very large proportion of strains transformed with the TrEG2 construct had significantly increased avicel conversion ability, while transformants with additional TeCBH1w/TrCBD copies had only marginal improvements in avicel hydrolysis.
- strain M1403 which contains heterologous genes encoding S. fibuligera (SfBGL), cellobiohydrolase 2b from C. lucknowense (CICBH2b), cellobiohydrolase I from T. emersonii fused to the T. reesei cellobiohydrolase I cellulose binding domain (TeCBH1+CBDTrCBH1), and Heterodera schachtii eng1 was produced in the M1254 background.
- Strain M1284 which contains heterologous genes encoding those same four cellulases was produced in the M0509 background. Strains M1284 and M1403 are described in more detail in Table 15.
- TeCBH + TrCBD-ENO1term delta::PGKprom-SfBGL- PGKterm, ENO1prom-ClCBH2- ENO1term (pMU1409) rDNA::ZeoMX, ENO1prom-HjEG2- ENO1term M0991 gre3::loxP/gre3::loxP TAL1+/loxP- M0509
- a single copy of the genomic LEU-2 PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 gene was deleted and replaced with a RPE1+/loxP-PTPI-RPE1 hygMX cassette.
- TKL+/loxP-PTPI-TKL delta :PTPI- xylA PTPI-XKS LEU2/leu2D::hph M0992 gre3::loxP/gre3::loxP TAL1+/loxP- M0991
- the second copy of the genomic PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 LEU-2 gene was deleted and RPE1+/loxP-PTPI-RPE1 replaced with a Streptomyces noursei TKL+/loxP-PTPI-TKL delta::PTPI- nat1 cassette.
- Linear DNA cassettes created by PTP1-TAL1 RKI1+/loxP-PTPI-RKI1 restriction digests of plasmids RPE1+/loxP-PTPI-RPE1 pMU1169 and pMU1409 were TKL+/loxP-PTPI-TKL delta::PTPI- integrated in multiple copies into the xylA PTPI-XKS leu2D::hph/ genome at the Ty1 delta sites and leu2D::nat rDNA sites.
- CBH1 T. emersonii CBH1 w/ T. reesei CBD attached
- CBH2 C. lucknowense CBH2b
- EG2 T. reesei EG2
- BGL S. fibuligera BGL
- FIG. 33 presents data from a CBP fermentation of paper sludge by an engineered thermotolerant S. cerevisiae host strain (parent strain M1254, cellulolytic derivative M1403).
- the data for M1254 alone demonstrates that the addition of cellulase (i.e. zoomerase) is required for ethanol production from paper sludge.
- the data for M1430 where no external cellulase is added (filled orange squares), demonstrates that this strain can convert a substantial fraction ( ⁇ 80%) of the “convertible” substrate by virtue of its expressed cellulases. Fermentations with additional external cellulase added to the M1403 strain demonstrate the ultimate potential of enzymatic conversion for the paper sludge substrate. Visual inspections demonstrated that the non-CBP strain was not able to liquefy the substrate, whereas the CBP strain was.
- the CBP strain M1179 which expresses CBH1, CBH2, RG2, and BGL can convert paper sludge to a large extent without added cellulase enzyme.
- FIG. 34 The control strain in this reaction, M0509, made only a small amount of ethanol during this reaction. The data also show that. M1179 can convert this material when loaded at lower cell density (1 g/L) as opposed to the higher cell density (10 g/L) used in other reactions. This implies that the strain is able to grow and produce cellulase throughout the fermentation experiments.
- Pretreated hardwood can also be converted by CRP strains.
- FIG. 35 shows the effect of using a cellulase expressing strain (M0963), compared to a control strain not expressing celluloses (M0509) during fermentation of PHW.
- M0963 cellulase expressing strain
- M0509 control strain not expressing celluloses
- FIG. 36 shows that a 30% washed solids fermentation can generate titers of ethanol up to about 70 g/L with minimal external enzyme loaded 4 mg/g and a relatively low cell inoculum (2 g/L).
- the ability of the low cell density cultivation to eventually catch up to and pass the high cell density culture indicates that the strain grows and continues to make enzyme throughout the fermentation.
- FIG. 37 demonstrates that pretreated corn stover can be converted well by GBP yeast strains.
- the CBP strain in this experiment was able to convert about 82% of what was converted with a high enzyme loading (15 FPU, or about 20 mg/g) could achieve.
- the non-CBP strain made about 60% of the ethanol that the CBP strain was able to achieve.
Abstract
The present invention is directed to cellulytic host cells. The host cells of the invention expressing heterologous cellulases and are able to produce ethanol from cellulose. According to the invention, host cells expressing a combination of heterologous cellulases can be used to produce ethanol from cellulose. In addition, multiple host cells expressing different heterologous cellulases can be co-cultured together and used to produce ethanol from cellulose. Furthermore, the invention demonstrates for the first time the ability of Kluyveromyces to produce ethanol from cellulose. The yeast strains and co-cultures of yeast strains of the invention can be used to produce ethanol on their own, or can also be used in combination with externally added cellulases to increase the efficiency of saccharification and fermentation processes.
Description
- The present application is a continuation of U.S. application Ser. No. 13/130,549, filed Feb. 7, 2012, which is a '371 National Stage Application of International Application No. PCT/US2009/065571, filed Nov. 23, 2009, which claims the benefit of U.S. Provisional Application No. 61/116,981, filed Nov. 21, 2008. The entire contents of each application are incorporated herein by reference in their entirety.
- The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Sep. 23, 2015, is named 191SeqList.txt and is 169,788 bytes in size.
- Lignocellulosic biomass is widely recognized as a promising source of raw material for production of renewable fuels and chemicals. The primary obstacle impeding the more widespread production of energy from biomass feedstocks is the general absence of low-cost technology for overcoming the recalcitrance of these materials to conversion into useful fuels. Lignocellulosic biomass contains carbohydrate fractions (e.g., cellulose and hemicellulose) that can be converted into ethanol. In order to convert these fractions, the cellulose and hemicellulose must ultimately be converted or hydrolyzed into monosaccharides; it is the hydrolysis that has historically proven to be problematic.
- Biologically mediated processes are promising for energy conversion, in particular for the conversion of lignocellulosic biomass into fuels. Biomass processing schemes involving enzymatic or microbial hydrolysis commonly involve four biologically mediated transformations: (1) the production of saccharolytic enzymes (cellulases and hemicellulases); (2) the hydrolysis of carbohydrate components present in pretreated biomass to sugars; (3) the fermentation of hexose sugars (e.g., glucose, mannose, and galactose); and (4) the fermentation of pentose sugars (e.g., xylose and arabinose). These four transformations occur in a single step in a process configuration called consolidated bioprocessing (CBP), which is distinguished from other less highly integrated configurations in that it does not involve a dedicated process step for cellulase and/or hemicellulase production.
- CBP offers the potential for lower cost and higher efficiency than processes featuring dedicated cellulase production. The benefits result in part, from avoided capital costs, substrate and other raw materials, and utilities associated with cellulase production. In addition, several factors support the realization of higher rates of hydrolysis, and hence reduced reactor volume and capital investment using CBP, including enzyme-microbe synergy and the use of thermophilic organisms and/or complexed cellulase systems. Moreover, cellulose-adherent cellulolytic microorganisms are likely to compete successfully for products of cellulose hydrolysis with non-adhered microbes, e.g., contaminants, which could increase the stability of industrial processes based on microbial cellulose utilization. Progress in developing CBP-enabling microorganisms is being made through two strategies: engineering naturally occurring cellulolytic microorganisms to improve product-related properties, such as yield and titer, and engineering non-cellulolytic organisms that exhibit high product yields and titers to express a heterologous cellulase and hemicellulase system enabling cellulose and hemicellulose utilization.
- Three major types of enzymatic activities are required for native cellulose degradation; The first type are endoglucanases (1,4-β-D-glucan 4-glucanohydrolase; EC 3.2.1.4). Endoglucanases cut at random in the cellulose polysaccharide chain of amorphous cellulose, generating oligosaccharides of varying lengths and consequently new chain ends. The second type are exoglucanases, including cellodextrinases (1,4-β-D-glucan glucanohydrolases; EC 3.2.1.74) and cellobiohydrolases (1,4-β-D-glucan cellobiohydrolases; EC 3.2.1.91), Exoglucanases act in a processive manner on the reducing or non-reducing ends of cellulose polysaccharide chains, liberating either glucose (glucanohydrolases) or cellobiose (cellobiohydrolase) as major products. Exogfucanases can also act on microcrystalline cellulose, presumably peeling cellulose chains from the microcrystalline structure. The third type are β-glucosidases (β-glucoside glucohydrolases; EC 3.2.1.21). β-Glucosidases hydrolyze soluble cellodextrins and cellobiose to glucose units.
- Bakers' yeast (Saccharomyces cerevisiae) remains the preferred micro-organism for the production of ethanol (Hahn-Hägerdal, B., et al., Adv. Biochem. Eng. Biotechnol. 73, 53-84 (2001)). Favorable attributes of this microbe include (i) high productivity at close to theoretical yields (0.51 g ethanol produced/g glucose used), (ii) high osmo- and ethanol tolerance, (iii) natural robustness in industrial processes, and (iv) being generally regarded as safe (GRAS) due to its long association with wine and bread making, and beer brewing. Furthermore, S. cerevisiae exhibits tolerance to inhibitors commonly found in hydrolyzates resulting from biomass pretreatment.
- One major shortcoming of S. cerevisiae is its inability to utilize complex polysaccharides such, as cellulose, or its break-down products, such as cellobiose and cellodextrins. In attempt to address this problem, several heterologous cellulases from bacterial and fungal sources have been transferred to S. cerevisiae, enabling the degradation of cellulosic derivatives (Van Rensburg, P., et al. Yeast 14, 67-76 (1998)), or growth on cellobiose (Van Rooyen, R., et al., J. Biotech. 120, 284-295 (2005)); McBride, J. E., et al., Enzyme Microb. Techol. 37, 93-101 (2005)). However, current levels of expression and specific activity of cellulases heterologously expressed in yeast are still not sufficient to enable efficient growth and ethanol production by yeast on cellulosic substrates without externally added enzymes. There remains a significant need for improvement in the amount of cellulase activity in order to attain the goal of achieving a consolidated bioprocessing (CBP) system capable of efficiently and cost-effectively converting cellulosic substrates to ethanol.
- Another major shortcoming of the use of S. cerevisiae is that externally produced cellulases function optimally at a higher temperature than the temperature at which S. cerevisiae function optimally. Thus, either the processing must be carried out in a two step process at two different temperatures or one temperature can be selected where both processes function to some extent, but at least one of the processes does not occur at optimal efficiency.
- In order to address these limitations, the present invention provides for heterologous expression of wild-type and codon-optimized combinations of heterologous cellulases in yeast that allows efficient production of ethanol from cellulose sources. The invention also provides for expression of such heterologous cellulases in thermotolerant yeast and methods of using such transformed yeast for ethanol production.
- The present invention is directed to cellulytic host cells. The host cells of the invention expressing heterologous cellulases and are able to produce ethanol from cellulose.
- In particular, in some embodiments, the invention provides a transformed thermotolerant yeast, host ceil comprising at least one heterologous polynucleotide comprising a nucleic acid encoding a cellulase, wherein the yeast host cell is capable of producing ethanol when grown using cellulose as a carbon source.
- In another embodiment, the invention provides a transformed thermotolerant yeast host cell comprising: (a) at least one heterologous polynucleotide comprising a nucleic acid which encodes an endoglucanase; (b) at least, one heterologous polynucleotide comprising a nucleic acid which encodes a β-glucosidase; (c) at least one heterologous polynucleotide comprising a nucleic acid which encodes a first cellobiohydrolase; and (d) at least one heterologous polynucleotide comprising a nucleic acid which encodes a second cellobiohydrolase.
- In another embodiment, the invention provides a transformed yeast host cell comprising: (a) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is an endoglucanase; (b) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a β-glucosidase; (c) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a first cellobiohydrolase; and (d) at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a second cellobiohydrolase, wherein at least two of the cellulases are secreted by the cell.
- In yet another embodiment, the invention provides a transformed yeast host cell comprising at least six heterologous polynucleotides, wherein each heterologous polynucleotide comprises a nucleic acid which encodes a cellulase.
- In yet another embodiment, the invention provides a transformed yeast host cell comprising at least four heterologous polynucleotides, wherein each heterologous polynucleotide comprises a nucleic acid which encodes an endoglucanase.
- In still another embodiment, the invention provides a co-culture comprising at least two yeast host cells wherein (a) at least one of the host cells comprises a first heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is an endoglucanase; (b) at least one of the host cells comprises a second heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a β-glucosidase; (c) at least one of the host cells comprises a third heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a first cellobiohydrolase; (d) at least one of the host cells comprises a fourth heterologous polynucleotide comprising a nucleic acid which encodes a cellulase which is a second cellobiohydrolase; wherein the first polynucleotide, the second polynucleotide, the third polynucleotide and the fourth polynucleotide are not in the same host cell; and wherein the co-culture is capable of producing ethanol from cellulose.
- In some particular embodiments of the invention, the cellulose carbon source is insoluble cellulose, crystalline cellulose, cellulose derived from lignocellulose, hardwood, phosphoric acid swollen cellulose or microcrystalline cellulose.
- In some embodiments, the host cells of the invention comprise a heterologous polynucleotide comprising a nucleic acid encoding a first cellobiohydrolase, a polynucleotide comprising a nucleic acid encoding an endoglucanase, a polynucleotide comprising a nucleic acid encoding a β-glucosidase and/or a polynucleotide comprising a nucleic acid encoding a second cellobiohydrolase.
- In some embodiments, the cellulase, endoglucanase, β-glucosidase or cellobiohydrolase is a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas firni, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, or Arabidopsis thaliana cellulase, endoglucanase, β-glucosidase or cellobiohydrolase.
- In some particular embodiments, the cellobiohydrolase is an H. grisea CBH1, a T. aurantiacus CBH1, a T. emersonii CBH1, a T. reesei CBH1, a T. emersonii CBH2, a C. lucknowense CBH2 or a T. reesei CBH2. In some embodiments, the heterologous polynucleotide comprising a nucleic acid which encodes a cellobiohydrolase, encodes a fusion protein comprising a cellobiohydrolase and a cellulose binding module (CBM). In some particular embodiments, the CBM is the CBM of T. reesei CBH2, the CBM of T. reesei CBH1 or the CBM of C. lucknowense CBH2b. In some particular embodiments, the CBM is fused to the cellobiohydrolase via a linker sequence. In some particular embodiments, the host cell expresses a first and a second cellobiohydrolase, wherein the first cellobiohydrolase is a T. emersonii CBH1 and CBD fusion, and the second cellobiohydrolase is a C. lucknowense CBH2b.
- In other particular embodiments, the β-glucosidase is a S. fibuligera β-glucosidase. In another particular embodiment, the endoglucanase is a C. formosanus endoglucanase. In another particular embodiment, the endoglucanase is a T. reesei endoglucanase, e.g. T. reesei EG2.
- In some embodiments of the invention, at least one or at least two of the cellulases is tethered. In other embodiments of the invention, at least one of the cellulases is secreted. In another embodiment, at least one of the cellulases is tethered and at least one of the cellulases is secreted. In another embodiment, all of the cellulases are secreted.
- In some embodiments of the invention, the nucleic acid encoding, a cellulase is codon optimized.
- In some embodiments, the host cell can be a thermotolerant host cell. In some embodiments, the host cell is a Issatchenkia orientalis, Pichia mississippiensis, Pichia mexicana, Pichia farinosa, Clavispora opuntiae, Clavispora lusitaniae, Candida mexicana, Hansenula polymorpha or Kluyveromyces host cell. For example, in some embodiments, the host cell is a K. lactis or K. maximus host cell. In some embodiments, the thermotolerant host cell is an S. cerevisiae host cell, wherein the S. cerevisiae is selected to be thermotolerant.
- In some embodiments, the host cell can be an oleaginous yeast cell. In some particular embodiments, the oleaginous yeast cell is a Blakeslea, Candida, Cryptococcus, Cunninghamella, Lipomyces, Mortierella, Mucor, Phycomces, Pythium, Rhodosporidium, Rhodotorula, Trichosporon or Yarrowia cell.
- In some embodiments, the host cell is a Saccharomyces cerevisiae cell.
- In some particular embodiments, the host cell can produce ethanol from cellulose at temperatures above about 30° C., 35° C., 37° C., 42° C., 45° C. or 50° C.
- In another particular embodiment, the host cell can produce ethanol at a rate of at least about 10 mg per hour per liter, at least about 30 mg per hour per liter, at least about 40 mg per hour per liter, at least about 50 mg per hour per liter, at least about 60 mg per hour per liter, at least about 70 mg per hour per liter, at least about 80 mg per hour per liter, at least about 90 mg per hour per liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, at least about 500 mg per hour per liter, at least about 600 mg per hour per liter, at least about 700 mg per hour per liter, at least about 800 mg per hour per liter, at least about 900 mg per hour per liter, or at least about 1 g per hour per liter.
- The present invention also provides methods of using the host cells and co-cultures of the invention. For example, the present invention is also directed to a method for hydrolyzing a cellulosic substrate, comprising contacting said cellulosic substrate with a host cell or co-culture of the invention. The invention is also directed to a method of fermenting cellulose comprising culturing a host cell or co-culture of the invention in medium that contains insoluble cellulose under suitable conditions for a period sufficient to allow saccharification and fermentation of the cellulose. In some particular embodiments, the methods further comprise contacting, the cellulosic substrate with externally produced cellulase enzymes.
- In some particular methods of she invention, the cellulosic substrate is a lignocellulosic biomass selected from the group consisting of grass, switch grass, cord grass, rye grass, reed canary grass, miscanthus, sugar-processing residues, sugarcane bagasse, agricultural wastes, rice straw, rice hulls, barley straw, corn cobs, cereal straws wheat straw, canola straw, oat straw, oat hulls, coni fiber, stover, soybean stover, corn stover, forestry wastes, recycled wood pulp fiber, paper sludge, sawdust, hardwood, softwood, Agave, and combinations thereof.
- In some particular methods of the invention, the host cell or co-culture produces ethanol. The ethanol can be produced at a rate of at least about 10 mg per hour per liter, at least, about 30 mg per hour per liter, at least about 40 mg per hour per liter, at least about 50 mg per hour per liter, at least about 60 mg per hour per liter, at least about 70 mg per hour per liter, at least about 80 mg per hour per liter, at least about 90 mg per hour pea-liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, at least about 500 mg per hour per liter, at least about 600 mg per hour per liter, at least about 700 mg per hour per liter, at least about 800 mg per hour per liter, at least about 900 mg per hour per liter, or at least about 1 g per hour per liter.
- In other particular methods of the invention, the host cell or co-cultures contact a cellulosic substance at a temperature of at least about 37° C., least about 42° C., from about 42° C. to about. 45° C., or from about 42° C. to about 50° C.
-
FIG. 1 shows an image of a CMC plate assay to detect endoglucanase I activity in K. lactis (colonies numbered 1-8) and K. maximus strains (colonies numbered 9-16) transformed with heterologous cellulases.Strains -
FIG. 2 depicts the results of an MU-lac assay to detect CBH1 activity in K. maximus strains transformed with heterologous cellulases. -
FIG. 3 depicts the percent of Avicel converted by several strains of K. maximus expressing heterologous cellulases. -
FIG. 4 depicts the ethanol production/consumption from Avicel by several strains of K. maximus expressing heterologous cellulases. -
FIG. 5 depicts the growth of S. cerevisiae expressing heterologous cellulases on bacterial microcrystalline cellulose (BMCC). -
FIG. 6 depicts the ethanol production from Avicel by an S. cerevisiae strain expressing heterologous cellulases. -
FIG. 7 depicts the ethanol production from pretreated hardwood (5% based on a dry weight percentage) by an S. cerevisiae strain expressing heterologous cellulases. -
FIG. 8 depicts the ethanol production from pretreated hardwood (5% based on a dry weight percentage) by an S. cerevisiae expressing heterologous cellulases in the presence of various concentrations of exogenously added cellulases. -
FIG. 9 depicts the ethanol production from Avicel by MO288 (circles) and a control strain (triangles) in both YP media and YNB media. -
FIG. 10 depicts the ethanol yield from Avicel (15% based on a dry weight percentage) by a small scale simultaneous saccharification and fermentation (SSF) process using S. cerevisiae supplemented with external cellulases. The yield from a yeast strain expressing heterologous cellulases (MO288) is compared to the yield from a control strain (MO249) at a variety of external cellulase concentrations over 150 hours. (100% cellulase loading indicates 25 mg/g total solids; initial solids concentration was 15%.) -
FIG. 11 depicts the theoretical ethanol yield from a simultaneous saccharification and fermentation (SSF) process using S. cerevisiae supplemented with external cellulases. The yield from a yeast strain expressing heterologous cellulases (MO288) is compared to the yield from a control strain (MO249). -
FIG. 12 illustrates the predicted cellulase enzyme savings based on ethanol yield at 168 hours of simultaneous saccharification and fermentation (SSF) process. -
FIG. 13 shows the activity of an artificial cellulase in the Avicel conversion assay as described in Example 9. The MO429 strain was transformed the CBH1 consensus sequence “CBH1cons,” and the MO419 strain was transformed with empty pMU451 vector as a negative control. Descriptions of other strains are found in Table 8 of Example 9. -
FIG. 14 demonstrates the activity of yeast expressing various combinations of CBH1 and CBH2 enzymes on Avicel as described in Example 10. -
FIG. 15 demonstrates the activity of yeast expressing various cellulase enzymes on Avicel as described in Example 10. -
FIG. 16 depicts the ethanol production front Avicel by a co-culture of live S. cerevisiae strains expressing heterologous cellulases. -
FIG. 17 depicts the ethanol production from Avicel by a co-culture of four S. cerevisiae strains expressing heterologous cellulases as well as the ethanol production from strain MO288, which is expressing four cellulases. -
FIG. 18 depicts the ethanol production from Avicel by a co-culture of four S. cerevisiae strains expressing heterologous cellulases in combination with externally added cellulase. -
FIG. 19 depicts the calculated enzyme savings using a co-culture of four S. cerevisiae strains expressing heterologous cellulases or MO288 as compared to untransformed S. cerevisiae. -
FIG. 20 depicts the xylose utilization and ethanol production of M0509 freezer stock, YPX-isolate and YPD-isolate. -
FIG. 21 depicts the growth of M1105 (labeled “colony C2”) and MO1046 in the presence of tire same medium and 8 g/L acetate at 40° C. -
FIG. 22 depicts the ethanol production by M1105 (triangles) and M1088 (squares) on 18% TS MS419. The experiment with M1105 had 10% lower enzyme dose and half the inoculated cell density, but produced a higher ethanol titer. The experiment with MO1105 was performed at 40° C., and the experiment with M1088 was performed at 35° C. -
FIG. 23 depicts the ethanol production of M1105 where the fermentation was only inoculated with 0.15 g/L DCW and resulted in some sugar accumulation and 29 g/L ethanol. -
FIG. 24 depicts the ethanol production of M1254 is standard IFM (circles) and low ammonium IFM (squares) conditions. -
FIG. 25 depicts the specific growth rate of single colonies compared to M1254 and M1339 on complex xylose medium supplemented with a synthetic inhibitor mixture (which included 8 g/L acetate) at 40° C. The single colonies were screened at the same conditions as the evolution occurred. Colony C1 was renamed M1360. -
FIG. 26 depicts the fermentation performance of M1360 at 40° C. on industrially relevant fermentation medium supplemented with glucose. The fermentation was inoculated with 60 mg/L dry cell weight of M1360. -
FIG. 27 depicts the ethanol production in SSF runs on PHW (1827 solids, unwashed MS149) at 35° C. and 40° C. by several strains. All reactions were loaded with 4 mg/g “zoomerase” (Novozyme 22c). -
FIG. 28 depicts cultures spotted on SCURA plates containing 0.2% of either CMC or lichenin or barley-β-glucan. The top two row's of each plate were Y294 based cultures, and the bottom two rows contained MO749 based strains. Numbers indicate the plasmid contained by each strain. pMU471 contains the C.f.EG and served as positive control. Plates were incubated for 24 hours at 30° C. (pictured on the left), after which colonies were washed of and the plates were stained with 0.1% congo red and destained with 1% NaCl (pictured on the right), -
FIG. 29 depicts SDS-PAGE analysis of the supernatants of Cel5 cellulase producing strains. A strain containing a plasmid with no foreign gene was used as reference strain (REF). The strain containing the plasmid pMU471 expressing C.f.EG, tire most successful EG previously found was also included. -
FIG. 30 depicts the activity of strains expressing EGs on (A) PASC (2 hours) and (R) avicel (24 hours). A strain containing a plasmid with no foreign gene was used as reference strain (REF) and the strain expressing C.f.EG (pMU471) was included as positive control. -
FIG. 31 depicts the distribution of avicel conversion ability of yeast supernatants from transformation with TrEG2 and additional TeCBH1w/TrCBD. M1088 conversion is presented as a dark vertical line, and the dotted lines flanking this line represent the standard deviation of the measurement. -
FIG. 32 depicts the conversion of Avicel in the HTP avicel assay (48 hour time point) by supernatants of cellulase expressing yeast strains. M0509 is the negative control expressing no cellulases.Strain 1088 is the parental strain expressing only CBH1, CBH12, and BGL, whereas 1179, 1180, and 1181 are transformants of 1088 also expressing TrEG2. -
FIG. 33 depicts ethanol production in paper sludge CBP/SSF with cellulolytic strain M1403 and non-cellulolytic background strain M1254 with various amounts of commercial enzyme supplementation. Experimental conditions: 30% solids fed batch, 10 g/l cell inoculation, pH 5.5 andtemperature 40° C., Zoom=Novozymes 22C cellulase preparation, BGL=AB Enzymes EL2008044L BGL preparation, Xyl=AB Enzymes EL2007020L xylanase preparation. -
FIG. 34 depicts fermentation of two types of paper sludge by CBP yeast. (M1179) and a control strain M0509, not expressing cellulases. Experimental conditions; 18% solids, cells loaded at 10 or 1 g/L, pH 5.5, Temp: 35 C, 1 mg/g BGL and 1 mg/g Xyl loaded. BGL=AB Enzymes EL2Q08044L BGL preparation, Xyl=AB Enzymes EL2007020L xylanase preparation. -
FIG. 35 depicts the performance of cellulolytic yeast strain M0963 and non-cellulolytic control strain (M0509) on 22% unwashed solids of pretreated hardwood (PHW) (MS149) at various external cellulase concentrations. Experimental conditions: 22% solids fed batch, pH 5.4,temperature 35° C., all enzyme protein (EP) was “zoomerase” (Novozymes 22C). -
FIG. 36 depicts the performance of cellulolytic yeast strain MI284 on 30% solids of washed pretreated hardwood at various initial cell loadings. Experimental conditions: 30% solids fed batch, pH 5.0,temperature 35° C., 4 mg EP=0.25 mg BGL+0.25 mg Xylanase+0.25 mg Pectinase+3.25 mg Zoomerase, 20 mg EP=1 mg BGL+1 mg Xylanase+1 mg Pectinase+16.7 mg Zoomerase. Zoomerase=Novozymes 22C cellulase preparation, BGL=AB Enzymes EL2008Q44L BGL preparation, Xyl=AB Enzymes EL2007020L xylanase preparation, Pectinase=Genencor Multifeet pectinase FE. -
FIG. 37 depicts the ethanol production in washed corn stover CBP/SSF with cellulolytic strain M1284 and non-cellulolytic background strain M0509 with various amounts of commercial enzyme supplementation. Experimental conditions: 18%; solids fed batch, 10 g/l cell inoculation, pH 5.0 andtemperature 35° C., 1 mg/g BGL and 1 mg/g xylanase loaded in each case. BGL=AB Enzymes EL2008044L BGL preparation, Xyl=AB Enzymes EL2007020L xylanase preparation. -
FIG. 38A depicts the activity on Avicel of yeast culture supernatants expressing different CBM genes. The host strain was either Y294 or M0749. The CBH1 genes are: Te, Talaromyces emersonii; Ct, Chaetomium thermophilum: At, Acremonium thermophilum; Tr, Trichoderma reesei; Hg, Humicola grisea: Ta, Thermoascus aurantiacus. The plasmid names are indicated. Yeast were cultivated in YPD in triplicate for 3 days. The data are means±standard deviation. -
FIG. 38B depicts the activity on Avicel of yeast culture supernatants expressing different CBH1 genes. The host strain is M0749. The CBM genes are: Te, Talaromyces emersonii; Ct, Chaetomium thermophilum; At, Acremonium thermophilum; Tr, Trichoderma reesei: Hg, Humicola grisea; Ta, Thermoascus aurantiacus. The plasmid names are indicated. Yeast were cultivated in YPD in triplicate for 3 days. The data are means±standard deviation. -
FIG. 38C depicts the activity on MU Lac of yeast culture supernatants expressing different CBM genes. The host strain is Y294. The CBM genes are: Te, Talaromyces emersonii: Ct, Chaetomium thermophilum; At, Acremonium thermophilum; Tr, Trichoderma reesei: Hg, Humicola grisea: Ta, Thermoascus aurantiacus. The plasmid names are indicated. Yeast were cultivated in YPD in triplicate for 3 days. The data are means±standard deviation. -
FIG. 38D depicts the activity on MULac of yeast culture supernatants expressing different CBM genes. The host strain is M0749. The CBM genes are: Te, Talaromyces emersonii; Ct, Chaetomium thermophilum: At, Acremonium thermophilum; Tr, Trichoderma reesei: Hg, Humicola grisea: Ta, Thermoascus aurantiacus. The plasmid names are indicated. Yeast were cultivated in YPD in triplicate for 3 days. The data are means±standard deviation. -
FIG. 38E depicts the activity on estimated CBM concentration (mg/L) based on MULac. The host strain is Y294. The CBH1 genes are: 7V, Talaromyces emersonii: Ct, Chaetomium thermophilum: At, Acremonium thermophilum: Tr, Trichoderma reesei: Hg, Humicola grisea: Ta, Thermoascus aurantiacus. The plasmid names are indicated. Yeast were cultivated in YPD in triplicate for 3 days. The data are means±standard deviation. -
FIG. 38F depicts the activity on estimated CBH1 concentration (mg/L) based on MULae. The host is M0749. The CBH1 genes are: Te, Talaromyces emersonii; Ct, Chaetomium thermophilum, At, Acremonium thermophilum; Tr, Trichoderma reesei; Hg, Humicola grisea; Ta, Thermoascus aurantiacus. The plasmid names are indicated. Yeast were cultivated in YPD in triplicate for 3 days. The data are means±standard deviation. -
FIG. 39 show's the genes modified in yeast, strain M0509. -
FIG. 40 shows the yeast strains used to contract M0509 and the relevant genetic modifications. -
FIG. 41 show's the genealogy of yeast strain M1105. -
FIG. 42 show's the genealogy of yeast strain M1254. - The disclosed methods and materials are useful generally in the field of engineered yeast.
- A “vector,” e.g., a “plasmid” or “YAC” (yeast artificial chromosome) refers to an extrachromosomal element often carrying one or more genes that are not part of the central metabolism of the cell, and is usually in the form of a circular double-stranded DNA molecule. Such elements may be autonomously replicating sequences, genome integrating sequences, phage or nucleotide sequences, linear, circular, or supercoiled, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a promoter fragment and DNA sequence for a selected gene product along with appropriate 3′ untranslated sequence into a cell. Preferably, the plasmids or vectors of the present invention are stable and self-replicating.
- An “expression vector” is a vector that is capable of directing the expression of genes to which it is operably associated.
- The term “heterologous” as used herein refers to an element of a vector, plasmid or host cell that is derived from a source other than the endogenous source. Thus, for example, a heterologous sequence could be a sequence that is derived from a different gene or plasmid from the same host, from a different strain of host cell, or from an organism of a different taxonomic group (e.g., different kingdom, phylum, class, order, family genus, or species, or any subgroup within one of these classifications). The term “heterologous” is also used synonymously herein with the term “exogenous.”
- The term “domain” as used herein refers to a part of a molecule or structure that shares common physical or chemical features, for example hydrophobic, polar, globular, helical domains or properties, e.g., a DNA binding domain or an ATP binding domain. Domains can be identified by their homology to conserved structural or functional motifs. Examples of cellobiohydrolase (CBH) domains include the catalytic domain (CD) and the cellulose binding domain (CBD).
- A “nucleic acid,” “polynucleotide,” or “nucleic acid molecule” is a polymeric compound comprised of covalently linked subunits called nucleotides. Nucleic acid includes polyribonucleic acid (RNA) and polydeoxyribonucleic acid (DNA), both of which may be single-stranded or double-stranded. DNA includes cDNA, genomic DNA, synthetic DNA, and semi-synthetic DNA.
- An “isolated nucleic acid molecule” or “isolated nucleic acid fragment” refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; “RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxyeytidine; “DNA molecules”), or any phosphoester analogs thereof, such as phosphorothioates and thioesters, in either single stranded form, or a double-stranded helix. Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible. The term nucleic acid molecule, and in particular DNA or RNA molecule, refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms. Thus, this term includes double-stranded DNA found, inter alia, in linear or circular DNA molecules (e.g., restriction fragments), plasmids, and chromosomes. In discussing the structure of particular double-stranded DNA molecules, sequences may be described herein according to the normal convention of giving only the sequence in the 5′ to 3′ direction along the non-transcribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA).
- A “gene” refers to an assembly of nucleotides that encode a polypeptide, and includes cDNA and genomic DNA nucleic acids. “Gene” also refers to a nucleic acid fragment that expresses a specific protein, including intervening sequences (introns) between individual coding segments (exons), as well as regulatory sequences preceding (5′ non-coding sequences) and following (3′ non-coding sequences) the coding sequence. “Native gene” refers to a gene as found in nature with its own regulatory sequences.
- A nucleic acid molecule is “hybridizable” to another nucleic acid molecule, such as a cDNA, genomic DNA, or RNA, when a single stranded form of the nucleic acid molecule can anneal to the other nucleic acid molecule under the appropriate conditions of temperature and solution ionic strength. Hybridization and washing conditions are well known and exemplified, e.g., in Sambrook, J., Fritsch, E. F. and Maniatis, T. MOLECULAR CLONING: A LABORATORY MANUAL, Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor (1989), particularly Chapter 11 and Table 11.1 therein (hereinafter “Maniatis”, entirely incorporated herein by reference). The conditions of temperature and ionic strength determine the “stringency” of the hybridization. Stringency conditions can be adjusted to screen for moderately similar fragments, such as homologous sequences from distantly related organisms, to highly similar fragments, such as genes that duplicate functional enzymes from closely related organisms. Post-hybridization washes determine stringency conditions. One set of conditions uses a series of washes starting with 6×SSC, 0.5% SDS at room temperature for 15 min, then repeated with 2×SSC, 0.5% SDS at 45° C. for 30 min, and then repeated twice with 0.2×SSC, 0.5% SDS at 50° C. for 30 min. For more stringent conditions, washes are performed at higher temperatures in which the washes are identical to those above except for the temperature of the final two 30 min washes in 0.2×SSC, 0.5% SDS are increased to 60° C. Another set of highly stringent conditions uses two final washes in 0.1×SSC, 0.1% SDS at 65° C. An additional set of highly stringent conditions are defined by hybridization at 0.1×SSC, 0.1% SDS, 65° C. and washed with 2×SSC, 0.1% SDS followed by 0.1×SSC, 0.1% SDS.
- Hybridization requires that the two nucleic acids contain complementary sequences, although depending on the stringency of the hybridization, mismatches between bases are possible. The appropriate stringency for hybridizing nucleic acids depends on the length of the nucleic acids and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the greater the value of Tm for hybrids of nucleic acids having those sequences. The relative stability (corresponding to higher Tm) of nucleic acid hybridizations decreases in the following order: RNA:RNA, DNA:RNA, DNA:DNA. For hybrids of greater than 100 nucleotides in length, equations for calculating Tm have been derived (see, e.g., Maniatis at 9.50-9.51). For hybridizations with shorter nucleic acids, i.e., oligonucleotides, the position of mismatches becomes more important, and the length of the oligonucleotide determines its specificity Gee, e.g., Maniatis, at 11.7-11.8). In one embodiment the length for a hybridizable nucleic acid is at least about 10 nucleotides. Preferably a minimum length for a hybridizable nucleic acid is at least about 15 nucleotides; more preferably at least about 20 nucleotides; and most preferably the length is at least 30 nucleotides. Furthermore, the skilled artisan will recognize that the temperature and wash solution salt concentration may be adjusted as necessary according to factors such as length of tire probe.
- The term “percent identity”, as known in the art, is a relationship between two or more polypeptide sequences or two or more polynucleotide sequences, as determined by comparing the sequences. In the art, “identity” also means the degree of sequence relatedness between polypeptide or polynucleotide sequences, as the case may be, as determined by the match between strings of such sequences.
- As known in the art, “similarity” between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide.
- “Identity” and “similarity” can be readily calculated by known methods, including but not limited to those described in: Computational Molecular Biology (Lesk, A. M., ed.) Oxford University Press, N.Y. (1988); Biocomputing: Informatics and Genome Projects (Smith, D. W., ed.) Academic Press, N.Y. (1993); Computer Analysis of Sequence Data, Part I (Griffin, A. M., and Griffin, H. G., eds.) Humana Press. N.J. (1994); Sequence Analysis in Molecular Biology (von Heinje, G., ed.) Academic Press (1987); and Sequence Analysis Primer (Gribskov, M. and Devereux, J., eds.) Stockton Press, NY (1991). Preferred methods to determine identity are designed to give the best match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Sequence alignments and percent identity calculations may be performed using the Megalign program of the LASERGENE bioinformatics computing suite (DNASTAR Inc., Madison, Wis.). Multiple alignments of the sequences disclosed herein were performed using the Clustal method of alignment (Higgins and Sharp (1989) CABIOS. 5:151-153) with the default parameters (GAP PENALTY=10, GAP LENGTH PENALTY=10). Default parameters for pairwise alignments using the Clustal method were
KTUPLE 1, GAP PENALTY-3, WINDOW=5 and DIAGONALS SAVED=5. - Suitable nucleic acid sequences or fragments thereof (isolated polynucleotides of the present invention) encode polypeptides that, are at least about 70% to 75% identical to the anti no acid sequences reported herein, at least about 80%, 85%, or 90% identical to the amino acid sequences reported herein, or at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequences reported herein. Suitable nucleic acid fragments are at least about 70%, 75%, or 80% identical to the nucleic acid sequences reported herein, at least, about 80%, 85%, or 90% identical to the nucleic acid sequences reported herein, or at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequences reported herein. Suitable nucleic acid fragments not only have the above identities/similarities but typically encode a polypeptide having at least 50 amino acids, at least 100 amino acids, at least 150 amino acids, at least 200 amino acids, or at least 250 amino acids.
- A DNA or RNA “coding region” is a DNA or RNA molecule which is transcribed and/or translated into a polypeptide in a ceil in vitro or in vivo when placed under the control of appropriate regulatory sequences. “Suitable regulatory regions” refer to nucleic acid regions located upstream (5′ non-coding sequences), within, or downstream (3′ non-coding sequences) of a coding region, and which influence the transcription, RNA processing or stability, or translation of the associated coding region. Regulatory regions may include promoters, translation leader sequences, RNA processing site, effector binding site and stem-loop structure. The boundaries of the coding region are determined by a start codon at the 5′ (amino) terminus and a translation stop codon at the 3′ (carboxyl) terminus. A coding region can include, but is not limited to, prokaryotic regions, cDNA from mRNA, genomic DNA molecules, synthetic DNA molecules, or RNA molecules. If the coding region is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3′ to the coding region.
- An “isoform” is a protein that has the same function as another protein but which is encoded by a different gene and may have small differences in its sequence.
- A “paralogue” is a protein encoded by a gene related by duplication within a genome.
- An “orthologue” is gene from a different species that has evolved from a common ancestral gene by speciation. Normally, orthologues retain the same function in the course of evolution as the ancestral gene.
- “Open reading frame” is abbreviated ORF and means a length of nucleic acid, cither DNA, cDNA or RNA, that comprises a translation start signal or initiation codon, such as an ATG or AUG, and a termination codon and can be potentially translated into a polypeptide sequence.
- “Promoter” refers to a DNA fragment capable of controlling the expression of a coding sequence or functional RNA. In general, a coding region is located 3′ to a promoter. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from different promoters found in nature, or even comprise synthetic DNA segments. It is understood by those skilled in the art that different promoters may direct, the expression of a gene in different tissues or cell types, or at different stages of development, or in response to different environmental or physiological conditions. Promoters which cause a gene to be expressed in most cell types at most times are commonly referred to as “constitutive promoters”. It is further recognized that since in most cases the exact boundaries of regulatory sequences have not been completely defined, DNA fragments of different lengths may have identical promoter activity. A promoter is generally bounded at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter will be found a transcription initiation site (conveniently defined for example, by mapping with nuclease S1), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase.
- A coding region is “under the control” of transcriptional and translational control elements in a cell when RNA polymerase transcribes the coding region into mRNA, which is then trans-RNA spliced (if the coding region contains introns) and translated into the protein encoded by the coding region.
- “Transcriptional and translational control regions” are DNA regulatory regions, such as promoters, enhancers, terminators, and the like, that provide for the expression of a coding region in a host cell. In eukaryotic cells, polyadenylation signals are control regions.
- The term “operably associated” refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other. For example, a promoter is operably associated with a coding region when it is capable of affecting the expression of that coding region (i.e., that the coding region is under the transcriptional control of the promoter). Coding regions can be operably associated to regulatory regions in sense or antisense orientation.
- The term “expression,” as used herein, refers to the transcription and stable accumulation of sense (mRNA) or antisense RNA derived from the nucleic acid fragment of the invention. Expression may also refer to translation of mRNA into a polypeptide,
- In order to address the limitations of the previous systems, the present invention provides host cells expressing heterologous cellulases that can be effectively and efficiently utilized to produce ethanol from cellulose. In some embodiments, the host cells can be a yeast. According to the present invention the yeast host cell can be, for example, from the genera Saccharomyces, Kluyveromyces, Candida, Pichia, Schizosaccharomyces, Hansenula, Kloeckera, Schwanniomyces, and Yarrowia. Yeast species as host cells may include, for example, S. cerevisiae, S. bulderi, S. barnetti, S. exiguus, S. uvarum, S. diastaticus, K. lactis, K. marxianus, or K. fragilis. In some embodiments, the yeast is selected from the group consisting of Saccharomyces cerevisiae, Schizzosaccharomyces pombe, Candida albicans, Pichia pastoris, Pichia stipitis, Yarrowia lipolytica, Hansenula polymorpha, Phaffia rhodozyma, Candida utilis, Arxula adeninivorans, Debaryomyces hansenii, Debaryomyces polymorphic, Schizosaccharomyces pombe and Schwanniomyces occidentalis. In one particular embodiment, the yeast is Saccharomyces cerevisiae. In another embodiment, the yeast is a thermotolerant Saccharomyces cerevisiae. The selection of an appropriate host is deemed to be within the scope of those skilled in the art from the teachings herein.
- In some embodiments of the present invention, the host ceil Is an oleaginous cell. According to the present invention, the oleaginous host cell can be an oleaginous yeast cell. For example, the oleaginous yeast host cell can be front the genera Blakeslea, Candida, Cryptococcus, Cunninghamella, Lipomyces, Mortierella, Mucor, Phycomyces, Pythium, Rhodosporidium, Rhodotorula, Trichosporon or Yarrowia. According to the present invention, the oleaginous host cell can be an oleaginous microalgae host cell. For example, the oleaginous microalgea host cell can be front the genera Thraustochytrium or Schizochytrium. Biodiesel could then be produced from the triglyceride produced by the oleaginous organisms using conventional lipid transesterification processes. In some particular embodiments, the oleaginous host cells can be induced to secrete synthesized lipids. Embodiments using oleaginous host ceils are advantageous because they can produce biodiesel from lignocellulosic feedstocks which, relative to oilseed substrates, are cheaper, can be grown more densely, show lower life cycle carbon dioxide emissions, and can be cultivated on marginal lands.
- In some embodiments of the present invention, the host cell is a thermotolerant host cell. Thermotolerant host cells can be particularly useful in simultaneous saccharification and fermentation processes by allowing externally produced cellulases and ethanol-producing host cells to perform optimally in similar temperature ranges.
- Thermotolerant host cells of the invention can include, for example, Issatchenkia orientalis, Pichia mississippiensis, Pichia mexicana, Pichia farinosa, Clavispora opuntiae, Clovispora lusitanine, Candida mexicana, Hansenula polymorpha and Kluyveromyces host cells. In some embodiments, the thermotolerant cell is an S. cerevisiae strain, or other yeast strain, that has been adapted to grow in high temperatures, for example, by selection for growth at high temperatures in a cytostat.
- In some particular embodiments of the present invention, the host cell is a Kluyveromyces host cell. For example, the Kluyveromyces host cell can be a K. lactis, K. marxianus, K. blattae, K. phaffii, K. yarrowii, K. aestuarii, K. dobzhanskii, K. wickerhamii K. thermotolerans, or K. waltii host cell. In one embodiment, the host cell is a K. lactis, or K. marxianus host cell. In another embodiment, the host cell is a K. marxianus host cell.
- In some embodiments of the present invention the thermotolerant host cell can grow at temperatures above about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C., about 40° C., about 41° C. or about 42° C. In some embodiments of the present invention the thermotolerant host cell can produce ethanol from cellulose at temperatures above about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C., about 40° C., about 41° C., about 42° C., or about 43° C., or about 44° C., or about 45° C., or about 50° C.
- In some embodiments of the present invention, the thermotolerant host cell can grow at temperatures from about 30° C. to 60° C., about 30° C. to 55° C., about 30° C. to 50° C., about 40° C. to 60° C., about 40° C. to 55° C. or about 40° C. to 50° C. In some embodiments of the present invention, the thermotolerant host cell can produce ethanol from cellulose at temperatures from about 30° C. to 60° C., about 30° C. to 55° C., about 30° C. to 50° C., about 40° C. to 60° C., about 40° C. to 55° C. or about 40° C. to 50° C.
- In some methods described herein, the host cell has the ability to metabolize xylose. Detailed information regarding the development of the xylose-utilizing technology can be found in the following publications: Kuyper M et al. FEMS Yeast Res. 4: 655-64 (2004), Kuyper M et al. FEMS Yeast Res. 5:399-409 (2005), and Kuyper M et al. FEMS Yeast Res. 5:925-34 (2005), which are herein incorporated by reference in their entirety. For example, xylose-utilization can be accomplished in S. cerevisiae by heterologously expressing the xylose isomerase gene, XylA, e.g. from the anaerobic fungus Piromyces sp. E2, overexpressing five S. cerevisiae enzymes involved in the conversion of xylulose to glycolytic intermediates (xylulokinase, ribulose 5-phosphate isomerase, ribulose 5-phosphate epimerase, transketolase and transaldolase) and deleting the GRE3 gene encoding aldose reductase to minimise xylitol production.
- According to the methods described herein, the host cells can contain antibiotic markers or can contain no antibiotic markers.
- Host cells are genetically engineered (transduced or transformed or transfected) with the polynucleotides encoding cellulases of this invention which are described in more detail below. The polynucleotides encoding cellulases can be introduced to the host cell on a vector of the invention, which may be, for example, a cloning vector or an expression vector comprising a sequence encoding a heterologous cellulase. The host cells can comprise polynucleotides of the invention as integrated copies or plasmid copies.
- In certain aspects, the present invention relates to host cells containing the polynucleotide constructs described below. The host cells of the present invention can express one or more heterologous cellulase polypeptides. In some embodiments, the host cell comprises a combination of polynucleotides that encode heterologous cellulases or fragments, variants or derivatives thereof. The host cell can, for example, comprise multiple copies of the same nucleic acid sequence, for example, to increase expression levels, or the host ceil can comprise a combination of unique polynucleotides. In other embodiments, the host cell comprises a single polynucleotide that encodes a heterologous cellulase or a fragment, variant or derivative thereof. In particular, such host ceils expressing a single heterologous cellulase can be used in co-culture with other host cells of the invention comprising a polynucleotide that encodes at least one other heterologous cellulase or fragment, variant or derivative thereof.
- Introduction of a polynucleotide encoding a heterologous cellulase into a host cell can be done by methods known in the art. Introduction of polynucleotides encoding heterologous cellulases into, for example yeast host cells, can be effected by lithium acetate transformation, spheroplast transformation, or transformation by electroporation, as described in Current Protocols in Molecular Biology, 13.7.1-13.7.10. Introduction of tire construct in other host cells can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection, or electroporation. (Davis, L., et al., Basic Methods in Molecular Biology, (1986)).
- The transformed host cells or cell cultures, as described above, can be examined for endoglucanase, cellobiohydrolase and/or β glucosidase protein content. For the use of secreted heterologous cellulases, protein content can be determined by analyzing the host (e.g., yeast) cell supernatants. In certain embodiments, high molecular weight material can be recovered from the yeast cell supernatant either by acetone precipitation or by buffering the samples with disposable de-salting cartridges. Proteins, including tethered heterologous cellulases, can also be recovered and purified from recombinant yeast, cell cultures by methods including spheroplast preparation and lysis, cell disruption using glass beads, and cell disruption using liquid nitrogen for example. Additional protein purification methods include ammonium sulfate, or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography, gel filtration, and lectin chromatography. Protein refolding steps can be used, as necessary, in completing configuration of the mature protein. Finally, high performance liquid chromatography (HPLC) can be employed for final purification steps.
- Protein analysis methods include methods such as the traditional Lowry method or the protein assay method according to BioRad's manufacturer's protocol. Using such methods, the protein content of saccharolylic enzymes can be estimated. Additionally, to accurately measure protein concentration a heterologous cellulase can be expressed with a tag, for example a His-tag or HA-tag and purified by standard methods using, for example, antibodies against the tag, a standard nickel resin purification technique or similar approach.
- The transformed host cells or cell cultures, as described above, can be further analyzed for hydrolysis of cellulose (e.g., by a sugar detection assay), for a particular type of cellulose activity (e.g., by measuring the individual endoglucanase, cellobiohydrolase or β glycosylase activity) or for total cellulase activity. Endoglucanase activity can be determined, for example, by measuring an increase of reducing ends in an endoglucanase specific CMC substrate. Cellobiohydrolase activity can be measured, for example, by using insoluble cellulosic substrates such as the amorphous substrate phosphoric acid swollen cellulose (PASC) or microcrystalline cellulose (Avicel) and determining the extent of the substrate's hydrolysis. β-glucosidase activity can be measured by a variety of assays, e.g., using cellobiose.
- A total cellulase activity, which includes the activity of endoglucanase, cellobiohydrolase and β-glucosidase, can hydrolyze crystalline cellulose synergistically. Total cellulase activity can thus be measured using insoluble substrates including pure cellulosic substrates such as Whatman No. 1 filter paper, cotton linter, microcrystalline cellulose, bacterial cellulose, algal cellulose, and cellulose-containing substrates such as dyed cellulose, alpha-cellulose or pretreated lignocellulose. Specific activity of cellulases can also be detected by methods known to one of ordinary skill in the art, such as by the Avicel assay (described supra) that would be normalized by protein (cellulase) concentration measured for the sample.
- One aspect of the invention is thus related to the efficient production of cellulases to aid in the digestion of cellulose and generation of ethanol. A cellulase can be any enzyme involved in cellulase digestion, metabolism and/or hydrolysis, including an endoglucanase, oxogluconate, or β-glucosidase.
- In additional embodiments, the transformed host cells or cell cultures are assayed for ethanol production. Ethanol production can be measured by techniques known to one or ordinary skill in the art e.g. by a standard HPLC refractive index method.
- According to the present invention the expression of heterologous cellulases in a host cell can be used advantageously to produce ethanol from cellulosic sources.
- Cellulases from a variety of sources can be heterologously expressed to successfully increase efficiency of ethanol production. For example, the cellulases can be front fungi, bacteria, plant, protozoan or termite sources. In some embodiments, the cellulase is a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigants, Aspergillus terreus, Neurospora Crassa, or Arabidopsis thaliana cellulase.
- In some embodiments of the invention, multiple cellulases from a single organism are co-expressed in the same host cell. In some embodiments of the invention, multiple cellulases from different organisms are co-expressed in the same host cell. In particular, cellulases from two, three, four, five, six, seven, eight, nine or more organisms can be co-expressed in the same host cell. Similarly, the invention can encompass co-cultures of yeast strains, wherein the yeast strains express different cellulases. Co-cultures can include yeast strains expressing heterologous cellulases from the same organisms or from different organisms. Co-cultures can include yeast strains expressing cellulases from two, three, four, five, six, seven, eight, nine or more organisms.
- Cellulases of the present invention include both endoglucanases or exoglucanases. The cellulases can be, for example, endoglucanases, β-glucosidases or cellobiohydrolases.
- In certain embodiments of the invention, the endoglucanase(s) can be an endoglucanase I or an endoglucanase II isoform, paralogue or orthologue. In some embodiments, the endoglucanase expressed by the host cells of the present invention can be recombinant endo-1,4-β-glucanase. In particular embodiments, the endoglucanase is a T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinerisis, N. walkeri, R. speratus Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces, Irpex lacteus, C. lucknowense, C. globosum, Aspergillus terreus, Aspergillus fumigatus, Neurospora crassa or Acremonium thermophilum endoglucanase. In one particular embodiment, the endoglucanase comprises an amino acid sequence selected from SEQ ID MOs: 30-39 or 52-56, as shown in Table 1 below. In certain other embodiments, the endoglucanase comprises an amino acid sequence that is at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to an amino acid sequence selected from SEQ ID NOs: 30-39 or 52-56.
- As a practical matter, whether any polypeptide is at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identical to a polypeptide of the present invention can be determined conventionally using known computer programs. Methods for determining percent identity, as discussed in more detail below in relation to polynucleotide identity, are also relevant for evaluating polypeptide sequence identity.
- In one particular embodiment, the endoglucanase is an endoglucanase I (“eg1.”) from Trichoderma reesei. In certain embodiments, the endoglucanase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100%; identical to SEQ ID NO:39.
- In another particular embodiment, the endoglucanase is an endoglucanase from C. formosanus. In certain embodiments, the endoglucanase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:31.
- In another particular embodiment, the the endoglucanase is an endoglucanase from H. jecorina. In certain embodiments, the endoglucanase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100%; identical to SEQ ID NO:54.
- In certain embodiments, the β-glucosidase is a β-glucosidase I or a β-glucosidase II isoform, paralogue or orthologue. In certain embodiments of the present invention the β-glucosidase is derived from Saccharomycopsis fibuligera. In particular embodiments, the β-glucosidase comprises an amino acid sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:40.
- In certain embodiments of the invention, the cellobiohydrolase(s) can be a cellobiohydrolase I and/or a cellobiohydrolase II isoform, paralogue or orthologue. In one particular embodiment, the cellobiohydrolase comprises an amino acid sequence selected from SEQ ID NOs: 21-29 or 46, as shown in Table 1 below. In particular embodiments of the present invention the cellobiohydrolase is a cellobiohydrolase I or II from Trichoderma reesei. In another embodiment, the cellobiohydrolase comprises a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO: 27 or SEQ ID NO:28.
- In other particular embodiments of the present invention the cellobiohydrolase is a cellobiohydrolase I or II from T. emersonii. In another embodiment, the cellobiohydrolase comprises a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:23 or SEQ ID NO:24.
- In another embodiment, the cellobiohydrolase of the invention is a C. lucknowense cellobiohydrolase. In a particular embodiment, the cellobiohydrolase is C. lucknowense cellobiohydrolase Cbh2h. In one embodiment, the cellobiohydrolase comprises a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:25.
- In some particular embodiments of the invention, the cellulase comprises a sequence selected from the sequences in Table 1 below. The cellulases of the invention also include cellulases that comprise a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99 or 100% identical to the sequences of Table 1.
- Some embodiments of the invention encompass a polypeptide comprising at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, or 500 or more consecutive amino acids of any of SEQ ID NOs:21-40, 46 or 52-56, or domains, fragments, variants, or derivatives thereof.
-
TABLE 1 Cellulases used in Examples 1-11 as described below. Donor organism/ Accession number and Gene Codon-Optimized DNA sequence used amino acid sequence Cellobiohydrolases Humicola GAATTCATGAGAACCGCTAAGTTCGCTACCTTGGCTGCCTTGGTTGCCTCT CAA35159 grisea cbh1 GCTGCTGCTCAACAAGCCTGTTCCTTGACTACTGAACGTCACCCATCTTTG MRTAKFATLAALVASAAAQQA TCTTGGAACAGTGTACTGCTGGTGGTCAATGTCAAACTGTCCAAGCCTCC CSLTTERHPSLSWNKCTAGGQC ATCACTTTGGACTCTAATTGGAGATGGACCCACCAAGTCTCTGGTAGTACT QTVQASITLDSNWRWTHQVSGS AACTGTTACACCGGTAATAAGTGGGACACTTCTATTTGTACTGACGCTAA TNCYTGNKWDTSICTDAKSCAQ GTCTTGTGCTCAAAATTGTTGTGTTGATGGTGCTGATTACACCTCCACTTA NCCVDGADYTSTYGITTNGDSLS TGGTATTACCACCAACGGTGACTCTTTGTCCTTGAAGTTCGTTACTAAAGG LKFVTKGQHSTNVGSRTYLMDG TCAACATTCCACCAACGTCGGTTCTAGAACCTACTTAATGGACGGTGAAG EDKYQTFELLGNEFTFDVDVSNI ACAAGTACCAAACCTTCGAATTGTTGGGTAATGAATTTACCTTCGATGTCG GCGLNGALYFVSMDADGGLSR ATGTGTCTAACATCGGTTGTGGTTTGAACGGTGCTTTATACTTCGTTTCTAT YPGNKAKAKYGTGYCDAQCPR GGACGCCGACGGTGGTTTGTCCTCGTTACCCAGGTAATAAGGCTGGTGCCA DIKFINGEANIEGWTGSTNDPNA AGTATGGTACCGTTACTGTGATGCTCAATGCCCAAGAGACATTAAGTTC GAGRYGTCCSEMDIWEANNMA ATCAACGGTGAAGCTAACATTGAAGGTTGGACTGGTTCTACCAACGACCC TAFTPHCTIIGQSRCEGDSCGGT AAACGCTGGCGCCGGTAGATACGGTACCTGTTGTTCCGAAATGGACATT YSNERYAGVCDPDGCDFNSYRQ GGGAAGCCAACAACATGGCTACTGCTTTTACTCCACACCCATGTACCATCC GNKTFYGKGMTVDTTKKITVVT ATTGGTCAATCCAGATGTGAAGGTGACTCCTGTGGCGGTACCTACTCCAA QFLKDANGDLGEIKRFYVQDGK CGAAAGATACGCTGGTGTTTGTGATCCAGACGGTTGTGACTTCAACTCCTA IIPNSESTIPGVEGNSITQDWCDR CAGACAAGGTAACAAGACTTTCTATGGTAAGGGTATGACTGTCGATACCA QKVAFGDIDDFNRKGGMKQMG CCAAGAAGATCACCGTCGTCACCCAATTCTTGAAGGACGCTAACGGTGAT KALAGPMVLVMSIWDDHASNM TTAGGTGAAATTAAAAGATTCTACGTCCAAGATGGTAAGATCATCCCAAA LWLDSTFPVDAAGKPGAERGAC CTCTGAATCTACCATTCCAGGTGTTGAAGGTAATTCCATCACTCAAGACTG PTTSGVPAEVEAEAPNSNVVFSN GTGTGACAGACAAAAGGTTGCCTTCGGTGATATTGACGACTTCAACAGAA IRFGPIGSTVAGLPGAGNGGNNG AGGGTGGTATGAAGCAAATGGGTAAGGCTTTGGCCGGTCCAATGGTCTTG GNPPPPTTTTSSAPATTTTASAGP TCCAACTACTTCCGGTGTCCCAGCTGAAGTTGAAGCCGAAGCTCCAAATT KAGRWQCGGIGFTGPTQCEEP CTAACGTTGTCTTCTCTAACATCAGATTCGGTCCAATCGGTTCCACAGTCG YICTKLNDWYSQCL (SEQ ID CTGGTTTGCCAGGTGCTGGTAATGGTGGTAATAACGGTGGTAACCCACCA NO: 21) CCACCAACCACTACCACTTCTTCTGCCCCAGCTACTACCACCACCGCTTCT GCTGGTCCAAAGGCTGGTAGATGGCAACAATGTGGTGGTATTGGTTTCAC CGGTCCAACCCAATGTGAAGAACCATACATCTGTACCAAGTTGAACGACT GGTACTCTCAATGTTTATAACTCGAG (SEQ ID NO: 1) Thermoascus GAATTCATGTACCAAAGAGCTCTATTGTTCTCCTTCTTCTTGGCCGCCGCT AAL83303 aurantiacus AGAGCTCATGAAGCCGGTACTGTCACCGCCGAAAACCACCCATCTTGAC MYQRALLFSFFLAAARAHEAGT chb1 TTGGCAACAATGTTCCTCTGGTGGTTCTTGTACTACTCAAAACGGGAAGGT VTAENHPSLTWQQCSSGGSCTT TGTTATTGACGCTAACTGGAGATGGGTTCACACTACCTCCGGTTACACCAA QNGKVVIDANWRWVHTTSGYT CTGTTACACTGGTAACACTTGGGATACTTCCATCTGTCCAGACGACGTTAC NCYTGNTWDTSICPDDVTCAQN CTGTGCTCAAAACTGTGCTTTGGACGGTGCTGACTACTCCGGTACTTACGG CALDGADYSGTYGVTTSGNALR TGTCACTACCTCTGGCAACGCGTTGAGATTGAACTTCGTCACCCAATCTTC LNFVTQSSGKNIGSRLYLLQDDT TGGTAAGAACATCGGTTCTAGATTGTACTTGTTGCAAGACGATACTACTTA TYQIFKLLGQEFTFDVDVSNLPC CCAAATCTTCAAGTTGTTGGGTCCAAGAGTTCACTTTCGACGTTGATGTTTC GLNGALYFVAMDADGNLSKYP CAACTTGCCTTGTGGTTTGAACGGTGCTTTGTACTTCGTTGCTATGGACGC GNKAGAKYGTGYCDSQCPRDL CGACGGTAACTTATCCAAGTACCCAGGTAACAAGGCCGGTGCCAAGTACG KFINGQANVEGWQPSANDPNAG GTACCGGTTACTGTGATTCTCAATGTCCAAGAGACCTAAAATTCATTAACG VGNHGSSCAEMDVWEANSISTA GTCAAGCTAACGTCGAAGGTTGGCAACCATCTGCTAACGATCCAAACGCC VTPHPCDTPGQTMCQGDDCGGT GGTGTCGGTAATCACGGTTCCTCCTGTGCTGAAATGGACGTTTGGGAAGC YSSTRYAGTCDTDGCDFNPYQP TAACTCTATCTCCACCGCCGTCACTCCACATCCATGTGATACCCAGGTCA GNHSFYGPGKIVDTSSKFTVVTQ AACCATGTGTCAAGGTGATGATTGTGGTGGTACCTACTCTTCCACTAGATA FUTDDGTOSGTKTEUJRFTVQBG CGCTGGTACCTGTGACACCGACGGTTGTGATTTCCAACCCATACCAACA FVIPQSESTISFVTGNSITTEYCT GTAACCACTCTTTCTACGGTCCAGGTAAGATTGTCGATACTTCTTCTAAGT AQKAAFDNTGFFHGGLQKISQ TCACTGTTGTCACTCAATTCATTACCGACGATGGTACCCCATCTGGTACCC ALAQGMVLVMSLWDDHAANM TAACTGAAATTAAGAGATTCTACGTCCAAAACGGTAAAGTCATTCCACAA LWLDSTYPTDADPDTPGVARGT TCCGAAAGCACCATTTCCGGTGTTACCGGTAACTCCATCACCACTGAATAC CPTTSGVPADVESQNPNSYVIYS TGTACCGCTCAAAAGGCCGCCTTTGACAACACCGGTTTCTTCACCCATGGT NIKVGPINSTFTAN (SEQ ID GGTTTGCAAAAGATTTCTCAAGCCTTGGCTCAAGGTATGGTTTTGTCATG NO: 22) TCCTTGTGGGATGACCACGCTGCTAACATGTTGTGGTTGGATTCTACTTAC CCAACTGACGCTGATCCAGACACCCCAGGTGTTGCTAGAGGTACTTGTCC AACCACTTCTGGTGTTCCAGCTGACGTCGAATCTCAAAACCCTAACTCTTA CGTTATCTACTCTAACATCAAGGTGGGTCCAATTAACTCCACCTTCACTGC TAACTAACTCGAG (SEQ ID NO: 2) Talaromyces GAATTCATGCTAAGAAGAGCTTTACTATTGAGCTCTTCTGCTATCTTGGCC AAL89553 erersonii GTTAAGGCTCAACAAGCCGGTACCGCTACTGCTGAAAACCACCCTCCATT MLRRALLSSSAILAVKAQQAG cbh1 GACCTGGCAAGATGTACCGCTCCAGGTTCTTGTACCACCCAAAACGGTG TATAENHPPLTWQECTAPGSCTT CTGTCGTCTTGGACGCTAACTGGAGATGGGTCCACGACGTCAACGGTTAC QNGAVVLDANWRWVHDVNGY ACTAACTGTTACACCGGTAACACCTGGGACCCAACTTACTGTCCAGACGA TNCYTGNTWDPTYCPDDETCAQ CGAAACTTGCGCTCAAAACTGTGCCTTGGACGGTGCTGACTACGAAGGTA NCALDGADYEGTYGVTSSGSSL CTTACGGTGTTACCTCCTCTGGTTCTTCCTTGAAGTTGAACTTCGTCACTGG KLNFVTGSNVGSRLYLLQDDST TTCTAACGTCGGTTCCAGATTGTATTTGTTGCAAGATGACTCCACTTACA YQIFKLLNREFSFDDVDVSNLPCG AATCTTCAAGTTGTTGAACAGAGAATTTTCTTTCGACGTCGATGTGTCCAA LNGALYFVAMDADGGVSKYPN CTTGCCTTGTGGTTTGAACGGTGCTCTATACTTCGTTGCTATGGACGCTGA NKAGAKYGTFYCDSQCPRDLKF TGGTGGTGTTTCCAAGTACCCAAACAACAAGGCTGGTGCCAAATACGGTA IDGEANVEGWQPSSNNANTGIG CTGGTTACTGTGACTCTCAATGTCCACGTGACTTGAAGTTTATTGATGGTG DHGSCCAEMDVWEANSISNAVT AAGCTAATGTCGAAGGTTGGCAACCATCTTCTAACAACGCTAACACTGGC PHPCDTPGQTMCSGDDCGGTYS ATGGGTGACCACGGTTCTTGCTGTGCCGAAATGGACGTTTGGGAAGCCAA NDRYAGTCDPDGCDFNPYRMG CTCCATTTCCAACGCCGTCACTCCACACCCATGTGACACTCCAGGTCAAAC NTSFYGPKHDTTKP TATGTGTTCCGGCGATGACTGTGGTGGTACTTACTCTAACGATAGATACGC FTVVTQFLTDDGTDTGTLSEIKR TGGTACCTGTGATCCAGACGGTTGCGACTTCAATCCATACAGAATGGGTA FYIQNSNVIPQPNSDISGVTGNSI ACACTTCCTTTTACGGTCCAGCAAGATCATCGACACTACTAAGCATTCA TTEFCTAQKQAFGDTDDFSQHG CTGTTGTCACCCAATTCTTGACCGACGATGGTACTGATACCGGTACTTTGT GLAKMGAAMQQGMVLVMLSW CCGAAATCAAGAGATTCTACATCCAAAACTCTAACGTCATCCCACAACCA DDYAAQMLWLDSDYPTADPT AATTCCGACATCTCTGGTGTCACTGGTAACTCCATTACCACCGAATTTTGT TPGIARGTCPTDSGVPSDVESQSP ACCGCCCAAAAGCAAGCTTTCGGTGACACCGACGACTTCTCTCAAGCACG NSYVTYSNIKFGPINSTFTAS TGGTTTGGCTAAGATGGGTGCTGCCTATGCAACAAGGTATGGTTTTGGTCAT (SEQ ID NO: 23) GTCTTTGTGGGACGACTACGCTGCTCAAATGTTGTGGTTGGACTCCGATTA CCCAACCGATGCCGACCCAACCACCCCTGGTATCGCTAGAGGTACCTGTC CAACTGACTCTGGTGTTCCATCTGACGTCGAATCCCAATCTCCAAACTCCT ACGTCACTTACTCCAACATTAAATTCGGTCCAATCAACTCCACTTTCACTG CTTCTTAACTCGAG (SQ ID NO: 3) Talaromyces GAATTCATGCGTAACTTGTTGGCCTTGGCTCCAGCCGCTTTGTTGGTTGGT AAL78165 emersonii GCTGCCGAAGCTCAACAATCCTTGTGGGGTCAATGCGGTGGTTCCTCCTG MRNLLALAPAALLVGAAEAQQS cbh2 GACTGGTGCAACTTCCTGTGCCGCTGGTGCCACCTGTTCCACCATTAACCC LWGQCGGSSWTGATSCAAGAT ATACTACGCTCAATGTGTTCCAGCCACTGCCACTCCAACTACCTTGACTAC CSTINPYYAQCVPATATPTTLTT CACCACTAAGCCAACCTCCACCGGTGGTGCTGCTCCAACCACTCCACCAC TTKPTSTGGAAPTTPPPTTTGTTT CAACTACTACCGGTACTACCACCTCTCCAGTCGTCACCAGACCTGCCTCCG SPVVTRPASASGNPFEGYQLYAN CCTCCGGTAATCCATTCGAAGGTTATCAATTGTACGCTAACCTTACTACG PYYASEVISLAIPSLSSELVPKAS CTTCTGAAGTCATTTCCTTGGCTATCCCATCTTTGAGCTCCGAGTTGGTCCC EVAKVPSFVWLDQAAKVPSMG AAAGGCCTCCGAAGTTGCTAAGGTCCCTTCATTTGTCTGGTTAGATCAAGC DYLKDIQSQNAAGADPPIAGIFV TGCCAAGGTTCCATCTATGGGTGATTACTTGAAGGATATTCAATCTCAAAA VYDLPDRDCAAAASNGEFSIAN CGCTGCTGGTGCTGATCCACCAATCGCCGGTATTTTCGTTGTTTACGATTT NGVALYKQYIDSIRELQTTYSDV GCCAGATAGAGACTGTGCCGCCGCTGCTTCTAACGGTGAATTTTCTATCGC HTILVIEPDSLANVVTNLNVPKC CAACAACGGTGTCGCTTTATACAAACAATATATCGATTCCATTAGAGAAC ANAQDAYLECINYAITQLDLPNV AATTAACCACTTACTCCGACGTCCATACCATCTTGGTTATCGAACCAGACT AMYLDAGHAGWLGWQANLAP CTTTGCTAACGTTGTCACTAACTTGAACGTTCCAAAATGTGCTAACGCTC AAQLFASVYKNASSPASVRGLA AAGATGCTTACTTGGAATGTATCAACTACGCTATTACCCAATTGGACTTGC TNVANYNAWSISRCPSYTQGDA CAAACGTTGCTATGTACTTGGACGCTGGTCACGCCGGTTGGTTGGGTTGGC NCDEEDYVNALGPLFQEQDGPA AAGCCAACTTGGCCCCAGCTGCTCAATTATTCGCTTCTGTTTACAAGAACG YFIIDTSRNGVRPTKQSQWGDW CCTCTTCCCCAGCTCTGTTAGAGGTTTGGCTACCAACGTGGCTAACTACA CNVIGTGFGVRPTTDTGNPLEDA ACGCCTGGTCCATTTCTAGATGTCCATCCTCACTCAAGGTGACGCTAACT FVWVKPGGESDGTSNTTSPRYD GTGATGAAGAAGATTACGTTAACGCTTTGGGTCCATTGTTCCAAGAACAA YHCGLSDALQPAPEAGTWFQAY GGTTTCCCAGCTTACTTCATCATCGACACTTCCCGTAACGGTGTCAGACCA FEQLLTNANPLF (SEQ ID ACTAAGCAATCTCAATGGGGTGACTGGTGTAACGTTATTGGTACCGGTTTC NO: 24) GGTGTTAGACCAACCACCGACACTGGTAACCCATTGGAAGACGCTTTCCGT TTGGGTCAAGCCAGGTGGTGAATCCGACGGTACCTCCAACACTACTAGCC CACGTTACGATTACCACTGTGGTTTGTCTGACGCTTTGCAACAGCTCCAG AAGCTGGTACCTGGTTCCAAGCCTACTTCGAACAATTGTTGACTAACGCC AACCATTGTTCTAACTCGAG (SEQ ID NO: 4) Chryso- ATGGCCAAGAAGTTGTTCATTACCGCTGCCTTAGCTGCCGCAGTGCTTGCT MAKKLFITAALAAAVLAAPVIEE sporium GCACCAGTGATCGAAGAGAGACAAAATTGCGGAGCCGTCTGGACACAGT RQNCGAVWTQCCGGNGWQGPTC lucknowense GCGGAGGCAACGGCTGGCAAGGCCCAACATGTTGTGCTTCTGGCTCAACG CASGSTCVAQNEWYSQCLPNSQ CBH2b TGCGTGGCACAGAACGAGTGGTATTCCCAGTGCCTTCCAAACTCCCAGGT VTSSTTPSSTSTSQRSTSTSSSTTR GACTTCTTCAACAACCCCCAGCTCAACGTCTACTTCACAGAGATCCACAA SGSSSSSSTTPPPVSSPVTSIPGGS GTACCTCTTCTAGCACAACCAGAAGTGGCTCATCCTCATCTAGCAGTACG TSTASYSGNPFSGVRLFANDYYR ACCCCTCCACCCGTATCAAGTCCTGTCACGAGTATCCCTGGCGGAGCAAC SEVHNLAIPSMTGTLAAKASAV CTCAACAGCCAGTTATTCCGGCAATCCTTTCTCTGGAGTGAGATTATTTGC AEVPSFQWLDRNVTIDTLMVQT AAACGACTATTATAGATCAGAGGTTCACAACCTTGCAATTCCTTCTATGAC LSQVRALNKAGANPPYAAQLVV GGGAACCCTAGCCGCAAAGGCTTCCGCCGTAGCAGAAGTCCCTAGTTTCC YDLPDRDCAAAASNGEFSIANG AATGGCTTGACAGAAACGTTACAATAGATACACTTATGGTACAGACTTTA GAANYRSYIDAIRKHIIEYSDIRII TCTCAGGTTAGAGCTTTGAATAAGGCCGGTGCCAACCCACCTTATGCTGCC LVIEPDSMANMVTNMNVAKCS CAATTAGTAGTCTATGACTTGCCAGATAGAGACTGTGCTGCCGCAGCTTCT NAASTYHELTVYALKQNLPNV AATGGTGAATTTTCCATCGCAAATGGCGGAGCTGCAAACTATAGATCATA AMYLDAGHAGWLGWPANIQPA CATTGATGCAATAAGAAAACACATCATTGAGTATTCTGATATTAGAATAA AELFAGIYNDAGKPAAVRGLAT TCCTTGTGATTGAACCAGACTCCATGGCTAATATGGTTACCAACATGAATG NVANYNAWSIASAPSYTSPNPN TAGCCAAGTGTTCTAACGCAGCTTCCACATACCATGAGCTAACCGTATAT YDEKHYIEAFSPLLNSAGFPARFI GCATTAAAACAACTGAATCTACCTAACGTTGCTATGTACTTAGATGCCGGT VDTGRNGKQPTGQQQWGDWC CATGCCGGATGGTTGGGCTGGCCTGCAAATATCCAACCCGCAGCTGAATT NVKGTGFGVRPTANTGHELVDA GTTCGCTGGAATCTACAACGACGCCGGAAAGCCCCGCTGCCGTTAAGGCT FVWVKPGGESDGTSDTSAARYD TAGCCACAAATGTTGCAAATTACAACGCTTGGTCAATTGCTAGTGCCCCTT YHCGLSDALQPAPEAGQWFQAY CTTATACCTCACCAAATCCTAACTACGATGAGAAACATTACATAGAAGCA FEQLLTNANPPF (SEQ ID NO: 25) TTTTCCCATTGTTAAACTCCGCTGGATTCCCTGCCAGATTCATCGTTGAT ACCCGGTAGAAACGGCAAACAACCAACTGGACAACAACAATGGGGAGATT GGTGTAACGTCAAGGGAACCGGCTTCGGCGTCAGGCCTACGGCAAACACC GGACACGAGCTATCGACGTTTTGTATGGGTTAAGCCAGGTGGCGAAAG TGACGGAACAAGTGACACGAGTGCTGCAAGATACGATTACCACTGTGGTC TGTCCGACGCTTTACAGCCCGCCCCCGAGGCTGGACAATGGTTCCAGGCT TATTTTGAACAATTGTTAACGAACGCAAATCCACCATTCTAA (SEQ ID NO: 5) Talaromyces ATGCTAAGAAGAGCTTTACTATTGAGCTCTTCTGCTATCTTGGCCGTTAAG MLRRALLLSSSAILAVKAQQAG emersonii GCTCAACAAGCCGGTACCGCTACTGCTGAAAACCACCCTCCATTGACCTG TATAENHPPLTWQECTAPGSCTT cbh1 with GCAAGAATGTACCGCTCCAGGTTCTTGTACCACCCAAAACGGTGCTGTCG QNGAVVLDANWRWVHDVNGY CBD TCTTGGACGCTAACTGGAGATGGGTCCACGACGTCAACGGTTACACTAAC TNCYTGNTWDPTYCPDDETCAQ TGTTACACCGTAACACCTGGGACCCAACTTACTGTCCAGACGACGAAAC NCALDADYEGTYGVTSSGSSL TTGCGCTCAAAACTGTGCCTTGGACGGTGCTGACTACGAAGGTACTTACG KLNFVTGSNVGSRLYLLQDDST GTGTTACCTCCTCTGGTTCTTCCTTGAAGTTGAACTTCGTCACTGGTTCTAA YQIFKLLNRFFSFDVDVSNLPCG CGTCGGTTCCAGATTGTATTTGTTGCAAGATGACTCCACTTACCAAATCTT LNGALYFVAMDADGGVSKYPN CAAGTTGTTGAACAGAGAATTTTCTTTCGACGTCGATGTGTCCAACTTGCC NKAGAKYGTGYCDSQCPRDLKF TTGTGGTTTGAACGGTGCTCTATACTTCGTTGCTATGGACGCTGATGGTGG IDGEANVEGWQPSSNNANTGIG TGTTTCCAAGTACCCAAACAACAAGGCTGGTGCCAAATACGGTACTGGTT DHGSCCAEMDVWEANSISNAVT ACTGTGACTCTCAATGTCCACGTGACTTGAAGTTTATTGATGGTGAAGCTA PHPCDTPGQTMCSGDDCGGTYS ATGTCGAAGGTTGGCAACCATCTTCTAACAACGCTAACACTGGCTCGGT NDRYAGTCDPDGCDFNPYRMG GACCACGGTTCTTGCTGTGCCGAAATGGACGTTTGGGAAGCCAACTCCAT NTSFYGPGKIIDTTKPFTVVTQFL TTCCAACGCCGTCACTCCACACCCATGTGACACTCCAGGTCAAACTATGTG TDDGTFTGTLSEIKRFYIQNSNVI TTCCGGCGTGACTGTGGTGGTACTTACTCTAACGATAGATACGCTGGTAC PQPNSDISGVTGNSITTEFCTAQK CTGTGATCCAGACGGTTGCGACTTCAATCCATACAGAATGGGTAACACTT QAFGDTDDFSQHGGLAKMGAA CCTTTTACGGTCCAGGCAAGATCATCGACACTACTAAGCCATTCACTGTTG MQQGMVLVMSLWDDYAAQML TCACCCAATTCTTGACCGACGATGGTACTGATACCGGTACTTTGTCCGAAA WLDSDYPTDADPTTPGIARGTCP TCAAGAGATTCTACATCCAAAACTCTAACGTCATCCCACAACCAAATTCC TDSGVPSDVESQSPNSYVTYSNI GACATCTCTGGTGTCACTGGTAACTCCATTACCACCGAATTTTGTACCCGCC KFGPINSTFTASNPPGGNRGTTTT CAAAAGCAAGCTTTCGGTGACACCGACGACTTCTCTCAACACGGTGGTTT RRPATTTGSSPGPTQSHYGQCGG GGCTAAGATGGGTGCTGCTATGCAACAAGGTATGGTTTTGGTCATGTCTTT IGYSGPTVCASGTTCQVLNPYYS GTGGGACGACTACGCTGCTCAAATGTTGTGGTTGGACTCCGATTACCCAA QCL (SEQ ID NO: 26) CCGATGCCGACCCAACCACCCCTGGTATCGCTAGAGGTACCTGTCCAACT GACTCTGGTGTTCCATCTGACGTCGAATCCCAATCTCCAAACTCCTACGTC ACTTACTCCAACATTAAATTCGGTCCAATCAACTCCACTTTCACTGCTTCT AACCCTCCAGGTGGTAACAGAGGTACTACCACTACTCGTAGGCCAGCTAC TACAACTGGTTCTTCCCCAGGCCCAACCCAATCCCACTACGGTCAATGTGG TGGTATCGGTTACTCTGGTCCAACCGTCTGTGCTTCTGGTACTACCTGTCA AGTTTTAAACCCATACTACTCTCAATGTTTGTAG (SEQ ID NO: 6) Trichoderma ATGGTCTCCTTCACCTCCCTGCTGGCCGGCGTTGCCGCTATCTCTGGTGTC ACCESSION NO.: CAA49596 reesei CTAGCAGCCCCTGCCGCAGAAGTTGAACCTGTCGCAGTTGAGAAACGTGA MVSFTSLLAGVAAISGVLAAPA CBH1 GGCCGAAGCAGAAGCTCAATCCGCTTGTACCCTACAATCCGAAACTCACC AEVEPVAVEKREAEAEAQSACT CACCATTGACCTGGCAAAAGTGTTCTAGCGGTGGAACTTGTACTCAACAA LQSETHPPLTWQKCSSGGTCTQ ACTGGTTCTGTTGTTATCGACGCTAACTGGAGATGGACACACGCCACTAA QTGSVVIDANWRWTHATNSSTN CTCTTCTACCAACTGTTACGACGGTAACACTTGGTCTTCCACTTTATGTCC CYDGNTWSSTLCPDNETCAKNC AGATAACGAAACTTGTGCTAAGAATTGCTGTTTGGACGGTGCCGCCTACG CLDGAAYASTYGVTTSGNSLSIG CTTCTACCTACGGTGTTACCACCTCCGGTAACTCCTTGTCTATTGGTTTCGT FVTQSAQKVGARLYLMASDTT CACTCAATCCGCTCAAAAGAACGTTGGTGCTAGATTGTACTTGATGGCTTC YQEFTLLGNEFSFDVDVSQLPCG TGACACTACTTATCAAGAATTTACTTTGTTGGGTAACGAATTTTCTTTCGA LNGALYFVSMDADGGVKYPTN TGTTGACGTTTCCCAATTGCCATGTGGCTTGAACGGTGCTTTGTACTTTGT TAGAKYGTGYCDSQCPRDLKFI CTCTATGGATGCTGACGGTGGTGTTTCTAAGTACCCAACTAACACTGCCGG NGQANVEGWEPSSNNANTGIGG TGCTAAGTACGGTACTGGTTACTGTGATTCTCAATGTCCACGTGACTTGAA HGSCCSEMDIWEANSISEALTPH GTTCATTAACGGTCAAGCCAACGTCGAACGGTTGGGAACCATCCTCCAACA PCTTVGQEICEGDGCGGTYSDN ACGCTAACACCGGTATCGGTGGTCACGGTTCCTGTTGTTCCGAAATGGAC PYGGTCDPDGCDWNPYRLGNTS ATCTGGGAAGCTAACAGTATTTCTGAAGCTTTGACACCACACCCATGCAC FYGPGSSFTLDTTKKLTVVTQFE CACTGTCGGTCAAGAAATTTGTGAAGGTGATGGATGTGGTGGAACCTACT TSGAINRYYVQNGVTFQQPNAE CTGATAACAGATACGGTGGTACTTGTGACCCAGACGGTTGTGACTGGAAC LGSYSGNELNDDYCTAEEAEFG CCATACAGATTGGGTAACACTTCTTTCTATGGTCCAGGTTCTTCTTTCACCT GSSFSDKGGLTQFKKATSGGMV TGGATACCACCAAGAAGTTGACTGTTGTTACCCAATTCGAAACTTCTGGTG LVMSLWDDYYANMLWLDSTYP CTATCAACAGATACTACGTTCAAAACGGTGTCACCTTCCAACCAAAC TNETSSTPGAVRGSCSTSSGVPA GCTGAATTGGGTTCTTACTCTGGTAATGAATTGAACGACGACTACTGTACC QVESQSPNAKVTFSNIKFGPIGST GCTGAAGAAGCTGAATTTGGTGGTTCCTCTTTCTCCGACAAGGGTGGTTTG GNPSGGNPPGGNRGTTTRRPAT ACCCAATTCAAGAAGGCTACCTCCGGTGGTATGGTTTTGGTTATGTCCTTG TTGSSPGPTQSHYGQCGGIGYSG TGGGTGATTACTACGCAAACATGTTATGGTTAGACAGTACTTACCCAAC PTVCASGTTCQVLNPYYSQCL TAACGAAACCTCCTCTACTCCAGGTGCTGTCAGAGGTTCCTGTTCTACCTC (SEQ ID NO: 27) TTCTGGTGTTCCAGCTCAAGTTGAATCTCAATCTCCAAACGCTAAGGTCAC [SECRETION SIGNAL: 1-33 TTTCTCCAACATCAAGTTCGGTCCAATCGGTTCCACTGGTAATCCATCTGG CATALYTIC DOMAIN: 41-465 TGGAAACCCTCCAGGTGGTAACAGAGGTACTACCACTACTCGTAGGCCAG CELLULOSE-BINDING DOMAIN: CTACTACAACTGGTTCTTCCCCAGGCCCAACCCAATCCCACTACGGTCAAT 503-535] GTGGTGGTATCGGTTACTCTGGTCCAACCGTCTGTGCTTCTGGTACTACCT GTCAAGTTTTAAACCCAACTACTCTCAATGTTTGTAA (SEQ ID NO: 7) Trichoderma ATGGTCTCCTTCACCTCCCTGCTGGCCGGCGTTGCCGCTATCTCTGGTGTC ACCESSION NO.: reesei CTAGCAGCCCCTGCCGCAGAAGTTGAACCTGTCGCAGTTGAGAAACGTGA AAA72922AAA24210 CBH2 GGCCGAAGCAGAAGCTGTCCCATTAGAAGAAAGACAAGCCTGCTCCTCTG MIVGILTTLATLATLAASVPLEE TTTGGGGTCAATGTGGTGGTCAAAACTGGTCTGGTCCAACTTGTTGTGCTT RQACSSVWGQCGGQNWSGPTC CCGGTTCTACCTGTGTTTACTCCAACGACTACTATTCCCAATGTTTGCCAG CASGSTCVYSNDYYCQCLPGAA GTGCTGCTTCCTCTTCCTCTTCAACTAGAGCTGCTTCTACAACTTCTAGGGT SSSSSTRAASTTSRVSPTTSRSSS CTCCCCAACCACTTCCAGATCCTCTTCTGCTACTCCACCACCAGGTTCTAC ATPPPGSTTTRVPPVGSGTATYS TACCACTAGAGTTCCACCAGTCGGTTCCGGTACTGCTACTTACTCTGGTAA GNPFVGVTPWANAYYASEVSSL CCCTTTCGTCGGTGTTACTCCATGGGCTAACGCTTACTACGCTTCTGAAGT AIPSLTGAMATAAAAVAKVPSF TTCTTCTTTGGCTATCCCATCTTTGACTGGTGCTATGGCTACCGCTGCTGCT MWLDTLDKTPLMEQTLADIRTA GCTGTCGCCAAAGTTCCATCCTTCATGTGGTTGGACACCTTGGACAAAACT NKNGGNYAGQFVVYDLPDRDC CCATTAATGGAACAAACCTTGGCAGACATAAGGACTGCTAACAAGAACG AALASNGEYSIADGGVAKYKNY GCGGTAACTACGCTGGTCAATTTGTTGTGTACGACTTGCCAGACAGAGAC IDTIRQIVVEYSDIRTLLVIEPDSL TGTGCTGCTTTGGCTTCCAACGGTGAATACTCCATCGCTGACGGTGGTGTC ANLVTNLGTPKCANAQSAYLEC GCCAAGTACAAGAACTACATTGATACCATTAGACAAATCGTTGTCGAATA INYAVTQLNLPNVAMYLDAHGA CTCTGACATCAGAACCTTGTTAGTCATCGAACCAGATTCTTTAGCCAATTT GWLGWPANQDPAAQLFANVYK AGTCACCAACTTGGGTACTCCAAAGTGTGCTAACGCTCAATCTGCCTACTT NASSPRALRGLATNVANYNGW AGAATGTATCAATTATGCAGTTACCCAATTGAACTTGCCAAACGTTGCTAT NITSPPSYTQGNAVYNEKLYIHAI GTACTTGGACGCTGGTCACGCCGGTTGGTTGGGTTGGCCAGCTAACCAAG GRLLANHGWSNAFFITDQGRSG ACCCAGCCGCTCAATTATTCGCCAACGTTTACAAGAATGCCTCTTCTCCTA KQPTGQQQWGDWCNVIGTGFGI GAGCCTTGCGTGGTTTGGCTACTAACGTCGCTAACTACAACGGTTGGAAC RPSANTGDSLLDSFVWVKPGGE ATCACTTCTCCACCATCTTACACCCAAGGTAACGCTGTTTACAACGAAAA CDGTSDSSAPRFDSHCALPDALQ GTTGTACATTCACGCTATCGGTCCATTATTGGCTAACCATGGTTGGTCTAA PAAQAGAWFQAYFVQLLTNAN CGCCTTCTTCATCACCGACCAAGGTAGATCCGGTAAACAACCAACTGGTC PSFL (SEQ ID NO: 28) AACAACAATGGGGTGATTGGTGTAACGTCATCGGTACTGGTTTCGGTATC AGACCATCCGCTAACACTGGTGATTCCTTGTTGGATTCCTTCGTCTGGGTT AAGCCAGGTGGTGAATGTGATGGCACCTCTGATTCCTCTGCTCCAAGATTC GATTCCCACTGCGCCTTGCCAGACGCTTTGCAACCAGCCCCACAAGCTGG TGCATGGTTCCAAGCTTACTTTGTCCAATTGTTGACCAACGCTAACCCATC TTTCTTGTAA (SEQ ID NO: 8) Chaetomium TTAATTAAACAATGATGTACAAGAAATTTGCAGCCCTAGCTGCTTTAGTTG AM711862 thermo- CAGGAGCTTCCGCTCAACAGGCATGTTCATTGACTGCCCGAAAATCATCCA MMYKKFAALAALVAGASAQQA philum TCCTTAACGTGGAAGAGATGCACGTCAGGAGGTTCATGCTCCACTGTAAA CSLTAENHPSLTWKRCTSGGSCS CBH1 CGGAGCTGTCACAATAGATGCAAATTGGAGATGGACCCACACTGTGTCCG TVNGAVTIDANWRWTH GTAGTACAAAGTGCTACACCGGTAATCAATGGGATACGTCTTTGTGTACA TVSGSTNCYTGNQWDTSLCTDG GATGGAAAGTCATGCGCTCAGACCTGTTGCGTGGATGGAGCAGACTACTC KSCAQTCCVDGADYSSTYGITTS TTCTACTTACGGAATCACGACATCAGGTGACAGTCTTAATTTGAAATTCGT GDSLNLKFVTKHQYG AACCAAGCACCAGTACGGAACAAATGTAGGCTCCAGAGTGTACTTAATGG TNVGSRVYLMENDTKYQMFELL AGAACGATACCAAATATCAAATGTTCGAGTTATTAGGCAATGAGTTTACC FVSMDADGGMSKYSGN TTTGACGTAGACGTTAGCAATTTGGGTTGCGGATTAAACGGCGCCCTTTAC KAGAKYGTGYCDAQCPRDLKFI TTCGTGTCTATGGATGCTGACGGAGGTATGTCAAAGTATTCTGGTAACAA NGEANVGNWTPSTNDANAGFG AGCCGGAGCAAAGTACGGTACAGGTTATTGTGACGCTCAGTGCCCTAGAG RYGSCCSEMDVWEANNM ATTTGAAGTTTATCAACGGAGAAGCCAACTTGGTAACTGGACGCCAAGT ATAFTPHPCTTVGQSRCEADTCG ACTAACGACGCAAACGCTGGATTCGGCAGATACGGTAGTTGTTGCTCAGA GTYSSDRYAGVCDPDGCDFNAY AATGGACGTGTGGGAGGCCAATAACATGGCAACCGCTTTTACTCCTCACC RQGDKTFYGKGMTVD CATGTACAACTGTTGGACAATCTAGATGTGAAGCCGACACGTGCGGTGGC TNKKMTVVTQFHKNSAGVLSEI ACCTACAGTAGCGATAGGTATGCAGGAGTATGTGATCCTGACGGTTGCGA KRFYVQDGKIIANAESKIPGNPG TTTCAATGCTTATAGACAAGGAGACAAAACGTTTTATGGTAAAGGTATGA NSITQEYCDAQKVAF CCGTCGATACTAACAAGAAGATGACTGTGGTTACCCAGTTCCACAAGAAC SNTDDFNRKGGMAQMSKALAG TCAGCTGGAGTATTGTCTGAAATTAAAAGATTCTACGTCCAGGATGGAAA PMVLVMSVWDDHYANMLWLD GATTATTGCTAATGCCGAGAGTAAGATACCAGGTAACCCTGGAAATAGTA STYPIDQAGAPGAERGACP TCACACAGGAATACTGTGACGCTCAGAAGGTAGCTTTTAGCAACACCGAT TTSGVPAEIEAQVPNSNVIFSNIR GACTTCAATAGAAAGGGTGGAATGGCTCAAATGAGTAAGGCTTTAGCCGG FGPIGSTVPGLDGSNPGNPTTTV TCCAATGGTGTTGGTGATGTCGTTTGGGATGATCACTATGCAAACATGCT VPPASTSTSRPTS TTGGCTTGACAGCACCTATCCTATCGACCAAGCCGGAGCCCCAGGTGCTG STSSPVSTPTGQPGGCTTQKWGQ AAAGGGGTGCATGTCCAACCACGAGTGGTGTGCCCGCCGAGATTGAAGCT CGGIGYTGCTNCVAGTTCTQLN CAAGTGCCTAATAGTAACGTTATCTTTTCCAATATAAGATTCGGACCAATC PWYSQCL (SEQ ID NO: 29) GGATCCACTGTTCCAGGTTTGGATGGATCTAATCCTGGCAACCCAACAAC CACGGTAGTCCCTCCAGCTTCAACTTCCACAAGTAGACCAACAAGTTCAA CGTCCAGTCCAGTGCTACTCCTACCGGACAACCAGGAGGCTGTACCACT CAGAAATGGGGTCAATGCGGTGGAATTGGCTATACAGGTTGTACGAATTG CGTTGCAGGAACCACTTGTACACAGTTAAACCCTTGGTACTCACATGCCT ATAAGGCGCGCC (SEQ ID NO: 9) Acremonium ATGTATACCAATTTGCTGCATTGGCCGCTTTAGTTGCAACAGTAAGAGGT MYTKFAALAALVATVRGQAAC thermo- CAAGCCGCTTGTTCTCTAACCGCAGAAACTCACCCATCTCTACAATGGCA SLTAETHPSLQWQKCTAPGSCTT philum GAAATGCACAGCCCCTGGATCTTGTACAACTGTCCCCGGCCAAGTCACCA VSGQVTIDANWRWLHQTNSSTN CBH1 TTGACGCTAATTGGAGATGGCTTCACCAAACTAACTCTTCAACGAATTGTT CYTGNEWDTSICSSDTDCATKC ATACCGGTAACGAATGGGATACTTCCATATGTTCATCCGATACAGACTGC CLDGADYTGTYGVTASGNSLNL GCAACGAAATGTTGTTTAGATGGAGCAGACTATCGGGAACTTATGGTGT KFVTQGPYSKNIGSRMYLMESES TACAGCCTCAGGTAATTCCCTAAACCTTAAGTTCGTAACTCAAGGACCAT KYQGFTLLGQEFTFDVDVSNLG ATAGTAAGAATATCGGCTCTAGAATGTACTTGATGGAAAGTGAGAGCAAA CGLNGALYFVSMDLDGGVSKYT TATCAGGGTTTTACGTTATTGGGACAAGAGTTTACATTTGATGTTGATGTG TNKAGAKYGTGYCDSQCPRDLK AGTAACTTAGGTTGCGGCCTAAACGGCGCCTTGTACTTCGTTTCTATGGAT FINGQANIDGWQPSSNDANAGL CTTGATGGAGGTGTATCAAAATACACGACCAACAAGGCTGGAGCCAAATA GNHGSCCSEMDIWEANKVSAAY TGGTACGGGATATTGTGACAGCCAATGCCCTAGAGACTTAAAGTTCATTA TPHPCTTIGQTMCTGDDCGGTYS ACGGTCAGGCAAATATTGACGGCTGGCAACCAAGCAGTAACGACGCTAAT SDRYAGICDPDGCDFNSYRMGD GCCGGACTAGGTAACCATGGCTCATGTTGTTCCGAAATGGATATCTGGGA TSFYGPGKTVDTGSKFTVVTQFL AGCCAATAAGGTGTCCGCTGCCTACACCCCCATCCATGCACGACAATCG TGSDGNLSEIKRFYVQNGKVIPN GTCAGACAATGTGTACCGGTGATGACTGTGGAGGCACATACTCAAGTGAT SESKIAGVSGNSITTDFCTAQKT AGGTACGCCGGTATATGTGATCCTGACGGTTGCGATTTCAACTCTTATAGA AFGDTNVFEERGGLAQMGKAL ATGGGAGATACATCCTTTTACGGCCCCGGTAAAACAGTTGATACGGGTAG AEPMVLVLSVWDDHAVNMLWL TAAGTTCACTGTTGTTACTCAGTTCTTAACAGGTTCAGACGGCAATCTTAG DSTYPTDSTKPGAARGDCPITSG TGAAATCAAAAGATTCTACGTTCAGAATGGAAAAGTCATTCCTAATTCCG VPADVESQAPNSNVIYSNIRFGPI AGAGTAAGATTGCTGGTGTGTCTGGTAACAGTATCACGACCGACTTCTGT NSTYTGTPSGGNNPPGGGTTTTTT ACCGCCCAAAAGACTGCCTTTGGAGATACGAATGTTTTCGAGGAAAGGGG TTTSKPSGPTTTTNPSGPQQTHW CGGTCTTGCTCAAATGGGCAAGGCTTTGGCCGAACCATGGTATTAGTCC GQCGGQGWTGPTVCQSPYTCK TATCCGTTTGGGATGATCATGCAGTGAATATGCTTTGGCTTGATAGCACCT YSNDWYSQCL (SEQ ID NO: 46) ACCCTACTGACAGCACCAAGCCAGGAGCTGCCAGAGGTGACTGTCCTATC ACAAGTGGCGTTCCAGCAGATGTAGAGAGCCAAGCTCCAAACTCCAATGT GATCTATTCTAACATCAGATTTGGCCCCATTAATAGTACCTATACAGGAAC GCCCTCTGGTGGTAACCCTCCAGGCGGAGGCACCACAACTACCACGACCA CAACGACTTCAAAGCCTTCTGGCCCTACGACAACTACCAATCCTTCCGGA CCACAGCAAACTCACTGGGGTCAGTGTGGAGGCCAAGGATGGACGGGTC CTACCGTGTGTCAATCACCTTACACATGCAAATACAGTAATGACTGGTACT CTCAGTGTTTATAA (SEQ ID NO: 45) Endoglucanases Coptotermes ATGAGATTTCCTTCCATATTCACCGCTGTRRTGTTCGCAGCCTCAAGTGCTT MRFPSIFTAVLFAASSALAECTK lacteus EG TAGCAGAATGTACTAAGGGTGGATGTACTAACAAGAATGGATACATAGTT GGCTNKNGYIVHDKHVGDIQNR CATGATAAGCACGTCGGTGACATCCAGAATAGAGACACTTTGGACCCTCC DTLDPPDLDYEKDVGVTVSGGT AGACTTAGATTATGAAAAGGACGTGGGAGTAACCGTGTCCGGTGGAACCC LSQRLVSTWNGKKVVGSRLYIV TTAGTCAAAGATTAGTCTCAACTTGGAACGGTAAGAAAGTCGTGGGAAGT DEADEKYQLFTFVGKEFTYTVD AGATTGTATATTGTGGACGAAGCCGACGAGAAATATCAATTATTCACATTT MSQIQCGINAALYTVEMPAAGK GTCGGTAAGGAGTTCACCTATACCGTTGATATGTCCCAGATCCAATGTGGA TPGGVKYGYGYCDANCVDGDC ATCAATGCCGCATTATACACAGTGGAAATGCCTGCCGCTGGAAAGACCCC CMEFDIQEASNKAIVYTTHSCQS TGGAGGTGTTAAGTATGGATATGGATATTGTGATGCCAACTGCGTGGATG QTSGCDTSGCGYNPYRDSGDKA GAGATTGTTGTATGGAGTTCGATATCCAAGAAGCTTCTAACAAGGCAATC FWGTTINVNQPVTIVTQFIGSGSS GTTTACACCACCCATTCCTGTCAAAGTCAAACTTCAGGTTGCGATACCTCA LTEVKRLCVQGGKTFPPAKSLT GGATGCGGTTACAACCCTTACAGAGACAGTGGTGACAAGGCATTCTGGGG DSYCNANDYRSLRTMGASMAR AACAACTATAAACGTAAACCAGCCTGTGACAATTGTAACACAGTTTATCG GHVVVFSLWDSNGMSWMDGG GTTCTGGTAGTTCCTTAACTGAAGTCAAAAGATTGTGCGTGCAAGGTGGA NAGPCTSYNIESLESSQPNLKVT AAGACCTTCCCTCCAGCCAAATCATTAACCGACAGTTATTGTAATGCCAAC WSNVKYGEIDSPY (SEQ ID GACTATAGAAGTTTGAGAACTATGGCTGCATCCATGGCTAGAGGACACGT NO: 30) TGTTGTGTTTTCTTTGTGGGATTCTAATGGTATCAGTTGGATGGATGGAGG TAAGGCCGGTCCTTGTACCTCATATAATATTGAATCTTTGGAATCCAGTCA GCCAAACTTAAAGGTCACATGGTCAAACGTGAAATACGGAGAGATCGATT CTCCTTATTAA (SEQ ID NO: 10) Coptotermes ATGAGATTCCCTTCCATTTTCACTGCTGTTTTGTTCGCAGCCTCAAGTGCTT BAB40697 formosanus TAGCAGCCTATGACTACAAGACAGTATTGAAGAACTCCTTGTTGTTCTACG MRFPSIFTAVLFAASSALAAYDY EG AAGCTCAAAGAAGTGGAAAATTGCCTGCAGACCAGAAGGTGACCTGGAG KTVLKNSLLFYEAQRSGKLPAD AAAAGATTCCGCATTAAACGACAAGGGACAGAAGGGAGAGGACTTAACT QKVTWRKDSALNDKGQKGEDL GGAGGTTATTACGACGCCGGAGACTTTGTGAAGTTCGGTTTTCCATGGCA TGGYYDAGDFVKFGFPMAYTV TACACAGTTACCGTGTTGGCCTGGGGTTTAGTCGATTATGAATCTGCTTAC TVLAWGLVDYESAYSTAGALD AGTACTGCGGGTGCCTTGGATGATGGTAGAAAGGCCTTGAAATGGGGTAC DGRKALKWGTDYFLKAHTAAN AGATTATTTCTTGAAAGCACATACCGCTGCCAATGAGTTTTACGGACAGGT EFYGQVGQGDVDHAYWGRPED GGGTCAGGGAGATGTGGATTATGCTTACTGGGGACGTCCTGAGGACATGA MTMSRPAYKIDTSKPGSDLAAE CTATGTCTAGACCAGCTTACAAGATCGATACATCAAAACCTGGTAGTGACT TAAALAATAIAYKSADSTYSNN TAGCTGCAGAAACAGCAGCCGCTTTAGCAGCAACCGCAATAGCTTACAAG LITHAKQLFDFANNYRGKYSDSI TCAGCCGATTCTACCTACAGTAACAACTTAATTACTCATGCAAAGCAGTTG TDAKNFYASGDYKDELVWAAA TTCGATTTTGCAAACAATTATAGAGGAAAGTACTGATAGTATTACCGAT WLYRATNDNTYLTKAESLYNEF GCCAAGAATTTCTATGCATCCGGTGATTATAAGGACGAATTAGTATGGGCT GLGSWNGAFNWDNKISGVQVL GCAGCCTGGTTGTATAGAGCTACAAATGATAACACTTACTTAACCAAAGC LAKLTSKQAYKDKVQGYVDYL CGAATCATTGTATAATGAATTGGTTTAGGATCTTGGAACGGTGCATTCAA VSSQKKTPKGLVVYIDQWGTLRH TTGGGATAACAAGATATCCGGAGTTCAGGTCTTATTAGCCAAATTGACATC AANSALLALQAADLGINAASYR CAAACAAGCATACAAAGATAAAGTTCAGGGTTATGTTGATTACTTAGTCTC QYAKKQIDYALGDGGRSYVVG CTCTCAAAAGAAAACTCCAAAGGGATTGGTCTATATTGACCAATGGGGAA FGTNPPVRPHHRSSSCPDAPAAC CCTAAGACACGCAGCTAATAGTGCCTTGATCGCTTTACAGGCCGCTGATT DWNTYNSAGPNAHVLTALVG TGGGTATAAACGCTGCTAGTTATAGACAATACGCAAAGAAGCAAATTGAT GPDSNDSYTDSRSDYISNEVATD TATGCCTTAGGTGACGGAGGTCGTTCTTACGTGGTCGGATTCGGAACTAAC YNAGFQSAVAGLLKAGV (SEQ CCTCCAGTAAGACCTCATCATAGATCCAGTTCCTGTCCTGACGCACCAGCC ID NO: 31) GTTGCGACTGGAATACTTACAACTCTGCCGGACCAAATGCCCACGTCTTG ACCGGAGCCTTAGTAGGTGGACCAGATTCCAACGATAGTTACACAGATTC ACGTTCTGATTATATCAGTAACGAAGTCGCTACTGATTACAATGCCGGTTT CCAATCTGCAGTTGCTGGTTTGTTGAAAGCCGGAGTATAA (SEQ ID NO: 11) Nasutitermes ATGAGATTCCATCTATTTTCACTGCCGTCTTATTTGCAGCCTCCAGTGCAT MRFPSIFTAVLFAASSALAAYDY takasa- TAGCAGCCTATGATTATAAACAAGTTTTGAGAGATTCCTTATTGTTCTACG KQVLRDSLLFEAQRSGRLPAD goensis EG AAGCTCAGAGAAGCGGTAGATTACCAGCAGACCAGAAGGTCACTTGGAG QKVTWRKDSALNDQGDQGQDL AAAAGATTCAGCCTTGAATGATCAGGGAGATCAAGGTCAAGACTTAACCG TGGYFDAGDFVKFGPMAYTAT GAGGTTATTTTGACGCCGGTGATTTTGTGAAATTTGGTTTCCCAATGGCAT VLAWGLIDFEAGYSSAGALDDG ATACTGCTACCGTCTTGGCCTGGGGTTTAATCGATTTTGAGGCAGGATACA RKAVKWATDYFIKAHTSQNEFY GTTCCGCTGGTGCCTTGGATGACGGTAGAAAAGCAGTAAAGTGGGCAACT GQVGQGDADHAFWGRPEDMT GATTACTTTATAAAGGCCCACACTTCACAGAATGAGTTTTACGGACAAGTG MARPAYKIDTSRPGSDLAGETA GGTCAGGGTGACGCTGATCACGGTTCTGGGGACGTCCTGAAGATATGAC AALAAASIVFRNVDGTYSNNLL CATGGCTAGACCAGCCTACAAGATTGACACCAGCAGACCAGGTAGTGACT THARQLFDFANNYRGKYSDSIT TAGCGGGTGAAACCGCAGCGGCATTGGCAGCTGCCAGTATCGTGTTTAGA DARNFYASADYRDELVWAAAW AATGTTGATGGTACATACTCTAACAAGTACTTACTCATGCCAGACAATTA LYRATNDNTYLNTAESLYDEFG TTTGACTTTGCAAATAACTACAGAGGAAAATACTCAGATTGCATAACCGA LQNWGGGLNWDSKVSGVQVLL CGCTAGAAACTTTTACGCCAGTGCAGATTACCGTGACGAATTGGTTTGGGC AKLTNKQAYKDTVQSYVNYLIN TGCCGCATGGTTGTACAGAGCTACAAATGACAACACTTACTTGAATACCG NQQKTPKGLLYIDMWGTLRHA CAGAATCCTTGTATGATGAATTTGGATTGCAGAACTGGGGTGGAGGGTTA ANAAFIMLEAAELGLSASSYRQF AACTGGGATTGAAAGGTGTCTGGTGTCCAGGTCTTGTTAGCAAAATTGACC AQTQIDYALGDGGRSFVCDFGS AACAAACAGGCTTACAAAGATACTGTGCAGTCTTACGTGAATTACCTGATT NPPTRPHHRSSSCPPAPATCDWN AATAACCAGCAAAAGACCCCAAAAGGATTGTTATACATTGATATGTGGGG TFNSPDPNYHVLSGALVGGPDQ TACATTGAGACACGCCGCAAATGCTGCATTCATCATGTTGGAAGCTGCCG NDNYVDDRSDYNHNEVATDYN AGTTGGGTTTATCCGCATCATCTTACAGACAGTTTGCTCAAACTCAGATCG AGFQSALAALVALGY (SEQ ID ACTACGCTTTGGGTGACGGTGGAAGAAGTTTCGTCTGTGGTTTTGGTTCAA NO: 32) ACCCTGCTACAAGACCACATCATCGTTCTTCCAGTTGCCCGCCTGCCCCAG CAACTTGTGACTGGAATACATTCAACTCACCTGACCCAAATTACCACGTGT TATCTGGAGCTTTGGTAGGAGGACCAGATCAAAACGATAATTATGTGGAT GATAGATCCGACTACGTCCATAACGAAGTGGCAACCGACTACAACGCCGG ATTTCAGAGTGCTTTGGCAGCCTTAGTTGCTTTGGGTTATTAA (SEQ ID NO: 12) Coptotermes ATGAGATTCCCTAGTATTTTCACTGCCGTCTTATTTGCAGCCAGTTCTGCTT MRFPSIFTAVLFAASSALAAYDY acinaciformis TAGCCGCATATGATTATACCACAGTTTTGAAAAGTTCCTTATTGTTCTACG TTVLKSSLLFYEAQRSGKLPADQ EG AAGCTCAAAGATCCGGTAAGTTGCCAGCCGACCAGAAGGTCACTTGGAGA KVTWRKDSALDDKGNNGEDLT AAAGATTCAGCATTAGACGATAAAGGAAATAATGGAGAGGACTTAACAG GGYYDAGDFVKFGFPLAYTATV GAGGTTATTATGACGCTGGTGATTTTGTGAAGTCTGGTTTTCCTTTAGCATA LAWGLVDYEAGYSSAGATDDG CACCGCTACTGTTTTAGCCTGGGGTTTTTGGTGGACTATGAAGCGGGTTACTC RKAVKWATDYLLKAHTAATEL ATCCGCTGGAGCCACAGATGACGGTAGAAAGGCAGTGAAATGGGCAACC YGQVGDGDADHAYWGRPEDM GACTATTTGTTGAAGGCACATACTGCCGCTACCGAGTTATACGGACAGGTC TMARPAYKIDASRPGSDLAGET GGGGACGGTGACGCCGATCACGCATATTGGGGACCTCCTGAAGATATGAC AAALAAASIVFKGVDSSYSDNL TATGGCTAGACCAGCATACAAGATCGACGCTAGCAGACCAGGATCTGACT LAHAKQLFDFADNYRGKYSDSI TAGCGGGTGAAACCGCTGCCGCTTTAGCCGCTGCATCCATAGTTTTCAAAG TQASNFYASGDYKDELVWAAT GTGTAGATTCTTCATATTCTGACAACTTGTTAGCTCACGCTAAACAGTTAT WLYRATNDNTYLTKAESLYNEF TTGATTTCGCTGACAATTATAGAGGAAAATACAGTGATTCCATAACACAA GLGNWNGAFNWDNKVSGVQV GCTTCAAACTTTTACGCCTCCGGAGATTACAAAGACGAGTTAGTCTGGGCT LLAKLTSKQAYKDTVQGYVDY GCCACTTGGTTGTACAGAGCAACCAACGATAATACATATTTGACCAAAGC LINNQKTPKGLLYIDQWGTLR AGAATCCTTGTACAACGAGTTCGGATTAGGAAACTGGAACGGAGCGTTA HAANAALIILQAADLGISADSYR ATTGGGACAACAAGGTGTCCGGTGTTCAGGTGTTGTTAGCCAAATTGACCT QFAKKQIDYALGDGGRSYVVGF CCAAGCAGGCTTATAAAGACACCGTTCAAGGATACGTCGATTATTTGATTA GDNPPTHPHHRSSSCPDAPAVC ACAATCAGCAAAAGACCCCAAAGGGTTTGTTATACATAGACCAATGGGGG DWNTFNSPDPNFHVLTGALVGG ACCTTGAGACACGCAGCTAATGCTGCCTTAATAATCTTACAGGCTGCTGAT PDQNDNYVDDRSDYVSNEVAT TTGGGTATTTCTGCCGACAGTTATAGACAATTCGCAAAGAAGCAAATAGA DYNAGFQSAVAALVTLGV (SEQ TTACGCTTTAGGTGACGGAGGTAGATCATATGTAGTTGGTTTTGGAGACAA ID NO: 33) TCCTCCAACACATCCTCATCACCGTTCTTCCTCATGCCCTGACGCCCCAGC AGTATGCGATTGGAATACTTTCAATTCACCTGATCCAAACTTTCATGTCTT AACCGGAGCTTTAGTGGGAGGTCCTGATCAGAACGATAACTACGTTGATG ATCGTTCTGACTACGTGTCCAACGAGGTTGCAACCGACTATAATGCAGGAT TCCAAAGTGCTGTGGCCGCTTTAGTTACTTTAGGAGTTTAA (SEQ ID NO: 13) Mastotermes ATGAGATTCCCAAGTATATTTACTGCTGTTTTGTTCGCAGCCAGTTCTGCTT MRFPSIFTAVLFAASSALAAYDY darwinensis TAGCAGCCTATGATTACAATGACGTATTAACCAAAAGTTTGTTGTTCTACG NDVLTKSLLFYEAQRSGKLPSD EG AAGCTCAAAGATCCGGTAAGTTACCTTCTGATCAGAAAGTCACCTGGAGA QKVTWRKDSALNDKGQNGEDL AAAGATTCAGCATTAAACGATAAGGGACAAAATGGTGAGGACTTAACTGG TGGYYDAGDYVKFGFPMAYTA TGGATATTATGACGCCGGTGATTACGTGAAGTTTGGTTTTCCAATGGCATA TVLAWGLVDHPAGYSSAGVLD TACTGCTACCGTTTTGGCTTGGGGTTTAGTGGACCATCCTGCCGGATACAG DGRKAVKWVTDYLIKAHVSKN TTCTGCGGGTGTCTTGGATGATGGTAGAAAAGCTGTGAAGTGGGTTACCG ELYGQVGDGDADHAYWGRPED ATTACTTAATCAAAGCCCACGTATCAAAGAACGAATTATACGGACAGGTC MTMARPAYKIDTSRPGSDLAGE GGTGACGGTGACGCAGATCACGCTTATTGGGGACGTCCAGAGGATATGAC TAAALAAASIVFKSTDSNYANT AATGCGAAGACCAGCATACAAAATAGACACTTCAAGACCAGGTTCCGACT LLTHAKQLFDFANNYRGKYSDS TAGCGGGTGAAACCGCAGCGGCATTGGCTGCTGCATCTATTGTGTTTAAGT ITQASNFYSSSDYKDELVWAAV CAACAGATTCTAATTACGCCAACACCTTATTGACCCACGCAAAACAATTAT WLYRATNDQTYLTTAEKLYSDL TCGACTTTGCCAATAACTATAGAGGTAAGTATAGTGATTCCATAACACAG GLQSWNGGFTWDTKISGVEVLL GCATCTAATTTCTACAGTAGTTCCGACTATAAAGATGAATTGGTTTGGGCA AKITGKQAYKDKVKGYCDYISG GCTGTATGGTTGTACAGAGCCACTAACGATCAGACCTATTTGACAACTGCA SQQKTPKGLVYIDKWGSLRMA GAGAAGTTATACTCAGACTTGGGATTACAGTCCTGGAACGGAGGTTTCAC ANAAYICAVAADVGISSTAYRQ ATGGGACACCAAAATTAGTGGAGTAGAAGTGTTATTGGCTAAGATTACTG FAKTQINYILDGAGRSFVVGYG GTAAACAGGCATATAAGGACAAAGTAAAGGGATATTGTGATTATATCTCA NNPPTHPHHRSSSCPDAPATCD GGATCTCAGCAGAAAACACGAAAGGATTAGTTTACATAGATAAGTGGGG WNNYNSANPNPHVLYGALVGG TTCCTTAAGAAGGCCGCAAACGCCGCATATATTTGCGCTGTAGCCGCAGA PDSNDNYQDLRSDYVANEVAT CGTCGGAATCAGTTCAACAGCTTACAGACAGTTCGCCAAAACACAGATTA DYNAAFQSLLALIVDLGL (SEQ ATTACATATTGGGTGATGCCGGACGTTCTTTTGTGGTTGGTTACGGAAACA ID NO: 34) ACCCACCTACACACCCACATCACAGATCCAGTTCATGTCCGACGCCCCAG CAACATGCGATTGGAATAACTACAACAGTGCTAACCCTAATCCACATGTTT TATACGGTGCATTAGTTGGTGGACCAGATTCCAACGATAATTATCAAGACT TAAGATCAGATTATGTCGCCAACGAAGTGGCAACAGACTACAATGCAGCC TTCCGTCATTGTTAGCATTAATCGTGGACTTAGGTTTGTAA (SEQ ID NO: 14) Nasutitermes ATGAGATTTCCATCTATTTTCACTGCCGTCTTATTTGCAGCCTCAAGTGCTT MRFPSIFTAVLFAASSALAAYDY walkeri EG TAGCAGCCTATGATTACAAACAAGTATTGAGAGATTCCTTATTGTTCTACG KQVLRDSLLFYEAQRSGRLPAD AAGCTCAGAGAAGCGGTAGATTACCAGCAGACCAGAAGGTCACCTGGAG QKVTWRKDSALNDQGEQGQDL AAAAGATTCCGCCTTGAATGATCAGGGAGAGCAAGGTCAAGACTTAACCG TGGYFDAGDFVKFGFPMAYTAT GAGGTTATTTTGACGCCGGTGATTTTGTGAAGTTTGGATTCCCAATGGCTT VLAWGLIDFEAGYSSAGALDDG ATACAGCAACCGTTTTGGCCTGGGGTTTAATCGACTTTGAAGCCGGTTACT RKAVKWATDYFIKAHTSQNEFY CTTCTGCTGGTGCCTTGGACGATGGTAGAAAAGCAGTAAAGTGGGCTACT GQVGQGDVDHAYWGRPEDMT GATTACTTTATAAAAGCCCATACTTCTCAAAACGAGTTTTACGGACAAGTC MARPAYKIDTSRPGSDLAGETA GGTCAGGGTGACGTAGATCACGCATATTGGGGACGTCCTGAAGATATGAC AALAAASIVFKNVDGTYSNNLL AATGGCTAGACCAGCCTACAAGATTGATACCAGCAGACCAGGTAGTGACT THARQLFDFANNYRGKYSDSIT TAGCAGGAGAAACTGCTGCAGCTTTGGCTGCCGCATCCATCGTTTTCAAGA DARNFYASADYRDELVWAAAW ATGTAGATGGTACATATTCCAACAACTTACTTACTCATGCTAGACAGTTGT NYRATNDNSYLNTAESYNEFG TTGATTTCGCCAACAATTACAGAGGAAAATACTCTGATAGTATTACCGATG LQNWGGGLNWDSKVSGVQVLL CAAGAAACTTTTACGCTAGTGCCGACTATAGAGATGAGTTAGTCTGGGCA AKLTNKQEYKDTIQSYVNYLIN GCTGCCTGGTTGTACAGAGCAACCAACGACAATTCTTACTTGAACACTGCT NQQKTPKGLLYIDMWGTLRHA GAATCATTATACAACGAGTTTGGATTGCAAAATTGGGGTGGAGGGTTAAA ANAAFIMLEAADLGLSADDYRQ CTGGGATTCTAAAGTGAGTGGTGTTCAA\GTTTTGTTAGCCAAGTTGACCAA FAQTQIDYALGDGGRSFVCGFG CAAACAAGAGTATAAGGACACTATTCAATCATACGTGAATTACTTAATCA SNPPTRPHHRSSSCPPAPATCDW ATAACCAACAGAAAACTCCAAAGGGATTGTTATACATTGACATGTGGGGG NTFNSPDPNYNVLSGALVGGPD ACCTTGAGACACGCAGCTAACGCAGCCTTTATAATGTTAGAAGCTGCCGA QNDNYVDDRSDYNHNEVATDY CTTAGGTTTATCCGCTTCATCTTATAGACAGTTGCGCCCAAACACAAATAGA NAGFQSALAALVALGY (SEQ ID CTACGCATTGGGGGACGGTGGACGTTCTTTTGTCTGTGGTTTCGGTTCTAA NO: 35) TCCTCCAACTAGACCTCATCATAGATCCAGTTCATGCCCGCCTGCTCCAGC TACCTGTGATTGGAATACATTCAATTCTCCTGACCCAAACTACAATGTTTT ATCCGGTGCCTTGGTTGGTGGTCCTGACCAGAATGATAACTACGTGGACG ATAGAAGTGATTATGTCCATAATGAGGTAGCAACTGACTACAATGCCGGT TTCCAATCAGCCTTAGCCGCTTTAGTCGCCTTAGGTTACTAA (SEQ ID NO: 15) Reticuli- ATGAGATTCCCAAGTATATTTACTGCCGTCTTATTTGCAGCCTCCAGTGCA AB019095 termes TTAGCCGCTTATGACTACAAAACAGTATTGTCAATTCCTTGTTGTTCTAC MRFPSIFTAVLFAASSALAAYDY speratus EG GAAGCTCAAAGATCCGGTAAGTTACCTTCTGACCAGAAAGTGACCTGGAG KTVLSNSLLFYEAQRSGKLPSDQ AAAGGATTCAGCATTAAACGACAAAGGACAAAAGGGTGAGGACTTAACC KVTWRKDSALNKDGQKGEDLT GGTGGATATTACGACGCCGGAGATTTTGTGAAATTTGGTTTTCCAATGGCT GGYYDAGDFVKGFPMAYTVT TACACAGTTACCGTATTGGCATGGGGTGTTATTGATTACGAATCCGCCTAC VLAWGVIDYESAYSAAGALDSG TCTGCCGCAGGAGCTTTAGATTCAGGTAGAAAGGCCTTGAAATATGGGAC RKALKYGTDYFLKAHTAANEFY CGACTATTTCTTAAAGGCACATACAGCAGCTAACGAGTTTTACGGACAGG GQVGQGDVDHAYWGRPEDMT TGGGTCAAGGTGACGTTGACCACGCATACTGGGGACGTCCTGAAGATATG MRSPAYKIDTSKPGSDLAAETA ACCATGAGCAGACCAGCATACAAAATAGACACTTCTAAGCGGGTTCCGA AALAATAIAYKSADATYSNNLIT CTTAGCTGCAGAGACTGCAGCTGCATTAGCAGCCACAGCTATTGCATACA HAKQLFDFANNYRGKYSDSITD AATCTGCCGATGCAACATATTCCAACAATTTGATAACACATGCAAAACAA AKNFYASGDYKDELVWAAAWL TTATTCGACTTTGCCAACAATTACAGAGGAAAATATTCCGATAGTATTACC YRATNDNTYLTKAESLYNEFGL GATGCCAAGAACTTTTATGCTTCTGGTGATTACAAAGACGAATTGGTATGG GNFNGAFNWDNKVSGVQVLLA GCCGCTGCATGGTTGTACAGAGCAACCAATGACAACACATATTGACTAA LKTSKQVYKDKVQSYVDYLISS GGCAGAATCCTTATACAATGAATTTGGTTTGGGAAACTTCAATGGTGCCTT QKKTPKGLVYIDQWGTLRIIAA CAATTGGGATAACAAAGTCTCCGGAGTCCAGGTGTTATTGGCCAAGTTAA NSALIALQAADLGINAATYRAY CCTCAAAACAAGTGTATAAGGATAAGGTACAGTCTTACGTGGATATTTG AKKQIDYALGDGGRSYVIGFGT ATCTCCTCACAAAAAAAGACACCAAAAGGTTTAGTGTACATCGATCAATG NPPVRPHHRSSSCPDAPAVCDW GGGTACTTTAAGACACGCAGCTAATTCTGCTTTGATCGCTTTGCAGGCAGC NTYNSAGPNAHVLTGALVGGPD TGAGTAGGAATTAACGCTGCTACTTACAGAGCCTACGCAAAGAAGCAAA SNDSYTDARSDYISNEVATDYN TCGACTATGCTTTGGGTGATGGTGGAAGATCCTATGTTATTGGATTTGGGA AGFQSAVAGLLKAGV (SEQ ID CCAACCCTCCAGTAAGACCACATCACAGAAGTTCATCTTGCCCAGATGCA NO: 36) CCAGCTGTCTGCGATTGGAACACCTATAACTCCGCTGGTCCAAACGCCCAC GTGTTAACCGGTGCATTGGTTGGAGGACCTGATAGTAATGATAGTTATACC GATGCTCGTTCTGACTACATATCCAACGAAGTGGCAACTGATTACAATGCG GGTTTCCAATCCGCTGTCGCTGGATTATTGAAGGCGGGTGTCTAA (SEQ ID NO: 16) Neosartorya ATGAGATTTCCATCTATTTTCACTGCAGTTTTGTTCGCAGCCAGTTCCGCTT XM_001258277 fischeri EG TGGCCCAACAGATCGGGTCCATCGCCGAAAATCATCCTGAGTTGACAACC MRFPSIFTAVLFAASSALAQQIG TATAGATGCTCCTCTCAAGCTGGATGCGTAGCACAGAGTACTTCCGTCGTG SIAENHPELTTYRCSSQAGCVAQ TTAGATATTAACGCTCATTGGATTCATCAAAACGGTGCCCAAACAAGTTGC STSVVLDINAHWIHQNGAQTSC ACTACCTCAAGTGGATTGGACCCTTCATTGTGCCCTGATAAAGTCACCTGT TTSSGLDPSLCPDKVTCSQNCVV TCTCAGAACTGCGTAGTCGAAGGAATAACCGACTACTCATCTTTTGGTGTG EGITDYSSFGVQNSGDAMTLRQ CAAAACTCCGGAGATGCAATGACATTAAGACAGTATCAAGTTCAAAATGG YQVQNGQIKTLRPRVYLLAEDG ACAGATCAAAACATTGCGTCCTAGAGTGTACTTGTTAGCTGAGGATGGAA INYSKLQLLNQEFTFDVDASKLP TCAATTACTCCAAATTGCAGTTGTTGAACCAAGAGTTTACTTTCGATGTGG CGMNGALYLSEMDASGGRSAL ACGCTTCCAAATTGCCTGTGGTATGAATGGAGCTTTATATTTGTCAGAAA NPAGATYGTGYCDAQCFNPGP TGGATGCTTCTGGTGGACGTTCTGCCTTGAACCCAGCGGGTGCCACATATG WINGEANTAGAGACCQEMDLW GAACAGGTTACTGTGATGCCCAGTGCTTCAACCCAGGTCCATGGATAAAT EANSTSTIFSPHPCTTAGLYACT GGAGAAGCAAATACTGCTGGAGCCGGTGCATGTTGCCAAGAGATGGACTT GAECYSICDGYGCTYNPYELGA ATGGGAAGCCAACTCCCGTTCTACCATTTTCAGTCCTCACCCATGTACAAC KDYYGYGLTIDTAKPITVVTQF TGCGGGTTTGTATGCCTGTACTGGAGCTGAGTGCTACTCAATCTGTGACGG MTADNTATGTLAEIRRLYVQDG TTATGGTTGCACTTACAACCCTTATGAATTAGGAGCCAAAGATTACTATGG KVIGNTAVAMTEAFCSSSRTFEE TTACGGTTTGACTATTGACACCGCAAAGCCAATAACAGTGGTTACTCAGTT LGGLQRMGEALGRGMVPVFSI TATGACCGCTGATAATACAGCAACCGGTACATTAGCAGAGATCAGAAGAT WDDPGLWMHWLDSDGAGPCG TATATGTTCAAGATGGTAAAGTAATCGGAAATACAGCCGTGGCCATGACC NTEGDPAFIQANYPNTAVTFSKV GAGGCATTTTGTAGTTCTAGTAGAACATTTGAAGAGTTAGGTGGTTTGCAA RWGDIGSTYSS (SEQ ID AGAATGGGAGAAGCTTTAGGTAGAGGAATGGTGCCAGTTTTCTCAATATG NO: 37) GGACGATCCTGGTTTGTGGATGCATTGGTTAGATTCTGACGGTGCAGGACC TTGTGGTAATACTGAAGGTGATCCTGCCTTCATTCAGGCTAACTACCCAAA TACCGCCGTAACATTCTCCAAGGTGAGATGGGGAGATATCGGTTCTACCTA TAGTTCTTAA (SEQ ID NO: 17) Reticuli- ATGAGATTTCCATCTATTTTCACTGCTGTTTTGTTCGCAGCCTCAAGTGCTT DQ014512 termes TAGCACAATGGATGCAGATCGGTGGTAAGCAGAAATATCCTGCCTTTAAG MRFPSIFTAVLFAASSALAQWM flavipes EG CCAGGTGCTAAGTACGGAAGAGGTTATTGTGACGGACAGTGCCCTCACGA QIGGKQKYPAFKPGAKYGRGYC CATGAAGGTGTCTAGTGGAAGAGCAAACGTTGACGGATGGAAGCCACAA DGQCPHDMKVSSRANDVDGWK GACAACGACGAAAATAGTGGAAATGGAAAATTGGGTACATGTTGCTGGGA PQDNDENSGNGKLGTCCWEMD GATGGATATATGGGAAGGAAACTTAGTGTCCCAAGCCTACACCGTTCACG IWEGNLVSQAYTVHAGSKSGQY CTGGTTCCAAGTCCGGACAATATGAGTGTACTGGAACACAATGCGGTGAC ECTGTQCGDTDSGERFKGTCDK ACCGACAGTGGTGAAAGATTCAAGGGAACATGCGATAAAGATCGTTGTGA DGCDFASYRWGATDYYGPGKT TTTGCAAGTTACAGATCGGGAGCTACACACTATTACGGTCCTGGAAAGA VDTKQPMTVVTQFIGDPLTEIKR CCGTGGACACCAAACAGCCAATGAGAGTCGTGACCCAGTTCATTGGTGAC VYVQGGKVINNSKTSNLGSVYD CCTTTGACTGAGATAAAGAGAGTTTATGTACAAGGAGGAAAAGTCATAAA SLTEAFCDDTKQVTGDTNDFKA CAATTCCAAAACATCTAACTTAGGTTCAGTGTACGATTCTTTGACTGAGGC KGGMSGFSKNLDTPQVLVMSL CTTCTGCGATGACACCAAACAGGTTACAGGTGAGACAAATGACTTTAAGG WDDHTANMLWLDSTYPTDSTK CTAAAGGAGGTATGTCTGGATTCTCCAAGAACTTAGACACCCCACAAGTTT PGAARGTCAVTSGDPKDVESKQ TGGTGATGTCTTTATGGGATGACCATACAGCTAATATGTTATGGTTAGATT ANSQVVYSDIKFGPINSTYKAN CTACTTATCCTACCGATAGTACAAAGCCAGGGGCCGCAAGAGGTACTTGT (SEQ ID NO: 38) GCCGTCACCTCCGGGGACCCGAAAGATGTGGAATCCAAGCAAGCCAACTC TCAGGTAGTTTACAGTGACATTAAGTTTGGTCCTATTAATTCAACATACAA AGCAAATTAA (SEQ ID NO: 18) Trichoderma ATGGTCTCCTTCACCTCCCTGCTGGCCGGCGTTGCCGCTATCTCTGGTGTCC AB003694 reesei EG1 TAGCAGCCCCTGCCGCAGAAGTTGAACCTGTCGCAGTTGAGAAACGTGAG MVSFTSLLAGVAAISGVLAAPA GCCGAAGCAGAAGCTCAACAACCAGGAACATCAACACCAGAAGTCCATC AEVEPVAVEKREAEAEAQQPGT CAAAGTTAACAACCTATAAATGTACTAAGAGTGGAGGGTGTGTAGCGCAG STPEVHPKLTTYKCTKSGGCVA GACACAAGTCTGGTCTTAGACTGGAATTATCGTTGGATGCATGATGCCAA QDTSVVLDWNYRWMHDANYN TATAATTCCTGTACTGTTAACGGCGGTGTTAACACTACGTTATGCCCCGAT SCTVNGGVNTTLCPDEATCGKN GAAGCGACTTGTGGTAAGAATTGTTTTATTGAAGGGGTTGACTACGCCGCT CFIEGVDYAASGVTTSGSSLTMN AGTGGTGTTACGACGAGTGGGTCATCCTTGACGATGAATCAATACATGCCT QYMPSSSGGYSSVSPRLYLLDSD TCTTCTAGTGGTGGGTATTCCTCTGTGTCTCCAAGGCTGTATTTATTGGATT GEYVMLKLNGQELSFDVDLSAL CCGATGGGGAATATGTTATGTTAAAATTAAATGGGCAAGAACTGAGTTTT PCGENGSLYLSQMDENGGANQ GATGTGGATCTATCTGCATTACCTTGTGGAGAAAATGGTAGTCTTTATTTA YNTAGANYGSGYCDAQCPVQT TCACAAATGGACGAAAACGGCGGAGCCAATCAGTACAATACAGCTGGTGC WRNGTLNTSHQGFCCNEMDILE TAATTATGGTTCAGGCTATTGTGATGCTCAATGTCCAGTGCAGACTTGGAG GNSRANALTPHSCTATACDSAG GAATGGCACCTTAAACACATCACATCAAGGATTTTGCTGTAACGAAATGG CGFNPYGSGYKSYYGPGDTVDT ACATATTAGAAGGTAATTCAAGAGCTAATGCAGAACTCCGCACTCTTGTA SKTFTHTQFNTDNGSPSGNLVSI CTGCGACCGCATGTGATTCTGCCGGTTGTGGTTTCAACCCTTATGGTTCTG TRKYQQNGVDIPSAQPGGDTISS GTTATAAGAGTTACTACGGTCCGGGAGACACCGTGGATACGTCAAAGACC CPSASAYGGLATMGKALSSGM TTCACTATAATCACTCAGTTTAACACAGATAACGGATCTCCGAGTGGTAAT VLVFSIWNDNSQYMNWLDSGN TTGGTGAGTATTACTAGGAAATATCAGCAGAACGGTGTTGATATTGCGTCC AGPCSSTEGNPSNILANNPNTHV GCGCAGCCAGGCGGTGACACTATATCTAGCTGTCCTTCCGCCAGTGCCTAT VFSNIRWGDIGSTTNSTAPPPPPA GGCGGACTTGCTACAATGGGTAAGGCATTGTCCTCAGGTATGGTCCTAGTA SSTTFSTTRRSSTTSSSPSCTQTH TTTTGATTTGGAATGATAATTCACAATACATGAATTGGCTGGATTCTGGT WGQCGGIGYSGCKTCTSGTTCQ AATGCAGGCCCTTGCTCCTCTACAGAAGGTAACCCAAGCAATATAGAGC YSNDYYSQC (SEQ ID NO: 39) TAATAACCCAAATACTCATGTTGTCTTTAGTAATATTAGATGGGGCGATAT AGGTAGCACTACGAACAGTACCGCACCTCCTCCTCCACCTGCTAGCTCCAC GACATTTTCCACTACTAGAAGGTCCAGCACTACCAGCTCATCACCATGTG TACTCAAACCCATTGGGGACAGTGTGGTGGTATAGGTTACAGCGGTTGCA AAACTTGCACATCTGGTACTACATGCCAATACAGTAATGACTATTACTCAC AATGTTAA (SEQ ID NO: 19) Aspergillus TTAATTAAAATGAGAATTTCTAACTTGATTGTTGCTGCTTCTGCTGCTACTA MRISNLIVAASAATMVSALPSRQ kawachii TGGTTTCTGCTTTGCCATCTAGACAAATGAAAAAGAGGGATTCTGGTTTTA MKKRDSGFKWVGTSESGAEFGS EgA AATGGGTTGGTACTTCTGAATCTGGTGCTGAATTTGGTTCTGCTTTACCAG ALPGTLGTDYTWPETSKIQVLR GTACTTTGGGTACTGATTATACTTGGCCAGAAACTTCTAAAATTCAAGTTT NKGMNIFRIPFLMERLTPDGLTP TGAGAAACAAGGGTATGAACATTTTTAGAATACCATTCTTGATGGAAAGA SFASTYLSDLKSTVEFVTNSGAY TTAACTCCAGATGGTTTGACTGGTTCTTTTGCTTCTACTTACTTGTCTGATT AVLDPHNYGRFDGSIIESTSDFK TGAAGTCAACTGTTGATTTGTTACTAATTCTGGTGCTTATGCTGTTTTAGA TWWKNVATEFADNDKVIFDTN TCCACATAATTACGGTAGATTCGATGGTTCTATTATTGAATCTACTTCTGAT NEYHDMEQSLVLNLNQAAINGI TTTAAGACTTGGTGGAAAAATGTTGCTACTGAATTTGCTGATAACGATAAG RAAGATTQYIFVEGNAYTGAW GTTATTTTCGATACAAACAACGAATATCATGATATGGAACAATCTTTGGTT DWTTYNDDLSGLTDSEDKIIYE TTGAATTTGAACCAAGCTGCTATTAATGGTATTAGAGCTGCTGGTGCTACT MHQYLDSDSSGTSETCVSSTIGK ACTCAATACATTTTCGTTGAAGGTAATGCTTATACTGGTGCTTGGGATTGG ERIEKATEWLKTNNKQGIIGEFA ACTACTTACAATGATGATTTGTCTGGTTTAACTGATTCTGAAGATAAGATA GGVNSVCEEAVEGMLAYMSEN ATATACGAAATGCATCAATACTTGGATTCTGATTCTTCTGGTACATCTGAA SDVWVGASWWSAGPWWGTYM ACTTGTGTTTCTTCTACTATTGGTAAAGAAAGAATTGAAAAGGCTACTGAA YSLEPTDGTAYSTYLPILEKYFPS TGGTTGAAAACTAACAACAAGCAAGGTATTATTGGTGAATTTGCAGGTGG GDASSSSSASASVAAATSAVSTT TGTTAATTCTGTTTGTGAAGAGGCTGTTGAAGGAATGTTGGCTTATATGTC TTAAFEQTTTPATQVEIASSSSSS TGAAAATTCTGATGTTTGGGTTGGTGCTTCCTTGGTGGTCTGCTGGTCCATG SAVAASQTTLSKVKSKSKSPCKL GTGGGGTACTTACATGTATTCTTTGGAACCAACTGATGGTACTGCTTATTC SSATSSAVSSAAAVTTPAVAATT TACTTATTTGCCAATTTTGGAAAAATACTTCCCATCTGGTGATGCTTCATCA PAAAPTSSSVAFATTSVYVPTTT TCTTCATCTGCTTCAGCTTCAGTTGCAGCCGCTACTTCTGCTGTTTCTACTA AAAPSQVSSSAASSSGVVGVS CTACTACAGCTGCATTTGAACAAACTACTACTCCAGCTACTCAAGTTGAAA DPQGPSATSAGEVNQYYQCGG TTGCTTCTTCTTCATCTTCATCATCAGCTGTTGCTGCTTCACAAACTACTTT INWTGPTVCASPYTCKVQNDYY GTCTAAGGTTAAGTCTAAATCTAAATCTCCATGTAAATTGTCATCTGCTAC YQCVAE (SEQ ID NO: 52) TTCATCTGCTGTTTCATCAGCTGCTGCAGTTACTACACCTGCAGTTGCAGCT ACAACTCCAGCTGCTGCTCCAACTTCTTCTTCTGTTGCTTTTGCTACTACTT CTGTTTACGTTCCAACTACTACTGCTGCTGCACCATCTCAAGTTTCATCTTC AGCTGCAGCTTCATCTTCAGGTGTTGTTGGTGTTTCTGATCCACAAGGTCC ATCTGCTACTAATTCTGCTGGTGAAGTTAATCAATATTACCAATGTGGTGG TATTAATTGGACTGGTCCAACTGTTTGTGCTTCTCCATATACTTGTAAGGTT CAAAACGATTACTACTATCAATGTGTTGCTGAATTATAAGGCGCGCC (SEQ ID NO: 47) Heterodera TTAATTAAAATGCATTGGGCTGATGTTGCTTGTTCTAGACCACCATGGCCA MHWADVACSRPPWPRDSVKAL schachtii AGAGATTCTGTTAAAGCTTTGAAGTGTAATTGGAACGCTAATGTTATTAGA KCNWNANVIRGAMGVDEGGYL Eng1 GGTGCTATGGGTGTTGATGAAGGTGGTTATTTGTCTGATGCTAATACTGCT SDANTAYNLMVAVIEAAISNGIY TACAATTTGATGGTTGCTGTTATTGAAGCTGCTATTTCTAATGGTATCTACG VIVDWHAHNAHPDEAVKFFTRI TTATTGTTGATTGGCATGCTCATAATGCTCATCCAGATGAAGCTGTTAAAT AQAYGSYLHILYEDFNEPLDVS TCTTTACTAGAATTGCTCAAGCTTATGGTTCTTACTTGCATATTTTGTACGA WTDVLVPYHKKVIAAIRAIDKK AGATTTCAATGAACCATTGGATGTTTCTTGGACTGATGTTTTGGTTCCATA NVIILGTPKWSQDVDVASQNPIK CCATAAAAAAGTTATTGCTGCCATTAGAGCTATTGATAAGAAGAACGTTA DYQNLMYTLHFYASSHFTSDLG TTATCTTGGGTACTCCAAAATGGTCACAAGATGTTGATGTTGCTTCTCAAA AKLKTAVNNGLPVFVTEYGTCE ATCCAATTAAGGATTACCAAAACTTGATGTACACTTTGCATTTTTACGCTT ASGNGNLNTDSMSSWWTLLDS CATCTCATTTTACATCTGATTTGGGTGCTAAATTGAAAACTGCTGTTAACA LKISYANWAISDKSEADSALSPG ATGGTTTGCCAGTTTTTGTTACTGAATATGGTACTTGTGAAGCTTCTGGTA TTAVNVGVSSRWTSSGNMVAS ATGGTAATTTGAATACTGATTCTATGTCATCTTGGTGGACTTTGTTGGATTC YYKKKSTGISCSGSSSGSSSGSSS TTTGAAAATTTCTTACGCTAATTGGGCTATTTCTGATAAATCTGAAGCTTGT GSSGTSSGSSGSSSGSSSGSSSGS TCTGCTTTGTCTCCAGGTACTACTGCTGTTAATGTTGGTGTTTCTTCTAGAT SGSSSGSSSGSGSASISVVPSNTW GGACTTCTTCTGGTAATATGGTTGCTTCTTACTACAAAAAAAAAGTCCACTG NGGRVNFEIKNTGSVPLCGVV GTATTTCTTGTTCTGGTAGTTCTTCAGGTTCTTCAAGTGGTTCATCTAGTGG FSVSLPSGTTLGGSWNMESAGS TTCTTCCGGTACATCTTCTGGTTCTAGTGGTTCATCTAGTGGTAGTTCTTCC GQYSLPSWVRIEAGKSSKDAGL GGTAGTTCTAGTGGTAGTTCTGGTTCAAGTTCTGGTTCCTCCTCTGGTTCTG TFNGKDKPTAKIVTTKKC (SEQ GTTCTGCATCTATTTCTGTTGTTCCATCTAATACTTGGAATGGTGGTGGTAG ID NO: 53) AGTTAATTTTGAAATTAAGAACACTGGTTCTGTTCCATTGTGTGGTGTTGTT TTTTCTGTTTCTTTGCCATCTGGTACTACTTTGGGTGGTTCTTGGAATATGG AATCTGCTGGTTCTGGTCAATATTCTTTACCATCTTGGGTTAGAATTGAAG CTGGTAAATCTTCTAAAGATGCTGGTTTGACTTTTAATGGTAAAGATAAGC CAACTGCTAAAATTGTTACCACCAAGAAGTGCTTATAAGGCGCGCC (SEQ ID NO: 48) Hypocrea TTAATTAAAATGAACAAGTCTGTTGCTCCATTGTTGTTGGCTGCTTCTATTT MNKSVAPLLLAASILYGGAVAQ jecorina TGTATGGTGGTGCTGTTGCTCAACAAACTGTTTGGGGTCAATGTGGTGGTA QTVWGQCGGIGWSGPTNCAPGS (anamorph: TTGGTTGGTCTGGTCAACTAATTGTGCTCCAGGTTCTGCTTGTTCTACTTT ACSTLNPYYAQCIPGATTITTSTR Trichoderma GAATCCATATTATGCTCAATGTATTCCAGGTGCTACTACTATTACTACTTCT PPSGPTTTTRATSTSSTPPTSSG reesei) Eg2 ACTAGACCACCATCTGGTCCAACAACTACTACTAGAGCTACTTCTACATCT VRGAGVNIAGFDFGCTTDGTCV TCTTCTACTCCACCACTTCATCTGGTGTTAGATTTGCTGGTGTTAACATTG TSKVYPPLKNFTGSNNYPDGIGQ CTGGTTTTGATTTTGGTTGTACTACTGATGGTACTTGTGTTACTTCTAAAGT MQHFVNEDGMTIFRLPVGWQY TTACCCACCATTGAAAAATTTCACTGGTTCTAACAATTATCCAGATGGTAT LVNNNLGGNLDSTSISKYDQLV TGGTCAAATGCAACATTTTGTTAACGAAGATGGTATGACTATTTTTAGATT QGCLSLGAYCIVDIHNYARWNG GCCAGTTGGTTGGCAATATTTGGTTAACAACAATTTGGGTGGTAATTTGGA GIIGQGGPTNAQFTSLWSQLASK TTCTACTTCTATTTCTAAGTACGATCAATTGGTTCAAGGTTGTTTGTCTTTG YASQSRVWFGIMNEPHDVNINT GGTGCTTACTGTATTGTTGATATTCATAATTATGCTAGATGGAATGGTGGT WAATVQEVVTAIRNAGATSQFI ATTATTGGTCAAGGTGGTCCAACAAATGCTCAATTTACTTCTTTGTGGTCA SLPGNDWQSAGAFISDGSAAAL CAATTGGCTTCAAAATATGCTTCTCAATCTAGAGTTTGGTTTGGTATTATG SQVTNPDGSTTNLIFDVHKYLDS AATGAACCACATGATGTTAACATTAATACTTGGGCTGCTACTGTTCAAGAA DNSGTHAECTTNNIDGAFSPLAT GTTGTTACTGCTATTAGAAATGCTGGTGCTACTTCTCAATTCATTTCTTTGC WLRQNNRQAILTETGGGNVQSC CAGGTAATGATTGGCAATCTGCTGGTGCTTTTATTTCTGATGGTTCTGCTGC IQDMCQQIQYLNQNSDVYLGYV TGCTTTGTCTCAAGTTACTAATCCAGATGGTTCTACTAVCTAATTTGATCTTC GWGAGSFDSTYVLTETPTSSGN GATGTTCATAAGTACTTGGATTCTGATAATTCTGGTACTCATGCTGAATGT SWTDTSLVSSCLARK (SEQ ID ACTACAAACAATATTGATGGTGCTTTTTCTCCATTGGCTACTTGGTTGAGA NO: 54) CAAAACAATAGACAAGCTATTTTGACTGAAACTGGTGGTGGTAATGTTCA ATCTTGTATCCAAGATATGTGCCAACAAATTCAATACTTGAACCAAAATTC TGATGTTTATTTGGGTTACGTTGGTTGGGGTGCTGGTTCTTTTGATTCTACT TACGTTTTAACTGAAACTCCAACTTCTTCTGGTAATTCTTGGACTGATACTT CTTTGGTTTCTTCATGTTTGGCTAGAAAGTTATAAGGCGCGCC (SEQ ID NO: 49) Orpinomyces TTAATTAAAATGAAGTTCTTGAACTCTTTGTCTTTGTTGGGTTTGGTTATTG MKFLNSLSLLGLVIAGCEAMRNI sp. PC-2 CTGGTTGTGAAGCTATGAGAAACATTTCTTCTAAAGAATTGGTTAAAGAAT SSKELVKELTIGWSLGNTLDASC CelB TGACTATTGGTTGGTCTTTGGGTAATACTTTGGATGCTTCTTGTGTTGAAAC VETLNYSKDQTASETCWGNVKT TTTGAACTACTCTAAAGATCAAACTGCTTCTGAAACTTGTTGGGGTAATGT TQELYYKLSDLGFNTFRIPTTWS TAAAACTACTCAAGAATTGTACTACAAATTGTCTGATTTGGGTTTCAATAC GHFGDAPDYKISDVWMKRVHE TTTCAGAATACCAACTACTTGGTCTGGTCATTTTGGTGATGCTCCAGATTA VVDYALNTGGYAILNIHHETWN CAAAATTTCTGATGTTTGGATGAAAAGAGTTCACGAAGTTGTTGATTATGC YAFQKNLESAKKILVAIWKQIA TTTGAATACTGGTGGTTACGCTATTTTGAACATTCATCATGAAACTTGGAA AEFGDYHEHLIFEGMNEPRKVG CAAAATTTCTGATGTTTGGATGAAAAGAGTTCACGAAGTTGTTGATTATGC DPAEWTGGDQEGWNFVNEMN TTTGAATACTGGTGGTTACGCTATTTTGAACATTCATCATGAAACTTGGAA ALFVKTIRATGGNNANRHLMIP TTACGCTTTTCAAAAGAATTTGGAATCTGCTAAAAAGATTTTGGTTGCTAT TYAASVNDGSINNFKYPNGDDK TTGGAAACAAATTGCTGCTGAATTTGGTGATTACGATGAACATTTGATTTT VIVSLHSYSPYNFALNNGPGAIS TGAAGGTATGAATGAACCAAGAAAAGTTGGTGATCCAGCTGAATGGACTG NFYDGNEIDWVMNTINSSFISKG GTGGTGATCAAGAAGGTTGGAATTTTGTTAATGAAATGAACGCTTTGTTCG IPVIIGEFVAMNRDNEDDRERW TTAAAACTATTAGAGCTACTGGTGGTAACAATGCTAATAGACATTTGATGA QEYYIKKATALGIPCVIWDNGYF TTCCAACTTATGCTGCTTCTGTTAATGATGGTTCTATTAACAATTTTAAGTA EGEGERFGIIDRKSLNVIFPKLIN CCCAAATGGTGATGATAAAGTTATTGTTTCTTTGCATTCTTACTCTCCATAC GLMKGLGDEKPKTTIRRTTITT AATTTTGCTTTGAACAATGGTCCAGGTGCTATTTCTAATTTCTACGATGGT VQVPTINNECFSTRLGYSCCNG AACGAAATTGATTGGGTTATGAACACTATTAACTCTTCATTCATTTCTAAG FDVLYTDNDGQWGVENGNWC GGTATTCCAGTTATTATTGGTGAATTTGTTGCTATGAACAGAGATAATGAA GIKSSCGNNQRQCWSERLGYPC GATGATAGAGAAAGATGGCAAGAATACTACATTAAAAAGGCTACTGCTTT CQYTTNAEYTDNDGRWGVENG GGGTATTCCATGTGTTATTTGGGATAATGGTTATTTTGAAGGTGAAGGTGA NWCGIY (SEQ ID NO: 55) AAGATTTGGTATTATTGATAGAAAGTCTTTGAACGTTATTTTCCCAAAGTT GATTAATGGTTTGATGAAAGGTTTGGCTGATGAAAAACCAAAAACTACTA TTAGAAGAACTACTACTACTACAGTTCAAGTTCAACCAACTATTAACAACG AATGTTTCTCTACTAGATTGGGTTATTCTTGTTGTAATGGTTTCGATGTTTT GTACACTGATAATGATGGTCAATGGGGTGTTGAAAATGGTAATTGGTGTG GTATTAAATCTTCTTGTGGTAACAATCAAAGACAATGTTGGTCTGAAAGAT TAGGTTATCCATGTTGTCAATACACTACTAATGCTGAATATACAGACAACG ACGGTAGATGGGGTGTAGAAAACGGTAACTGGTGCGGAATATACTTGTAA GGCGCGCC (SEQ ID NO: 50) Irpex TTAATTAAAATGAAGTCTTTGTTGTTGTCTGCTGCTGCTACTTTGGCTTTAT MKSLLSAAATLALSTPAFSVSV lacteus CTACTCCAGCTTTTTCTGTTTCTGTTTGGGGTCAATGTGGTGGTATTGGTTT WGQCGGIGFTGSTTCDAGTSCV En1 TACTGGTTCTACTCTTGTGATGCTGGTACTTCTTGTGTTCATTTGAACGAT HLNDYYFQCQPGAATSTVQPTT TACTACTTTCAATGTCAACCAGGTGCTGCTACTTCTACTGTTCAACCAACT TASSTSSAAAPSSSGNAVCSGTR ACTACTGCTTCTTCTACTTCTTCTGCTGCAGCTCCATCTTCTTCAGGTAATG NKFKFFGVNESGAEFGNNVIPGT CTGTTTGTTCTGGTACTAGAAACAAGTTTAAGTTCTTCGGTGTTAATGAAT LGTDYTWPSPSSIDFFVGKGFNT CTGGTGCTGAATTTGGTAACAATGTTATTCCAGGTACTTTGGGTACTGATT FRVPFLMERLSPPATGLTGPFDS ATACTTGGCCATCTCCATCTTCTATTGATTTTTTCGTTGGTAAGGGTTTTAA TYLQGLKTIVSYITGKGGYALV TACTTTCAGAGTTCCATTTTTGATGGAAAGATTGTCTCCACCTGCTACTGGT DPHNFMIYNGATISDTNAFQTW TTGACTGGTCCATTTGATTCTACTTATTTGCAAGGTTTGAAAACTATTGTTT WQNLAAQFKTDSHVVFDVMNE CTTACATTACTGGTAAAGGTGGTTATGCTTTGGTGATCCACATAACTTTA PHDIPQTVFNLNQAAINRIRAS TGATTTACAACGGTGCTACTATTTCTGATACTAATGCTTTTCAAACTTGGTG GATSQSILVEGTSYTGAWTWIT GCAAAATTTGGCTGCTCAATTTAAGACTGATTCTCATGTTGTTTTCGATGTT TSGNSQVFGAIHDPNNNVAIEM ATGAATGAACCACATGATATTCCAGCTCAAACTGTTTTTAACTTGAACCAA HQYLDSDGSGTSPTCVSPTIGAE GCTGCTATTAATAGAATTAGAGCTTCTGGTGCTACTTCTCAATCTATTTTGG RLQAATQWLQQNNLKGFLGEIG TTGAAGGTACTTCTTATACTGGTGCTTGGACTTGGACTACTACTTCTGGTA AGSNADCISAVQGALCEMQQSD ATTCTCAAGTTTTTGGTGCTATTCATGATCCAAACAACAATGTTGCTATTG VWLGALWWAAGPWWGDYFQS AAATGCATCAATACTTGGATTCTGATGGTTCTGGTACTTCTCCAACTTGTG IEPPSGVAVSSILPQALEPFL (SEQ TTTCTCCAACTATTGGTGCTGAAAGATTGCAAGCTGCTACTCAATGGTTGC ID NO: 56) AACAAAACAATTTGAAAGGTTTCTTGGGTGAAATTGGTGCTGGTTCTAATG CTGATTGTATTTCTGCTGTTCAAGGTGCTTTGTGTGAAATGCAACAATCTG CTGTTTGGTTGGGTGCTTTGTGGTGGGCTGCTGGTCCATGGTGGGGTGATT ATTTTCAATCTATTGAACCACCATCTGGTGTTGCTGTTTCTTCTATTTTGCC ACAAGCTTTGGAACCATTTTTGTTATAAGGCGCGCC (SEQ ID NO: 51) β-Glucosidases S.f. BGL1 ATGGTCTCCTTCACCTCCCTCCTCGCCGGCGTCGCCGCCATCTCGGGCGTC FJ028723 TTGGCCGCTCCCGCCGCCGAGGTCGAATCCGTGGCTGTGGAGAAGCGCTC MVSFTSLLAGVAAISGVLAAPA GGACTCCGCGAGTCCCAATTCAAAACTATACCCAGTCTCCATCCCAGAGAG AEVESVAVEKRSDSRVPIQNYT ATGAGAGCTCCCAATGGGTGAGCCCGCATTATTATCCAACTCCACAAGGT QSPSQRDESSQWVSPHYYPTPQ GGTAGGCTCCAAGACGTCTGGCAAGAAGCATATGCTAGAGCAAAAGCCAT GGRLQDVWQEAYARAKAIVGQ CGTTGGCCAGATGACTATTGTTGAAAAGGTCAATTTGACCACTGGTACCGG MTIVEKVNLTTGTGWQLDPCVG TTGGCAATAGATCCATGTGTTGGTAATACCGGTTCTGTTCCAAGATTCGG NTGSVPRFGIPNLCLQDGPLGVR CATCCCAAACCTTTGCCTACAAGATGGGCCATTGGGTGTTCGATTCGCTGA FADVFTGYPSGLATGATFNKDL CTTTGTTACTGGCTATCCATCCGGTCTTGCTACTGGTGCAACGTTCAATAA FLQRGQALGHEFNSKGVHIALG GGATTTGTTTCTTCAAAGAGGTCAAGCTCTCGGTCATGAGTTCAACAGCAA PAVGPLGVKARGGRNFEARGSD AGGTGTACATATTGCGTTGGGCCCTGCTGTTGGCCCACTTGGTGTCAAAGC PYLQGTAAAATIKGLQENNVMA CAGAGGTGGCAGAAATTTCGAAGCCTTTGCTTTCCCTACCCATATCTCCAAG CVKHFIGNEQEKYRQPDDINPAT GTACTGCTGCTGCTGCAACCATCAAAGCTCTCCAAGAGAATAATGTTATG NQTTKEAISANIPDRAMHELYL GCTTGTGTCAAGCACTTTATTGGTAACCAACAAGAAAAGTACAGACAGCC WPFADSVRAGVGSVMCSYNRV AGATGACATAAACCCTGCCACCAACCAAACTACTAAAGAAGCTATTAGTG NNTYACENSYMMNHLLKEELG CCAACATTCCAGACAGAGCCATGCATGAGTTGTACTTGTGGCCATTTGCCG FQGFVVSDWGAQLSGVSAISG ATTCGGTTCGAGCAGGTGTTGGTTCTGTTATGTGCTCTTATAACAGAGTC LDMSMPGEVYGGWNTGTSFWG ACAACACTTACGCTTGCGAAAACTCTTACATGATGAACCACTTGCTTAAAG QNLTKAIYNETVPIERLDDMATR AAGAGTTGGGTTTTCAAGGCTTTGTTGTTTCGGACTGGGGTGCACAATTAA ILAALYATNSFPTEDHLPNFSSW GTGGGGTTTATAGCGCTATCTCGGGCTTAGATATGTCTATGCCTGGTGAAG TTKEYGNKYYADNTTEIVKVNY TGTATGGGGGATGGAACACCGGCACGTCTTTCTGGGGTCAAAACTTGACG HVDPSNDFTEDTALKVAEESIVL AAAGCTATTTACAATGAGACTGTTCCGATTGAAAGATTAGATGATATGGC LKNENNTLPISPEKAKRLLLSGIA AACCAGGATCTTGGCTGCTTTGTATGCTACCAATAGTTTCCCAACAGAAGA AGPDPIGYQCEDQSCTNGALFQ TCACCTTCCAAATTTTTCTTCATGGACAACGAAAGAATATGGCAATAAATA GWGSGSVGSPKYQVTPFEEISYL TTATGCTGACAACACTACCGAGATTGTCAAAGTCAACTACCATGTGGACCC ARKNKMQFDYIRESYDLAQVTK ATCAAATGACTTTACGGAGGACACAGCTTTGAAGGTTGCTGAGGAATCTA VASDAHLSIVVVSAASGEGYITV TTGTGCTTTTAAAAAATGAAAACAACACTTTGCCAATTTCTCCCGAAAAGG DGNQGDRRNLTLWNNGDKLIET CTAAAAGATTACTATTGTCGGGTATTGCTGCAGGCCCTGATCCGATAGGTT VAENCANTVVVVTSTGQINFEG ATCAGTGTGAAGATCAATCTTGCACAAATGGCGCTTGTTTCAAGGTTGGG FADHPNVTAIVWAGPLGDRSGT GTTCTGGCAGTGTTGGTTCTCCAAAATATCAAGTCACTCCATTTGAGGAAA AIANILFGKANPSGHLPFTIAKTD TTTCTTATCTTGCAAGAAAAACAAGATGCAATTTGATTATATTCGGGAGT DDYIPIETYSPSSGEPEDNHLVEN CTTACGACTTAGCTCAAGTTACTAAAGTAGCTTCCGATGCTTCATTTGTCTA DLLVDYRYFEEKNIEPRYAFGY TAGTTGTTGTCTCTGCTGCAAGCGGTGAGGGTTATATAACCGTTGACGGTA GLSYNEYEVSNAKVSAAKKVDE ACCAAGGTGACAGAAGAAATCTCACTTTTGGAACAACGGTGATAAATTG ELPEPATYLSEFSYQNAKDSKNP ATTGAAACAGTTGCTGAAAACTGTGCCAATACTGTTGTTGTTGTTACTTCT SDAFAPTDLNRVNEYLYPYLDS ACTGGTCAAATTAATTTTGAAGGCTTTGCTGATCACCCAAATGTTACCGCA NVTLKDGNYEYPDGYSTEQRTT ATTGTCTGGGCCGGCCCATTAGGTGACAGATCCGGGACTGCTATCGCCAAT PIQPGGGLGGNDALWEVAYKVE ATTCTTTTTGGTAAAGCGAACCCATCAGGTCATCTTCCATTCACTATTGCTA VDVQNLGNSTDKFVPQLYLKHP AGACTGACGATGATTACATTCCAATTGAAACCTACAGTCCATCGAGTGGT EDGKFETPIQLRGFEKVELSPGE GAACCTGAAGACAACCACTTGGTTGAAAATGACTTGCTTGTTGACTATAG KKTVEFELLRRDLSVWDTTRQS ATATTTTGAAGAGAAGAATATTGAGCCAAGATACGCATTTGGTTATGGCTT WIVESGTYEALIGVAVNDIKTSV GTCTTACAATGAGTATGAAGTTAGCAATGCAAAGGTCTCGGCAGCCAAAA LFTI (SEQ ID NO: 40) AAGTTGATGAGGAGTTGCCTGAACCAGCTACCTACTTATCGGAGTTTAGCT ATCAAAATGCAAAAGACAGCAAAAATCCAAGTGATGCTTTTGCTCCAACA GATTTAAACAGAGTTAATGAGTACCTTTATCCATATTTAGATAGCAATGTT ACCTTAAAAGACGGAAACTATGAGTATCCCGATGGCTACAGCACTGAGCA AAGAACAACACCTATCCAACCTGGGGGCGGCTTGGGAGGCAACGATGCTT TGTGGGAGGTCGCTTATAAAGTTGAAGTGGACGTTCAAAACTTGGGTAAC TCCACTGATAAGTTTGTTCCACAGTTGTATTTGAAACACCCTGAGGATGGC AAGTTTGAAACCCCTATTCAATTGAGAGGGTTTGAAAAGGTTGAGTTGTCC CCGGGTGAGAAGAAGACAGTTGAGTTTGAGCTTTTGAGAAGAGATCTTAG TGTGTGGGATACCACCAGACAGTCTTGGATCGTTGAATCTGGTACTTATGA GGCCTTAATTGGTGTTGCTGTTAATGATATCAAGACATCTGTCCTGTTTACT ATT (SEQ ID NO: 20) - In certain aspects of the invention, the polypeptides and polynucleotides of the present invention are provided in an isolated form, e.g., purified to homogeneity.
- The present invention also encompasses polypeptides which comprise, or alternatively consist of, an amino acid sequence which is at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% similar to the polypeptide of any of SEQ ID NOs: 21-40, 46, or 52-56 and to portions of such polypeptide with such portion of the polypeptide generally containing at least 30 amino acids and more preferably at least 50 amino acids.
- As known in the art “similarity” between two polypeptides is determined by comparing the amino acid sequence and conserved amino acid substitutes thereto of the polypeptide to the sequence of a second polypeptide.
- The present invention further relates to a domain, fragment, variant, derivative, or analog of the polypeptide of any of SEQ ID NOs: 21-40, 46, or 52-56.
- Fragments or portions of the polypeptides of the present invention may be employed for producing the corresponding full-length polypeptide by peptide synthesis.
- Therefore, the fragments may be employed as intermediates for producing the full-length polypeptides.
- Fragments of cellobiohydrolase, endoglucanase or beta-glucosidase polypeptides encompass domains, proteolytic fragments, deletion fragments and in particular, fragments of H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walked, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigants, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptides which retain any specific biological activity of the cellobiohydrolase, endoglucanase or beta-glucosidase proteins. Polypeptide fragments further include any portion of the polypeptide which retains a catalytic activity of cellobiohydrolase, endoglucanase or beta-glucosidase proteins.
- The variant, derivative or analog of the polypeptide of any of SEQ ID NOs: 21-40, 46, or 52-56, may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the mature polypeptide for purification of the polypeptide or (v) one in which a fragment of the polypeptide is soluble, i.e., not membrane bound, yet still binds ligands to the membrane bound receptor, Such variants, derivatives and analogs are deemed to be within the scope of those skilled in the art from the teachings herein.
- The polypeptides of the present invention further include variants of the polypeptides. A “variant” of the polypeptide can be a conservative variant, or an allelic variant. As used herein, a conservative variant refers to alterations in the amino acid sequence that do not adversely affect the biological functions of the protein, A substitution, insertion or deletion is said to adversely affect the protein when the altered sequence prevents or disrupts a biological function associated with the protein. For example, the overall charge, structure or hydrophobic-hydrophilic properties of the protein can be altered without adversely affecting a biological activity. Accordingly, the amino acid sequence can be altered, for example to render the peptide more hydrophobic or hydrophilic, without adversely affecting the biological activities of the protein.
- By an “allelic variant” is intended alternate forms of a gene occupying a given focus on a chromosome of an organism. Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced rising art-known mutagenesis techniques. Allelic variants, though possessing a slightly different amino acid sequence than those recited above, will still have the same or similar biological functions associated with the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase protein.
- The allelic variants, the conservative substitution variants, and members of the endoglucanase, cellobiohydrolase or β-glucosidase protein families, can have an amino acid sequence having at least 75%, at least 80%, at least 90%, at least 95% amino add sequence identity with a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walked, S. fibuligera, C. lucknowense, R. speratus, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, R. flavipes, or Neosartorya fischeri cellobiohydrolase, endoglucanase or beta-glucosidase amino acid sequence set forth in any one of SEQ ID NOs: 21-40, 46, or 52-56. Identity or homology with respect to such sequences is defined herein as tire percentage of amino acid residues in the candidate sequence that are identical with the known peptides, alter aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. N-terminal, C-terminal or internal extensions, deletions, or insertions into the peptide sequence shall not be construed as affecting homology.
- Thus, the proteins and peptides of the present invention include molecules comprising the amino acid sequence of SEQ ID NOs: 21-40, 46 and 52-56 or fragments thereof having a consecutive sequence of at least about 3, 4, 5, 6, 10, 15, 20, 25, 30, 35 or more amino acid residues of the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, R. flavipes, or Neosartorya fischeri cellobiohydrolase, endoglucanase or beta-glucosidase polypeptide sequences; amino acid sequence variants of such sequences wherein at least one amino acid residue has been inserted N- or C-terminal to, or within, the disclosed sequence; amino acid sequence variants of the disclosed sequences, or their fragments as defined above, that have been substituted by another residue. Contemplated variants further include those containing predetermined mutations by, e.g., homologous recombination, site-directed or PCR mutagenesis, and the corresponding proteins of other animal species, including but not limited to bacterial, fungal, insect, rabbit, rat, porcine, bovine, ovine, equine and non-human primate species, the alleles or other naturally occurring variants of the family of proteins; and derivatives wherein the protein has been covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid (for example, a detectable moiety such as an enzyme or radioisotope).
- Using known methods of protein engineering and recombinant DNA technology, variants may be generated to improve or alter the characteristics of the cellulase polypeptides. For instance, one or more amino acids can be deleted from the N-terminus or C-terminus of the secreted protein without substantial loss of biological function.
- Thus, the invention further includes H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptide variants which show substantial biological activity. Such variants include deletions, insertions, inversions, repeats, and substitutions selected according to general rules known in the art so as have little effect on activity.
- The skilled artisan is fully aware of amino acid substitutions that are cither less likely or not likely to significantly effect protein function replacing one aliphatic amino acid with a second aliphatic amino acid), as further described below.
- For example, guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie et al., “Deciphering the Message in Protein Sequences: Tolerance to Amino Add Substitutions,” Science 247:1306-1310 (1990), wherein the authors indicate that there are two main strategies for studying the tolerance of an amino acid sequence to change.
- The first strategy exploits the tolerance of amino acid substitutions by natural selection during the process of evolution. By comparing amino acid sequences in different species, conserved amino acids can be identified. These conserved amino acids are likely important for protein function. In contrast, the amino acid positions where substitutions have been tolerated by natural selection indicates that these positions are not critical for protein function. Thus, positions tolerating amino acid substitution could be modified while still maintaining biological activity of the protein.
- The second strategy uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene to identify regions critical for protein function. For example, site directed mutagenesis or alanine-scanning mutagenesis (introduction of single alanine mutations at every residue in the molecule) can be used. (Cunningham and Wells, Science 244:1081-1085 (1989).) The resulting mutant molecules can then be tested for biological activity.
- As the authors state, these two strategies have revealed that proteins are often surprisingly tolerant of amino acid substitutions. The authors further indicate which amino acid changes are likely to be permissive at certain amino acid positions in the protein. For example, most buried (within the tertiary structure of the protein) amino acid residues require nonpolar side chains, whereas few features of surface side chains are generally conserved. Moreover, tolerated conservative amino acid substitutions involve replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and lie; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gin, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Tip, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly.
- The terms “derivative” and “analog” refer to a polypeptide differing from the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptide, but retaining essential properties thereof. Generally, derivatives and analogs are overall closely similar, and, in many regions, identical to the H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptides. The terms “derivative” and “analog” when referring to H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya, fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptides include any polypeptides which retain at least some of the activity of the corresponding native polypeptide, e.g., the exoglucanase activity, or the activity of the catalytic domain.
- Derivatives of H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridium thermocellum, Clostridium cellulolyticum, Clostridium josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigants, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptides, are polypeptides which have been altered so as to exhibit additional features not found on the native polypeptide. Derivatives can be covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid (for example, a detectable moiety such as an enzyme or radioisotope). Examples of derivatives include fusion proteins.
- An analog is another form of a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense, R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigants, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellobiohydrolase, endoglucanase or beta-glucosidase polypeptide of the present invention. An “analog” also retains substantially the same biological function or activity as the polypeptide of interest, e.g., functions as a cellobiohydrolase. An analog includes a proprotein which can be activated by cleavage of the proprotein portion to produce an active mature polypeptide.
- The polypeptide of the present invention may be a recombinant polypeptide, a natural polypeptide or a synthetic polypeptide. In some particular embodiments, the polypeptide is a recombinant polypeptide.
- Also provided in the present invention are allelic variants, orthologs, and/or species homologs. Procedures known in the art can be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any of SEQ ID NOs: 1-40, using information from the sequences disclosed herein or the clones deposited with the ATCC. For example, allelic variants and/or species homologs may be isolated and identified by making suitable probes or primers from the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homologue.
- In some embodiments of the present invention, the host cells express at least one heterologous cellulase that is not derived from any one particular organism, but instead has an artificial amino acid sequence that is a consensus cellulase sequence. The consensus cellulase sequence can be an endoglucanase consensus sequence, a β-glucosidase consensus sequence, or a cellobiohydrolase consensus sequence.
- In one particular embodiment, the heterologous cellulase is a CBH1 consensus sequence. Therefore, in one embodiment, the invention is directed to a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98% or 99% identical to the consensus CBH1 sequence of SEQ ID NO: 43. In some embodiments, the invention is directed to a polypeptide which comprises the sequence of SEQ ID NO: 43.
- The invention is also directed to host cells that comprise a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98% 99% or 100% identical to the consensus CBH1 sequence of SEQ ID NO: 43. The invention further directed to host cells that comprise a polynucleotide that encodes a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98% 99% or 100% identical to the consensus CBH1 sequence of SEQ ID NO: 43. In some embodiments the host cell comprises at least one polynucleotide that encodes a polypeptide sequence which comprises a sequence that is at least. 80%, 85%, 90%, 95%, 98%, 99% or 10098 identical to the consensus CBH1 sequence of SEQ ID NO: 43 and at least a second polynucleotide that encodes a heterologous cellulase. The second polynucleotide can encode a endoglucanase, a β-glucosidase, a cellobiohydrolase, an endoglucanase consensus sequence, a β-glucosidase consensus sequence, or a cellobiohydrolase consensus sequence. In some embodiments the host cell comprising the polynucleotide that encodes a polypeptide sequence which comprises a sequence that is at least 80%, 85%, 90%, 95%, 98%, 99%, or 100% identical to the consensus CBH1 sequence of SEQ ID NO: 43 is capable of producing ethanol when grown using cellulose as a carbon source.
- In some embodiments of the present invention the host cells express a combination of heterologous cellulases. For example, the host cell can contain at least two heterologous cellulases, at least three heterologous cellulases, at least four heterologous cellulases, at least five heterologous cellulases, at least six heterologous cellulases, at least seven heterologous cellulases, at least eight heterologous cellulases, at least nine heterologous cellulases, at least ten heterologous cellulases, at least eleven heterologous cellulases, at least twelve heterologous cellulases, at least thirteen heterologous cellulases, at least fourteen heterologous cellulases or at least fifteen heterologous cellulases. The heterologous cellulases in the host cell can be from the same or from different species.
- In some embodiments of the present invention, the host cells express a combination of heterologous cellulases which includes at least, one endoglucanase, at least one β-glucosidase and at least one cellobiohydrolase. In another embodiment of the invention, the host cells express a combination of heterologous cellulases which includes at least one endoglucanase, at least one β-glucosidase and at least two cellobiohydrolases.
- The at least two cellobiohydrolases can be both be cellobiohydrolase I, can both be cellobiohydrolase II, or can be one cellobiohydrolase I and one cellobiohydrolase II.
- In one particular embodiment of the invention, the host cells express a combination of cellulases that includes a C. formosanus endoglucanase I and an S. fibuligera β-glucosidase I. In another embodiment of the invention, the host ceils express a combination of cellulases that includes a T. emersonii cellobiohydrolase I, and a T. reesei cellobiohydrolase II.
- In yet another embodiment the host cells express a combination of cellulases that includes a C. formosanus endoglucanase I, an S. fibuligera β-glucosidase I, a T. emersonii cellobiohydrolase I, and a C. lucknowense cellobiohydrolase IIb. In still another embodiment, the host cells express a combination of cellulases that includes a C. formosanus endoglucanase I, an S. fibuligera β-glucosidase I, a T. emersonii cellobiohydrolase I, and a T. reesei cellobiohydrolase II. In still another embodiment, the host cells express a combination of cellulases that includes an
H. jecorina endoglucanase 2, an S. fibuligera β-glucosidase I, a T. emersonii cellobiohydrolase I, and a T. reesei cellobiohydrolase II. In still another embodiment, the host cells express a combination of cellulases that includes anH. jecorina endoglucanase 2, an S. fibuligera β-glucosidase I, a T. emersonii cellobiohydrolase I, and a C. lucknowense cellobiohydrolase II. - According to the present invention, the cellulases may be either tethered or secreted. As used herein, a protein is “tethered” to an organism's cell surface if at least one terminus of the protein is bound, covalently and/or electrostatically for example, to the cell membrane or cell wall. It will be appreciated that a tethered protein may include one or more enzymatic regions that may be joined to one or more other types of regions at the nucleic acid and/or protein levels (e.g., a promoter, a terminator, an anchoring domain, a linker, a signaling region, etc.). While the one or more enzymatic regions may not be directly bound to the ceil membrane or cell wall (e.g., such as when binding occurs via an anchoring domain), the protein is nonetheless considered a “tethered enzyme” according to the present specification.
- Tethering may, for example, be accomplished by incorporation of an anchoring domain into a recombinant protein that is heterologously expressed by a cell, or by prenylation, Tatty acyl linkage, glycosyl phosphatidyl inositol anchors or oilier suitable molecular anchors which may anchor the tethered protein to the cell membrane or cell wall of the host cell. A tethered protein maybe tethered at its amino terminal end or optionally at its carboxy terminal end.
- As used herein, “secreted” means released into the extracellular milieu, for example into the media. Although tethered proteins may have secretion signals as part of their immature amino acid sequence, they are maintained as attached to the cell surface, and do not fall within the scope of secreted proteins as used herein.
- As used herein, “flexible linker sequence” refers to an amino acid sequence which links two amino acid sequences, for example, a cell wall anchoring amino acid sequence with an amino acid sequence that contains the desired enzymatic activity. The flexible linker sequence allows for necessary freedom for the amino acid sequence that contains the desired enzymatic activity to have reduced steric hindrance with respect to proximity to the ceil and may also facilitate proper folding of the amino acid sequence that contains the desired enzymatic activity.
- In some embodiments of the present invention, the tethered cellulase enzymes are tethered by a flexible linker sequence linked to an anchoring domain. In some embodiments, the anchoring domain is of CWP2 (for carboxy terminal anchoring) or FLO1 (for amino terminal anchoring) from S. cerevisiae.
- In some embodiments, heterologous secretion signals may be added to the expression vectors of the present invention to facilitate the extra-cellular expression of cellulase proteins. In score embodiments, the heterologous secretion signal is the secretion signal from T. reesei Xyn2.
- The present invention also encompasses fusion proteins. For example, the fusion proteins can be a fusion of a heterologous cellulase and a second peptide. The heterologous cellulase and the second peptide can be fused, directly or indirectly, for example, through a linker sequence. The fusion protein can comprise for example, a second peptide that is N-terminal to the heterologous cellulase and/or a second peptide that is C-terminal to the heterologous cellulase. Thus, in certain embodiments, the polypeptide of the present invention comprises a first, polypeptide and a second polypeptide, wherein the first polypeptide comprises a heterologous cellulase.
- According to the present invention, the fusion protein can comprise a first and second polypeptide wherein the first polypeptide comprises a heterologous cellulase and Ore second polypeptide comprises a signal sequence. According to another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous cellulase and the second polypeptide comprises a polypeptide used to facilitate purification or identification or a reporter peptide. The polypeptide used to facilitate purification or identification or the reporter peptide can be, for example, a HIS-tag, a GST-tag, an HA-tag, a FLAG-tag, a MYC-tag, or a fluorescent protein.
- According to yet another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first, polypeptide comprises a heterologous cellulase and the second polypeptide comprises an anchoring peptide. In some embodiments, the anchoring domain is of CWP2 (for carboxy terminal anchoring) or FLO1 (for amino terminal anchoring) from S. cerevisiae.
- According to yet another embodiment, the fusion protein can comprise a first and second polypeptide, wherein the first polypeptide comprises a heterologous cellulase and the second polypeptide comprises a cellulose binding module (CBM). In some embodiments, the CBM is from, for example, T. reesei Cbh1 or Cbh2, from H. grisea Cbh1, or from C. lucknowense Cbh2b. In some particular embodiments, the CBM is fused to a cellobiohydrolase. In one particular embodiment, the fusion protein comprises a first and second polypeptide, wherein the first polypeptide comprises a heterologous cellobiohydrolase and the second polypeptide comprises a CBM. In yet another particular embodiment, the cellobiohydrolase is T. emersonii cellobiohydrolase I and the CBM is a T. reesei cellobiohydrolase CBM. In yet another particular embodiment, the cellobiohydrolase is T. emersonii cellobiohydrolase I and the CBM is a H. grisea cellobiohydrolase CBM, In some embodiments, the CBM of H. grisea comprises amino acids 492-525 of SEQ ID NO: 21.
- In certain embodiments, the polypeptide of the present invention encompasses a fusion protein comprising a first polypeptide and a second polypeptide, wherein the first polypeptide is a cellobiohydrolase, and the second polypeptide is a domain or fragment of a cellobiohydrolase. In certain embodiments, the polypeptide of the present invention encompasses a fusion protein comprising a first polypeptide, where the first polypeptide is a T. emersonii Cbh1, H. grisea Cbh1, T. aurantiancusi Cbh1, T. emersonii Cbh2, T. reesei Cbh1 T. reesei Cbh2, C. lucknowense Cbh2b, or domain, fragment, variant, or derivative thereof, and a second polypeptide, where the second polypeptide is a T. emersonii Cbh1, H. grisea Cbh1, or T. aurantiancusi Cbh1, T. emersonii Cbh2, T. reesei Cbh1 or T. reesei Cbh2, C. lucknowense Cbh2b, or domain, fragment, variant, or derivative thereof. In particular embodiments the first polypeptide is T. emersonii Cbh1 and the second polynucleotide is a CBM from T. reesei Cbh1 or Cbh2 or from C. lucknowense Cbh2b. In additional embodiments, the first polypeptide is either N-terminal or C-terminal to the second polypeptide. In certain other embodiments, the first polypeptide and/or the second polypeptide are encoded by codon-optimized polynucleotides, for example, polynucleotides codon-optimized for S. cerevisiae or Kluyveromyces. In particular embodiments, the first polynucleotide is a codon-optimized T. emersonii cbh1 and the second polynucleotide encodes for a codon-optimized CBM from T. reesei Cbh1 or Cbh2. In another particular embodiments, the first polynucleotide is a codon-optimized T. emersonii cbh1 and the second polynucleotide encodes for a codon-optimized CBM from C. lucknowense or Cbh2b.
- In certain other embodiments, the first polypeptide and the second polypeptide are fused via a linker sequence. The linker sequence can, in some embodiments, be encoded by a codon-optimized polynucleotide. (Codon-optimized polynucleotides are described in more detail below.) An amino acid sequence corresponding to a codon-optimized
linker 1 according to the invention is a flexible linker-strep tag-TEV site-FLAG-flexible linker fusion and corresponds to GGGGSGGGGS AWHPQFGG ENLYFQG DYKDDDK GGGGSGGGGS (SEQ ID NO:57) - The DNA sequence is as follows:
-
(SEQ ID NO: 41) GGAGGAGGTGGTTCAGGAGGTGGTGGGTCTGCTTGGCAT CCACAATTTGGAGGAGGCGGTGGTGAAAATCTGTATTTC CAGGGAGGCGGAGGTGATTACAAGGATGACGACAAAGG AGGTGGTGGATCAGGAGGTGGTGGCTCC - An amino acid sequence corresponding to optimized
linker 2 is a flexible linker-strep tag-linker-TEV site-flexible linker and corresponds to GGGGSGGGGS WSHPQFEK GG ENLYFQG GGGGSGGGGS (SEQ ID NO:58), The DNA sequence is as follows: -
(SEQ ID NO: 42) ggtggcggtggatctggaggaggcggttcttggtctcacccacaatttg aaaagggtggagaaaacttgtactttcaaggcggtggtggaggttctgg cggaggtggctccggctca - The present invention is also directed to co-cultures comprising at least two yeast host cells wherein the at least two yeast host ceils each comprise an isolated polynucleotide encoding a heterologous cellulase. As used herein, “co-culture” refers to growing two different strains or species of host cells together in the same vessel. In some embodiments of the invention, at least, one host cell of the co-culture comprises a heterologous polynucleotide comprising a nucleic acid which encodes an endoglucanase, at least one host cell of the co-culture comprises a heterologous polynucleotide comprising a nucleic acid which encodes a β-glucosidase and at least one host cell comprises a heterologous polynucleotide comprising a nucleic acid which encodes a cellobiohydrolase. In a further embodiment, the co-culture further comprises a host cell comprising a heterologous polynucleotide comprising a nucleic acid which encodes a second cellobiohydrolase.
- The co-culture can comprise two or more strains of yeast host cells and the heterologous cellulases can be expressed in any combination in the two or more strains of host cells. For example, according to the present invention, the co-culture can comprise two strains: one strain of host cells that expresses an endoglucanase and a second strain of host: cells that expresses a β-glucosidase, a cellobiohydrolase and a second cellobiohydrolase. According to the present invention, the co-culture can also comprise four strains: one strain of host cells which expresses an endoglucanase, one strain of host cells that expresses a β-glucosidase, one strain of host cells which expresses a first cellobiohydrolase, and one strain of host cells which expresses a second cellobiohydrolase. Similarly, the co-culture can comprise one strain of host cells that expresses two celluloses, for example an endoglucanase and a beta-glucosidase and a second strain of host cells that expresses one or more celluloses, for example one or more cellobiohydrolases. The co-culture can, in addition to the at least two host cells comprising heterologous cellulases, also include other host cells which do not comprise heterologous cellulases.
- The various host cell strains in the co-culture can be present in equal numbers, or one strain or species of host cell can significantly outnumber another second strain or species of host cells. For example, in a co-culture comprising two strains or species of host cells the ratio of one host cell to another can be about 1:1, 1:2, 1:3, 1:4, 1:5, 1:10, 1:100, 1:500 or 1:1000. Similarly, in a co-culture comprising three or more strains or species of host ceils, the strains or species of host cells may be present in equal or unequal numbers.
- The co-cultures of the present invention can include tethered cellulases, secreted cellulases or both tethered and secreted cellulases. For example, in some embodiments of the invention, the co-culture comprises at least one yeast host cell comprising a polynucleotide encoding a secreted heterologous cellulase. In another embodiment, the co-culture comprises at least one yeast host cell comprising a polynucleotide encoding a tethered heterologous cellulase. In one embodiment, all of the heterologous cellulases in tire co-culture are secreted, and in another embodiment, all of the heterologous cellulases in the co-culture are tethered. In addition, other cellulases, such as externally added cellulases may be present in the co-culture.
- The present invention also includes isolated polynucleotides encoding cellulases of the present invention. Thus, the polynucleotides of tire invention can encode endoglucanases or exoglucanases. The polynucleotides can encode endoglucanases, β-glucosidases or cellobiohydrolases.
- In some particular embodiments of the invention, the polynucleotide encodes an endoglucanase which is an endo-1,4-β-glucanase. In particular embodiments, the polynucleotide encodes an endoglucanase I from Trichoderma reesei. In certain other embodiments, the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:19. In particular embodiments, the polynucleotide encodes an endoglucanase I from C. formosanus. In certain other embodiments, the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NOTE In particular embodiments, the polynucleotide encodes an endoglucanase I from Trichoderma reesei. In certain other embodiments, the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO: 19. In particular embodiments, the polynucleotide encodes an
endoglucanase 2 from H. jecorina. In certain other embodiments, the endoglucanase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:54. - In certain embodiments, the polynucleotide encodes a β-glucosidase I or a β-glucosidase II isoform, paralogue or orthologue. In certain embodiments of the present invention the polynucleotide encodes a β-glucosidase derived from Saccharomycopsis fibuligera. In particular embodiments, the β-glucosidase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:20.
- In certain embodiments of the invention, the polynucleotide encodes a
cellobiohydrolase 1 and/or an cellobiohydrolase II isoform, paralogue or orthologue. In particular embodiments of the present invention, the polynucleotide encodes the cellobiohydrolase I or II from Trichoderma reesei. In particular embodiments of the present invention, the polynucleotide encodes the cellobiohydrolase I or II from Trichoderma emersonii. In another embodiment, the cellobiohydrolase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:7 or SEQ ID NO:8. In particular embodiments of the present invention, the polynucleotide encodes a cellobiohydrolase from C. lucknowense. In another embodiment, the cellobiohydrolase is encoded by a polynucleotide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to SEQ ID NO:5. - In further embodiments the polynucleotide is a polypeptide comprising a sequence at least about 70, about 80, about 90, about 95, about 96, about 97, about 98, about 99, or 100% identical to a nucleotide sequence listed in Table 1. In certain aspects the polynucleotide can encode an endoglucanase, cellobiohydrolase or β-glucosidase derived from, for example, a fungal, bacterial, protozoan or termite source.
- In certain aspects, the present invention relates to a polynucleotide comprising a nucleic acid encoding a functional or structural domain of T. emersonii, H. grisea, T. aurantiacus, C. lucknowense or T. reesei Cbh1 or Cbh2. For example, the domains of
T. reesei Cbh 1 include, without limitation; (1) a signal sequence,front amino acid 1 to 33 of SEQ ID NO: 27; (2) a catalytic domain (CD) from about amino acid 41 to about amino acid 465 of SEQ ID NO: 27; and (3) a cellulose binding module (CBM) from about amino acid 503 to about amino acid 535 of SEQ ID NO: 27. The domains ofT. reesei Cbh 2 include, without limitation: (1) a signal sequence, fromamino acid 1 to 33 of SEQ ID NO: 27; (2) a catalytic domain (CD) from about amino acid 145 to about amino acid 458 of SEQ ID NO: 27; and (3) a cellulose binding module (CBM) from about amino acid 52 to about amino acid 83 of SEQ ID NO: 27. - The present invention also encompasses an isolated polynucleotide comprising a nucleic acid that is at least about 70%, 75%, or 80% identical, at least about 90% to about 95% identical, or at least about 96%, 97%, 98%, 99% or 100% identical to a nucleic acid encoding a T. emersonii, H. grisea, T. aurantiacus, C. lucknowense or T. reesei Cbh1 or Cbh2 domain, as described above.
- The present invention also encompasses variants of the cellulase genes, as described above. Variants may contain alterations in the coding regions, non-coding regions, or both. Examples are polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In certain embodiments, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. In further embodiments, H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteous, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinerisis, N. walkeri, S. fibuligera, C. lucknowense R. speratus, Thermobifida fischeri, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes, and Arabidopsis thaliana cellulase polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host. Codon-optimized polynucleotides of the present invention are discussed further below.
- The present invention also encompasses an isolated polynucleotide encoding a fusion protein. In certain embodiments, the nucleic acid encoding a fusion protein comprises a first polynucleotide encoding for a T. emersonii chh1, H. grisea cbh1, T. aurantiacus cbh1 or T. emersonii cbh1 and a second polynucleotide encoding for the CBM domain of T. reesei cbh1 or T. reesei cbh2 or C. lucknowense cbh2b. In particular embodiments of the nucleic, acid encoding a fusion protein, the first polynucleotide encodes T. emersonii cbh1 and the second polynucleotide encodes for a CBM from T. reesei Cbh1 or Cbh2.
- In further embodiments, the first and second polynucleotides are in the same orientation, or the second polynucleotide is in the reverse orientation of the first polynucleotide. In additional embodiments, the first polynucleotide encodes a polypeptide that is either N-terminal or C-terminal to the polypeptide encoded by the second polynucleotide. In certain other embodiments, the first polynucleotide and/or the second polynucleotide are encoded by codon-optimized polynucleotides, for example, polynucleotides codon-optimized for S. cerevisiae, Kluyveromyces or for both S. cerevisiae and Kluyveromyces. In particular embodiments of the nucleic acid encoding a fusion protein, the first polynucleotide is a codon-optimized T. emersonii cbh1 and the second polynucleotide encodes for a codon-optimized CBM from T. reesei Cbh1 or Cbh2.
- Also provided in the present invention are allelic variants, orthologs, and/or species homologs. Procedures known in the art can be used to obtain full-length genes, allelic variants, splice variants, full-length coding portions, orthologs, and/or species homologs of genes corresponding to any of SEQ ID NOs: 1-20, using information from the sequences disclosed herein or the clones deposited with the ATCC. For example, allelic variants and/or species homologs may be isolated and identified by making suitable probes or primers from the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homologue.
- By a nucleic add having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence of the present invention, it is intended that tire nucleotide sequence of the nucleic acid is identical to the reference sequence except that the nucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the particular polypeptide. In other words, to obtain a nucleic acid having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. The query sequence may be an entire sequence shown of any of SEQ ID NOs:1-20, or any fragment or domain specified as described herein.
- As a practical matter, whether any particular nucleic acid molecule or polypeptide is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence or polypeptide of the present invention can be determined conventionally using known computer programs. A method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag et al. (Comp. App. Biosci. (1990) 6:237-245.) In a sequence alignment the query and subject sequences are both DNA sequences. An RNA sequence can be compared by converting U's to T's. The result of said global sequence alignment is in percent identity. Preferred parameters used in a FASTDB alignment of DNA sequences to calculate percent identity are: Mattix=Unitary, k-tuplc=4, Mismatch Penalty=1, Joining Penalty=30, Randomization Group Length=0, Cutoff Score=1, Gap Penalty=5, Gap Size Penalty 0.05, Window Size=500 or the length of the subject, nucleotide sequence, whichever is shorter.
- If the subject sequence is shorter than the query sequence because of 5′ or 3′ deletions, not because of internal deletions, a manual correction must be made to the results. This is because the FASTDB program does not account for 5′ and 3′ truncations of the subject sequence when calculating percent identity. For subject sequences truncated at the 5′ or 3′ ends, relative to the query sequence, the percent identity is corrected by calculating the number of bases of the query sequence that are 5′ and 3′ of the subject sequence, which are not matched/aligned, as a percent of the total bases of the query sequence. Whether a nucleotide is matched/aligned is determined by results of the FASTDB sequence alignment. This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to arrive at a final percent identity score. This corrected score is what is used for the purposes of the present invention. Only bases outside the 5′ and 3′ bases of the subject sequence, as displayed by the FASTDB alignment, which are not matched/aligned with the query sequence, are calculated for the purposes of manually adjusting the percent identity score.
- For example, a 90 base subject sequence is aligned to a 100 base query sequence to determine percent identity. The deletions occur at the 5′ end of the subject sequence and therefore, the FASTDB alignment does not show a matched/alignment of the first 10 bases at 5′ end. The 10 unpaired bases represent 10% of the sequence (number of bases at the 5′ and 3′ ends not matched/total number of bases in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 bases were perfectly matched the final percent identity would be 90%. In another example, a 90 base subject sequence is compared with a 100 base query sequence. This time the deletions are internal deletions so that there are no bases on the 5′ or 3′ of the subject sequence which are not matched/aligned with the query. In this case the percent identity calculated by FASTDB is not manually corrected. Once again, only bases 5′ and 3′ of the subject sequence which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are to be made for the purposes of the present invention.
- Some embodiments of the invention encompass a nucleic acid molecule comprising at least 10, 20, 30, 35, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, or 800 consecutive nucleotides or more of any of SEQ ID NOs: 1-20, or domains, fragments, variants, or derivatives thereof.
- The polynucleotide of the present invention may be in the form of RNA or in the form of DNA, which DNA includes cDNA, genomic DNA, and synthetic DNA. The DMA may be double stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand. The coding sequence which encodes the mature polypeptide can be identical to the coding sequence encoding SEQ ID NO:21-40, 46, or 52-56, or may be a different coding sequence which coding sequence, as a result, of the redundancy or degeneracy of the genetic code, encodes the same mature polypeptide as the DNA of any one of SEQ ID NOs:21-40, 46, or 52-56.
- In certain embodiments, the present, invention provides an isolated polynucleotide comprising a nucleic acid fragment which encodes at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 95, or at least 100 or more contiguous amino acids of SEQ ID NOs: 21-40, 46, or 52-56.
- The polynucleotide encoding for the mature polypeptide of SEQ ID NOs: 21-40, 46, or 52-56 or may include: only the coding sequence for the mature polypeptide; the coding sequence of any domain of the mature polypeptide; and the coding sequence for the mature polypeptide (or domain-encoding sequence) together with non coding sequence, such as introns or
non-coding sequence 5′ and/or 3′ of the coding sequence for tire mature polypeptide. - Thus, the term “polynucleotide encoding a polypeptide” encompasses a polynucleotide which includes only sequences encoding for the polypeptide as well as a polynucleotide which includes additional coding and/or non-coding sequences.
- In further aspects of the invention, nucleic acid molecules having sequences at least about 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid sequences disclosed herein, encode a polypeptide having cellobiohydrolase (“Cbh”), endoglucanase (“Eg”) or beta-gluconase (“Bgl”) functional activity. By “a polypeptide having Cbh, Eg or Bgl functional activity” is intended polypeptides exhibiting activity similar, but not necessarily identical, to a functional activity of the Cbh, Eg or Bgl polypeptides of the present invention, as measured, for example, in a particular biological assay. For example, a Cbh, Eg or Bgl functional activity can routinely be measured by determining the ability of a Cbh, Eg or Bgl polypeptide to hydrolyze cellulose, or by measuring the level of Cbh, Eg or Bgl activity.
- Of course, due to the degeneracy of the genetic code, one of ordinary skill in the art will immediately recognize that a large portion of the nucleic acid molecules having a sequence at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence of any of SEQ ID NOs: 1-20, or fragments thereof, will encode polypeptides having Cbh, Eg or Bgl functional activity. In fact, since degenerate, variants of any of these nucleotide sequences ail encode the same polypeptide, in many instances, this will be clear to the skilled artisan even without performing the above described comparison assay. St will be further recognized in the art that, for such nucleic acid molecules that are not degenerate variants, a reasonable number will also encode a polypeptide having Cbh, Eg or Bgl functional activity.
- The polynucleotides of the present invention also comprise nucleic acids encoding a H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes or Arabidopsis thaliana cellulase, or domain, fragment, variant, or derivative thereof, fused to a polynucleotide encoding a marker sequence which allows for detection of the polynucleotide of the present, invention. In one embodiment of the invention, expression of the marker is independent from expression of the cellulase. The marker sequence may be a yeast selectable marker selected from the group consisting of URA3, HIS3, LEU2, TRP1, LYS2 or ADE2. Casey, G. P. et al. “A convenient dominant selection marker for gene transfer in industrial strains of Saccharomyces yeast: SMR1 encoded resistance to the herbicide sulfometuron methyl,” J. Inst. Brew. 94:93-97 (1988).
- According to one embodiment of the invention, the polynucleotides encoding heterologous celluloses can be codon-optimized. As used herein the term “codon-optimized coding region” means a nucleic acid coding region that has been adapted for expression in the cells of a given organism by replacing at least one, or more than one, or a significant number, of codons with one or more codons that are more frequently used in the genes of that organism.
- In general, highly expressed genes in an organism are biased towards codons that are recognized by the most abundant tRNA species in that organism. One measure of this bias is the “codon adaptation index” or “CAI,” which measures the extent to which the codons used to encode each amino acid in a particular gene are those which occur most frequently in a reference set of highly expressed genes from an organism.
- The CAI of codon optimized sequences of the present invention corresponds to between about 0.8 and 1.0, between about 0.8 and 0.9, or about 1.0. A codon optimized sequence may be further modified for expression in a particular organism, depending on that organism's biological constraints. For example, large runs of “As” or “Ts” (e.g., runs greater than 4, 4, 5, 6, 7, 8, 9, or 10 consecutive bases) can be removed from the sequences if these are known to effect transcription negatively. Furthermore, specific restriction enzyme sues may be removed for molecular cloning purposes. Examples of such restriction enzyme sites include Pad, AscI, BamHI, BglII, EcoRI and XhoI. Additionally, the DMA sequence can be checked for direct repeats, inverted repeats and mirror repeats with lengths of ten bases or longer, which can be modified manually by replacing codons with “second best” codons, codons that occur at the second highest frequency within the particular organism for which the sequence is being optimized.
- Deviations in the nucleotide sequence that comprise the codons encoding tire amino acids of any polypeptide chain allow for variations in the sequence coding for the gene. Since each codon consists of three nucleotides, and the nucleotides comprising DNA are restricted to four specific bases, there are 64 possible combinations of nucleotides, 61 of which encode amino acids (the remaining three codons encode signals ending translation). The “genetic code” which shows which codons encode which amino acids is reproduced herein as Table 2. As a result, many amino acids are designated by more than one codon. For example, the amino acids alanine and proline are coded for by four triplets, serine and arginine by six, whereas tryptophan and methionine are coded by just one triplet. This degeneracy allows for DNA base composition to vary over a wide range without altering the amino acid sequence of the proteins encoded by the DNA.
-
TABLE 2 The Standard Genetic Code T C A G T TTT Phe (F) TCT Ser (S) TAT Tyr (Y) TGT Cys (C) TC″ TCC″ TAC″ TGC TTA Leu (L) TCA″ TAA Ter TGA Ter TTG″ TCG″ TAG Ter TGG Trp (W) C CTT Leu (L) CCT Pro (P) CAT His (H) CGT Arg (R) CTC″ CCC″ CAC″ CGC″ CTA″ CCA″ CAA Gln (Q) CGA″ CTG″ CCG″ CAG″ CGG″ A ATT Ile (I) ACT Thr (T) AAT Asn (N) AGT Ser (S) ATC″ ACC″ AAC″ AGC″ ATA″ ACA″ AAA Lys (K) AGA Arg (R) ATG Met ACG″ AAG″ AGG″ (M) G GTT Val (V) GCT Ala (A) GAT Asp (D) GGT Gly (G) GTC″ GCC″ GAC″ GGC″ GTA″ GCA″ GAA Glu (E) GGA″ GTG″ GCG″ GAG″ GGG″ - Many organisms display a bias for use of particular codons to code for insertion of a particular amino acid in a growing peptide chain. Codon preference or codon bias, differences in codon usage between organisms, is afforded by degeneracy of the genetic code, and is well documental among many organisms. Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a ret lection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
- Given the large number of gene sequences available for a wide variety of animal, plant, and microbial species, it is possible to calculate the relative frequencies of codon usage. Codon usage tables are readily available, for example, at http://phenotype.biosci.umbc.edu/codon/sgd/index.php (visited May 7, 2008) or at http://www.kazusa.or.jp/codon/ (visited Mar. 20, 2008), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. “Codon usage tabulated from the international DNA sequence databases: status for the year 2000” Nucl. Acids Res. 28:292 (2000). Codon usage tables for yeast, calculated from GenBank Release 128.0 [15 Feb. 2002], are reproduced below as Table 3. This table uses mRNA nomenclature, and so instead of thymine (T) which is found in DNA, the tables use uracil (U) which is found in RNA. The Table has been adapted so that frequencies are calculated for each amino acid, rather than for all 64 codons.
-
TABLE 3 Codon Usage Table for Saccharomyces cerevisiae Genes Frequency per Amino Acid Codon Number hundred Phe UUU 170666 26.1 Phe UUC 120510 18.4 Total Leu UUA 170884 26.2 Leu UUG 177573 27.2 Leu CUU 80076 12.3 Leu CUC 35545 5.4 Leu CUA 87619 13.4 Leu CUG 68494 10.5 Total Ile AUU 196893 30.1 Ile AUC 112176 17.2 Ile AUA 116254 17.8 Total Met AUG 136805 20.9 Total Val GUU 144243 22.1 Val GUC 76947 11.8 Val GUA 76927 11.8 Val GUG 70337 10.8 Total Ser UCU 153557 23.5 Ser UCC 92923 14.2 Ser UCA 122028 18.7 Ser UCG 55951 8.6 Ser AGU 92466 14.2 Ser AGC 63726 9.8 Total Pro CCU 88263 13.5 Pro CCC 44309 6.8 Pro CCA 119641 18.3 Pro CCG 34597 5.3 Total Thr ACU 132522 20.3 Thr ACC 83207 12.7 Thr ACA 116084 17.8 Thr ACG 52045 8.0 Total Ala GCU 138358 21.2 Ala GCC 82357 12.6 Ala GCA 105910 16.2 Ala GCG 40358 6.2 Total Tyr UAU 122728 18.8 Tyr UAC 96596 14.8 Total His CAU 89007 13.6 His CAC 50785 7.8 Total Gln CAA 178251 27.3 Gln CAG 79121 12.1 Total Asn AAU 233124 35.7 Asn AAC 162199 24.8 Total Lys AAA 273618 41.9 Lys AAG 201361 30.8 Total Asp GAU 245641 37.6 Asp GAC 132048 20.2 Total Glu GAA 297944 45.6 Glu GAG 125717 19.2 Total Cys UGU 52903 8.1 Cys UGC 31095 4.8 Total Trp UGG 67789 10.4 Total Arg CGU 41791 6.4 Arg CGC 16993 2.6 Arg CGA 19562 3.0 Arg CGG 11351 1.7 Arg AGA 139081 21.3 Arg AGG 60289 9.2 Total Gly GGU 156109 23.9 Gly GGC 63903 9.8 Gly GGA 71216 10.9 Gly GGG 39359 6.0 Total Stop UAA 6913 1.1 Stop UAG 3312 0.5 Stop UGA 4447 0.7 - By utilizing this or similar tables, one of ordinary skill in the art can apply the frequencies to any given polypeptide sequence, and produce a nucleic acid fragment of a codon-optimized coding region which encodes the polypeptide, but winch uses codons optimal for a given species. Codon-optimized coding regions can be designed by various different methods.
- In one method, a codon usage table is used to find the single most frequent codon used for any given amino acid, and that codon is used each time that particular amino acid appears in the polypeptide sequence. For example, referring to Table 3 above, for leucine, the most frequent codon is UUG, which is used 27.2% of the time. Thus ail the leucine residues in a given amino acid sequence would be assigned the codon UUG.
- In another method, the actual frequencies of the codons are distributed randomly throughout the coding sequence. Thus, using this method for optimization, if a hypothetical polypeptide sequence had 100 leucine residues, referring to Table 3 for frequency of usage in the S. cerevisiae, about 5, or 5% of the leucine codons would be CUC, about 11, or 11% of the leucine codons would be CUG, about 12, or 12% of the leucine codons would be CUU, about 13, or 13% of the leucine codons would be CUA, about 26, or 26% of the leucine codons would be UUA, and about 27, or 27% of the leucine codons would be UUG.
- These frequencies would be distributed randomly throughout the leucine codons in the coding region encoding the hypothetical polypeptide. As will be understood by those of ordinary skill in the art, the distribution of codons in the sequence can vary significantly using this method; however, the sequence always encodes the same polypeptide.
- When using the methods above, the term “about” is used precisely to account for fractional percentages of codon frequencies for a given amino acid. As used herein, “about” is defined as one amino acid more or one amino acid less than the value given. The whole number value of amino adds is rounded up if the fractional frequency of usage is 0.50 or greater, and is rounded down if the fractional frequency of use is 0.49 or less. Using again the example of the frequency of usage of leucine in human genes for a hypothetical polypeptide having 62 leucine residues, the fractional frequency of codon usage would be calculated by multiplying 62 by the frequencies for the various codons. Thus, 7.28 percent of 62 equals 4.51 UUA codons, or “about 5,” i.e., 4, 5. or 6 UUA codons, 12.66 percent of 62 equals 7.85 UUG codons or “about 8,” i.e., 7, 8, or 9 UUG codons, 12.87 percent of 62 equals 7.98 CUU codons, or “about 8,” i.e., 7, 8, or 9 CUU codons, 19.56 percent of 62 equals 12.13 CUC codons or “about 12,” i.e., 11, 12, or 13 CUC codons, 7.00 percent of 62 equals 4.34 CUA codons or “about 4,” i.e., 3, 4, or 5 CUA codons, and 40.62 percent of 62 equals 25.19 CUG codons, or “about 25,” i.e., 24, 25, or 26 CUG codons.
- Randomly assigning codons at an optimized frequency to encode a given polypeptide sequence, can be done manually by calculating codon frequencies for each amino acid, and then assigning the codons to the polypeptide sequence randomly. Additionally, various algorithms and computer software programs are readily available to those of ordinary skill in the art. For example, the “EditSeq” function in the Lasergene Package, available from DNAstar, Inc., Madison, Wis., the back translation function in the VectorNTI Suite, available from InforMax, Inc., Bethesda, Md., and the “backtranslate” junction in the GCG—Wisconsin Package, available from Accelrys, Inc., San Diego, Calif. In addition, various resources are publicly available to codon-optimize coding region sequences, e.g., the “backtranslation” function at http://www.entelechon.com/bioinformatics/backtranslation.php?lang=eng (visited Apr. 15, 2008) and the “backtranseq” function available at http://bioinfo.pbi.nrc.ca:8090/EMBOSS/index.html (visited Jul. 9, 2002). Constructing a rudimentary algorithm to assign codons based on a given frequency can also easily be accomplished with basic mathematical functions by one of ordinary skill in the art.
- A number of options are available for synthesizing codon optimized coding regions designed by any of the methods described above, using standard and routine molecular biological manipulations well known to those of ordinary skill in the art. In one approach, a series of complementary oligonucleotide pairs of 80-90 nucleotides each in length and spanning the length of the desired sequence is synthesized by standard methods. These oligonucleotide pairs are synthesized such that upon annealing, they form double stranded fragments of 80-90 base pairs, containing cohesive ends, e.g., each oligonucleotide in the pair is synthesized to extend 3, 4, 5, 6, 7, 8, 9, 10, or more bases beyond the region that is complementary to the other oligonucleotide in the pair. The single-stranded ends of each pair of oligonucleotides is designed to anneal with the single-stranded end of another pair of oligonucleotides. The oligonucleotide pairs are allowed to anneal, and approximately five to six of these double-stranded fragments are then allowed to anneal together via the cohesive single stranded ends, and then they ligated together and cloned into a standard bacterial cloning vector, for example, a TOPO® vector available from Invitrogen Corporation, Carlsbad, Calif. The construct is then sequenced by standard methods. Several of these constructs consisting of 5 to 6 fragments of 80 to 90 base pair fragments ligated together, i.e., fragments of about 500 base pairs, are prepared, such that the entire desired sequence is represented in a series of plasmid constructs. The inserts of these plasmids are then cut with appropriate restriction enzymes and ligated together to form She final construct. The final construct is then cloned into a standard bacterial cloning vector, and sequenced. Additional methods would be immediately apparent to the skilled artisan. In addition, gene synthesis is readily available commercially.
- In certain embodiments, an entire polypeptide sequence, or fragment, variant, or derivative thereof is codon optimized by any of the methods described herein. Various desired fragments, variants or derivatives are designed, and each is then codon-optimized individually. In addition, partially codon-optimized coding regions of the present invention can be designed and constructed. For example, the invention includes a nucleic acid fragment of a codon-optimized coding region encoding a polypeptide in which at least about 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the codon positions have been codon-optimized for a given species. That is, they contain a codon that is preferentially used in the genes of a desired species, e.g., a yeast species such as Saccharomyces cerevisiae or Kluyveromyces, in place of a codon that is normally used in lire native nucleic acid sequence.
- In additional embodiments, a full-length polypeptide sequence is codon-optimized for a given species resulting in a codon-optimized coding region encoding the entire polypeptide, and then nucleic acid fragments of the codon-optimized coding region, which encode fragments, variants, and derivatives of the polypeptide are made from the original codon-optimized coding region. As would be well understood by those of ordinary skill in the art, if codons have been randomly assigned to the full-length coding region based on their frequency of use in a given species, nucleic acid fragments encoding fragments, variants, and derivatives would not necessarily be fully codon optimized for the given species. However, such sequences are still much closer to the codon usage of the desired species than the native codon usage. The advantage of this approach is that synthesizing codon-optimized nucleic acid fragments encoding each fragment, variant, and derivative of a given polypeptide, although routine, would be time consuming and would result in significant expense.
- The codon-optimized coding regions can be, for example, versions encoding a cellobiohydrolase, endoglucanase or beta-glucosidase from H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana, or domains, fragments, variants, or derivatives thereof.
- Codon optimization is carried out for a particular species by methods described herein, for example, in certain embodiments codon-optimized coding regions encoding polypeptides of H. grisea, T. aurantiacus, T. emersonii, T. reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigatus, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellulases, or domains, fragments, variants, or derivatives thereof are optimized according to yeast codon usage, e.g., Saccharomyces cerevisiae, Kluyveromyces lactis and/or Kluyveromyces maximus. Also provided are polynucleotides, vectors, and other expression constructs comprising codon-optimized coding regions encoding polypeptides of H. grisea, T. aurantiacus, T. emersonii, T, reesei, C. lacteus, C. formosanus, N. takasagoensis, C. acinaciformis, M. darwinensis, N. walkeri, S. fibuligera, C. lucknowense R. speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Aspergillus kawachii, Heterodera schachtii, H. jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Neosartorya fischeri, Chaetomium globosum, Chaetomium thermophilum, Aspergillus fumigants, Aspergillus terreus, Neurospora Crassa, R. flavipes, or Arabidopsis thaliana cellulases or domains, fragments, variants, or derivatives thereof, and various methods of using such polynucleotides, vectors and other expression constructs.
- In certain embodiments described herein, a codon-optimized coding region encoding any of SEQ ID NOs:21-40, 46, or 52-56 or domain, fragment, variant, or derivative thereof, is optimized according to codon usage in yeast (Saccharomyces cerevisiae, Kluyveromyces lactis or Kluyveromyces marxianus). in some embodiments, the sequences are codon-optimized specifically for expression in Saccharomyces cerevisiae. In some embodiments, the sequences are codon-optimized for expression in Kluyveromyces. In some embodiments, a sequence is simultaneously codon-optimized tor optimal expression in both Saccharomyces cerevisiae and in Kluyveromyces. Alternatively, a codon-optimized coding region encoding any of SEQ ID NOs: 21-40, 46, or 52-56 may be optimized according to codon usage in any plant, animal, or microbial species.
- The present invention also relates to vectors which include polynucleotides of the present invention, host cells which are genetically engineered with vectors of the invention and the production of polypeptides of the invention by recombinant techniques.
- Host cells are genetically engineered (transduced or transformed or transfected) with the vectors of this invention which may be, for example, a cloning vector or an expression vector, lire vector may be, for example, in the form of a plasmid, a viral particle, a phage, etc. lire engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the genes of the present invention. The culture conditions, such as temperature, pH and the like, are those previously used with the host cell selected tor expression, and will be apparent to the ordinarily skilled artisan.
- The polynucleotides of the present invention may be employed for producing polypeptides by recombinant techniques. Titus, for example, the polynucleotide may be included in any one of a variety of expression vectors for expressing a polypeptide. Such vectors include chromosomal, nonchromosomal and synthetic DNA sequences, e.g., derivatives of SV40; bacterial plasmids; and yeast plasmids. However, any other vector may be used as long as it is replicable and viable in the host.
- The appropriate DNA sequence may be inserted into the vector by a variety of procedures. In general, the DNA sequence is inserted into an appropriate restriction endonuclease site(s) by procedures known in the art. Such procedures and others are deemed to be within the scope of those skilled in the art.
- The DNA sequence in the expression vector is operatively associated with an appropriate expression control sequence(s) (promoter) to direct mRNA synthesis. Representative examples of such promoters are as follows:
-
Gene Organism Systematic name Reason for use/benefits PGK1 S. cerevisiae YCR012W Strong constitutive promoter ENO1 S. cerevisiae YGR254W Strong constitutive promoter TDH3 S. cerevisiae YGR192C Strong constitutive promoter TDH2 S. cerevisiae YJR009C Strong constitutive promoter TDH1 S. cerevisiae YJL052W Strong constitutive promoter ENO2 S. cerevisiae YHR174W Strong constitutive promoter GPM1 S. cerevisiae YKL152C Strong constitutive promoter TPI1 S. cerevisiae YDR050C Strong constitutive promoter - Additionally, promoter sequences front stress and starvation response genes are useful in the present invention. In some embodiments, promoter regions from the S. cerevisiae genes GAC1, GET3, GLC7, GSH1, GSH2, HSF1, HSP12, LCB5, LRE1, LSP1, NBP2, PIL1, PIM1, SGT2, SLG1, WHI2, WSC2, WSC3, WSC4, YAP1, YDC1, HSP104, HSP26, ENA1, MSN2, MSN4, SIP2, SIP4, SIP5, DPL1, IRS4, KOG1, PEP4, HAP4, PRB1, TAX4, ZPR1, ATG1, ATG2, ATG10, ATG11, ATG12, ATG13, ATG14, ATG15, ATG16, ATG17, ATG18, and ATG19 may be used. Any suitable promoter to drive gene expression in the host cells of the invention may be used. Additionally the E. coli, lac or trp, and other promoters known to control expression of genes in prokaryotic or lower eukaryotic cells can be used.
- In addition, the expression vectors may contain one or more selectable marker genes to provide a phenotypic trait for selection of transformed host cells such as URA3, HIS3, LEU2, TRP1, LYS2 or ADE2, dihydrofolate reductase, neomycin (G418) resistance or zeocin resistance for eukaryotic cell culture, or tetracycline or ampicillin resistance in E. coli.
- The expression vector may also contain a ribosome binding site for translation Initiation and/or a transcription terminator. The vector may also include appropriate sequences for amplifying expression, or may include additional regulatory regions.
- The vector containing the appropriate DNA sequence as herein, as well as an appropriate promoter or control sequence, may be employed to transform an appropriate host to permit the host to express the protein.
- Thus, in certain aspects, the present invention relates to host ceils containing the above-described constructs. The host cell can be a host cell as described elsewhere in the application. The host cell can be, for example, a lower eukaryotic cell, such as a yeast cell, e.g., Saccharomyces cerevisiae or Kluyveromyces, or the host cell can be a prokaryotic cell, such as a bacterial cell.
- As representative examples of appropriate hosts, there may be mentioned: bacterial cells, such as E. coli, Streptomyces, Salmonella typhimurium; thermophilic or mesophilic bacteria; fungal cells, such as yeast; and plant ceils, etc. The selection of an appropriate host is deemed to be within the scope of those skilled in the art front the teachings herein.
- Appropriate fungal hosts include yeast. In certain aspects of the invention the yeast is selected from the group consisting of Saccharomyces cerevisiae, Kluyveromyces lactis, Schizzosaccharomyces pombe, Candida albicans, Pichia pastoris, Pichia stipitis, Yarrowia lipolytica, Hansenula polymorpha, Phaffia rhodozyma, Candida utilis, Arxula adeninivorans, Debaryomyces hansenii, Debaryomyces polymorphus, Schwanniomyces occidental, Issatchenkia orientalis, Kluyveromyces maximus, Blakeslea, Candida, Cryptococcus, Cunninghamella, Lipomyces, Mortierella, Mucor, Phycomces, Pythium, Rhodosporidium, Rhodotorula, Trichosporon and Yarrowia.
- The present invention is also directed to use of host cells and co-cultures to produce ethanol from cellulosic substrates. Such methods can be accomplished, for example, by contacting a cellulosic substrate with a host cell or a co-culture of the present invention.
- Numerous cellulosic substrates can be used in accordance with the present invention. Substrates for cellulose activity assays can be divided into two categories, soluble and insoluble, based on their solubility in water. Soluble substrates include cellodextrins or derivatives, carboxymethyl cellulose (CMC), or hydroxyethyl cellulose (HEC). Insoluble substrates include crystalline cellulose, microcrystalline cellulose (Avicel), amorphous cellulose, such as phosphoric acid swollen cellulose (PASC), dyed or fluorescent cellulose, and pretreated lignocellulosic biomass. These substrates are generally highly ordered cellulosic material and thus only sparingly soluble.
- It will be appreciated that suitable lignocellulosic material may be any feedstock that, contains soluble and/or insoluble cellulose, where the insoluble cellulose may be in a crystalline or non-crystalline form. In various embodiments, the lignocellulosic biomass comprises, for example, wood, corn, corn stover, sawdust, bark, leaves, agricultural and forestry residues, grasses such as switchgrass, ruminant digestion products, municipal wastes, paper mill effluent, newspaper, cardboard or combinations thereof.
- In some embodiments, the invention is directed to a method for hydrolyzing a cellulosic substrate, for example a cellulosic substrate as described above, by contacting the cellulosic substrate with a host cell of the invention. In some embodiments, the invention is directed to a method for hydrolyzing a cellulosic substrate, for example a cellulosic substrate as described above, by contacting the cellulosic substrate with a co-culture comprising yeast cells expressing heterologous cellulases.
- In some embodiments, the invention is directed to a method for fermenting cellulose. Such methods can be accomplished, for example, by culturing a host cell or co-culture in a medium that contains insoluble cellulose to allow saccharification and fermentation of the cellulose.
- The production of ethanol can, according to the present invention, be performed at temperatures of at least about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C., about 40° C., about 41° C., about 42° C., about 43° C., about 44° C., about 45° C., about 46° C., about 47° C., about 48° C., about 49° C., or about 50° C. In some embodiments of the present invention the thermotolerant host cell can produce ethanol from cellulose at temperatures above about 30° C., about 31° C., about 32° C., about 33° C., about 34° C., about 35° C., about 36° C., about 37° C., about 38° C., about 39° C. about 40° C., about 41° C., about 42° C., or about 43° C., or about 44° C., or about 45° C., or about 50° C. In some embodiments of the present invention, the thermotolerant host cell can produce, ethanol from cellulose at temperatures from about 30° C. to 60° C., about 30° C. to 55° C., about 30° C. to 50° C., about 40° C. to 60° C., about 40° C. to 55° C. or about 40° C. to 50° C.
- In some embodiments, methods of producing ethanol can comprise contacting a cellulosic substrate with a host cell or co-culture of the invention and additionally contacting the cellulosic substrate with externally produced cellulase enzymes. Exemplary externally produced cellulase enzymes are commercially available and are known to those of skill in the art.
- Therefore, the invention, is also directed to methods of reducing the amount of externally produced cellulase enzymes required to produce a given amount of ethanol front cellulose comprising contacting the cellulose with externally produced cellulases and with a host cell or co-culture of the invention. In some embodiments, the same amount of ethanol production can be achieved using at least about 5%, 10%, 15%, 20%, 25%, 30%, or 50% less externally produced cellulases. In some embodiments, no external cellulase is added, or less than about 5% of the cellulase is externally added cellulase, or less than about 10% of the cellulase is externally added cellulase, or less than about 15% of the cellulase is externally added cellulase.
- In some embodiments, the methods comprise producing ethanol at a particular rate. For example, in some embodiments, ethanol is produced at a rate of at least about 0.1 mg per hour per liter, at least about 0.25 mg per hour per liter, at least about 0.5 mg per hour per liter, at least about 0.75 mg per hour per liter, at least about 1.0 mg per hour per liter, at least about 2.0 mg per hour per liter, at least about 5.0 mg per hour per liter, at least about 10 mg per hour per liter, at least about 15 mg per hour per liter, at least about 20.0 mg per hour per liter, at least about 25 mg per hour per liter, at least about 30 mg per hour per liter, at least about 50 mg per hour per liter, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, or at least about 500 mg per hour per liter.
- In some embodiments, the host cells of the present invention can produce ethanol at a rate of at least about 0.1 mg per hour per liter, at least about 0.25 mg per hour per liter, at least about 0.5 mg per hour per liter, at least about 0.75 mg per hour per liter, at least about 1.0 mg per hour per liter, at least about 2.0 mg per hour per liter, at least about 5.0 mg per hour per liter, at least about 10 mg per hour per liter, at least about 15 mg per hour per liter, at least about 20.0 mg per hour per liter, at least about 25 mg per hour per liter, at least about 30 mg per hour per liter, at least about 50 mg per hour per bier, at least about 100 mg per hour per liter, at least about 200 mg per hour per liter, at least about 300 mg per hour per liter, at least about 400 mg per hour per liter, or at least about 500 mg per hour per liter more than a control strain (lacking heterologous cellulases) and grown under the same conditions. In some embodiments, the ethanol can be produced in the absence of any externally added cellulases.
- Ethanol production can be measured using any method known in the art. For example, the quantity of ethanol in fermentation samples can be assessed using HPLC analysis. Many ethanol assay kits are commercially available that use, for example, alcohol oxidase enzyme based assays. Methods of determining ethanol production are within the scope of those skilled in the art from the teachings herein.
- The following embodiments of the invention will now be described in more detail by way of these non-limiting examples.
- The present invention presents a number of important steps forward for creating a yeast capable of consolidated bioprocessing. It describes improved cellulolytic yeast created by expressing combinations of heterologous cellulases. The present invention demonstrates for the first time, the ability of transformed Kluyveromyces to produce ethanol from cellulose, the ability of yeast strains expressing only secreted heterologous cellulases to produce ethanol from cellulose, and the ability of co-cultures of multiple yeast strains expressing different cellulases to produce ethanol from cellulose. In addition such yeast strains and co-cultures of yeast strains can increase the efficiency of simultaneous saccharification and fermentation (SSF) processes.
- General Strain Cultivation and Media
- Escherichia coli strain DH5α (Invitrogen), or
NEB 5 alpha (New England Biolabs) was used for plasmid transformation and propagation. Cells were grown in LB medium (5 g/L yeast extract, 5 g/L NaCl, 10 g/L tryptone) supplemented with ampicillin (100 mg/L), kanamycin (50 mg/L), or zeocin (20 mg/L). When zeocin selection was desired LB was adjusted to pH 7.0. Also, 15 g/L agar was added when solid media was desired. - Yeast strains were routinely grown in YPD (10 g/L yeast extract, 20 g/L peptone, 20 g/L glucose), YPC (10 g/L yeast extract, 20 g/L peptone, 20 g/L cellobiose), or YNB+glucose (6.7 g/L Yeast: Nitrogen Base without amino acids, and supplemented with appropriate amino acids for strain, 20 g/L glucose) media with either G418 (250 mg/L unless specified) or zeocin (20 mg/L unless specified) for selection. 15 g/L, agar was added for solid media.
- Molecular Methods
- Standard protocols were followed for DNA manipulations (Sambrook et al. 1989). PCR was performed using Phusion polymerase (New England Biolabs) for cloning, and Taq polymerase (New England Biolabs) for screening transformants, and in some cases Advantage Polymerase (Clontech) for PCR of genes for correcting auxotrophies. Manufacturers guidelines were followed as supplied. Restriction enzymes were purchased from New England Biolabs and digests were set up according to the supplied guidelines. Ligations were performed using the Quick ligation kit (New England Biolabs) as specified by the manufacturer. Gel purification was performed using either Qiagen or Zymo research kits, PCR product and digest purifications were performed using Zymo research kits, and Qiagen midi and miniprep kits were used for purification of plasmid DNA. Sequencing was performed by the Molecular Biology Core Facility at Dartmouth College. Yeast mediated ligation (YML) was used to create some constructs (Ma et al. Gene 58:201-216 (1987)). This was done by creating DNA fragments to be cloned with 20-40 bp of homology with the other pieces to be combined and/or the backbone vector. A backbone vector (pRS426), able to replicate in yeast, and with the Ura3 gene for selection, was then transformed into yeast by standard methods with the target sequences for cloning. Transformed yeast recombine these fragments to form a whole construct and the resulting plasmid allows selection on media without uracil.
- Vectors
- Plasmid constructs vectors in the experiments detailed below are summarized in Table 4, and the primers used in vector construction are shown in Table 5.
-
TABLE 4 Plasmids used. Plasmid Genotype pBKD1-BGLI bla KanMX PGK1P-S.f. bgl1- PGK1T pBKD2-sEGI bla KanMX ENO1P-sT.r. eg1- ENO1T pBKD1-BGLI-sEGI bla KanMX ENO1P-sT.r. eg1- ENO1T & PGK1P-S.f. bgl1- PGK1T YEpENO-BBH bla URA3 ENO1PT pJC1 La grange et al. bla URA3 PGKPT (1996) pRDH101 bla URA3 ENO1P-sT.r.cbh1- ENO1T pRDH103 bla URA3 ENO1P-sH.g.cbh1- ENO1T pRDH104 bla URA3 ENO1P-sT.a.cbh1- ENO1T pRDH105 bla URA3 ENO1P-sT.e.cbh1- ENO1T pRDH106 bla URA3 ENO1P-sT.e.cbh2- ENO1T pRDH107 bla URA3 PGK1P-sT.r.cbh2- PGK1T pRDH108 bla URA3 PGK1P-sT.r.cbh2- PGK1T & ENO1P-sT.e.cbh1- ENO1T pRDH118 bla URA3 PGK1P-sT.r.cbh2- PGK1T & ENO1P-sH.g.cbh1- ENO1T pRDH120 bla URA3 PGK1P-sT.r.cbh2- PGK1T & ENO1P-sT.a.cbh1- ENO1T pDF1 La Grange et al. bla fur1::LEU2 (1996) pCEL5 Den Haan et al. 2 micron vector for expression of SfBGLI and 2007 TrEGI (native sequence) pMU185 pUG66 (loxp-zeo-loxp) pKLAC1 New England K. lactis expression vector for integration at Biolabs the lac4 locus, acetamide selection pRS426 2 micron vector for yeast mediated ligation (YML) pMU289 pRS426 with portion of pKLAC1 for insertion of TrEG1 (from pBKD_11621, as detailed in example 1) into lac4 locus created by YML pMU291 pRS426 with portion of pKLAC1 for insertion of TrCBH2 (from pBZD_20641, as detailed in example 1) into lac4 locus created by YML pMU398 ENO1P-sT.e.cbh1- ENO1T from pRDH105 into pMU289 (cloning by YML) pMU451 pRDH105 with PacI/AscI linker (formed using primers) inserted into EcoRI/XhoI pMU458 synthetic construct for N.f. EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU463 TrEG1 from pBKD1-BGLI-sEGI into pMU451 (PacI/AscI digest of both pieces) pMU465 synthetic construct for C.l.(a) EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU469 synthetic construct for R.f.EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU471 synthetic construct for C.f.EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU472 synthetic construct for N.t.EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU473 synthetic construct for C.a.EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU475 synthetic construct for T.r. CBH2 derived from pBKD_20641 with tether removed (from example 1) inserted into pMU451 (PacI/AscI digest of both pieces) pMU499 synthetic construct for M.d. EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU500 synthetic construct for R.s. EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU503 synthetic construct for N.w. EG inserted into pMU451 (PacI/AscI digest of both pieces) pMU624/ pMI529 2 micron vector for expression of T.e. CBH1 w/CBD (PCR fragments for chimeric enzyme with PmlI-XhoI digested pRDH105) pMU326 synthetic construct for R.s. EG from Codon Devices pMU784/ pMI574 2 micron vector for expression of C.l.(b) CBH2 (synthetic construct for C.l.(b) CBH2 inserted into PacI/AscI digested pMU624) pMU562 pBKD_2 with loxp-zeo-loxp inserted (NotI digest of both pieces) pMU576 ENO1p- T.r.cbh1-ENO1T (from pMU291) in pMU562 (PacI/AscI digest of both pieces) pMU577 ENO1p- T.e.cbh1-ENO1T in (from pMU398) pMU562 (PacI/AscI digest of both pieces) pMU661 ENO1p- T.r. EG1-ENO1T (from pMU463) in pMU562 (PacI/AscI digest of both pieces) pMU662 ENO1p- C.l.(a) EG1-ENO1T (from pMU465) in pMU562 (PacI/AscI digest of both pieces) pMU663 ENO1p- C.f. EG1-ENO1T (from pMU471) in pMU562 (PacI/AscI digest of both pieces) pMU664 ENO1p- N.t. EG1-ENO1T (from pMU472) in pMU562 (PacI/AscI digest of both pieces) pMU665 ENO1p- C.a. EG1-ENO1T (from pMU473) in pMU562 (PacI/AscI digest of both pieces) pMU666 ENO1p- T.r.CBH2-ENO1T (from pMU475) in pMU562 (PacI/AscI digest of both pieces) pMU667 ENO1p- M.d.-EG1-ENO1T (from pMU499) in pMU562 (PacI/AscI digest of both pieces) pMU668 ENO1p- N.w.-EG1-ENO1T (from pMU503) in pMU562 (PacI/AscI digest of both pieces) pMU755 ENO1p- T.e.CBH1 w/CBD-ENO1T (from pMU624) in pMU562 (PacI/AscI digest of both pieces) pMU750 ENO1p- R.s.-EG2-ENO1T (from pMU326) in pMU562 (PacI/AscI digest of both pieces) pMU809 ENO1p- C.l.(b) CBH2b-ENO1T (from pMU784) in pMU562 (PacI/AscI digest of both pieces) pMU721 pMU562 with hph gene (hygromycin resistance marker) replacing zeocin marker (NotI digest for both fragments) pMU760 ENO1p- T.e.CBH1 w/CBD-ENO1T from pMU624 in pMU721 (MheI/AscI digest for both fragments) pMU761 ENO1p- T.r.CBH2-ENO1T from pMU291in pMU721 (PacI/AscI digest for both fragments) pMI553 2 micron vector for expression of T.r. CBH2 and T.e. CBH1 + CBM pMI568 2 micron vector for expression of T.r. EG1, please see text for description of how this construct was built. pMI574 2 micron vector for expression of C.l.(b) CBH2 pMI577 2 micron vector for expression of T.r. CBH2 and H.g. CBH1 pMI578 2 micron vector for expression of T.r. CBH2 and T.e. CBH1 pMI579 2 micron vector for expression of T.r. CBH2 and C.l.(b) CBH1 pMI580 2 micron vector for expression of C.l.(b) CBH2 and T.e. CBH1 + CBM pMI581 2 micron vector for expression of C.l.(b) CBH2 and T.e. CBH1 pMI582 2 micron vector for expression of C.l.(b) CBH2 and H.g. CBH1 pMI583 2 micron vector for expression of C.l.(b) CBH2 and C.t. CBH1 - Abbreviations: ENO1P/T=
Enolase 1 gene promoter/terminator; PGKIP/T=phosphoglycerate kinase 1 gene promoter & terminator; T.r.=Trichoderma reesei; H.g.=Humicola grisea; T.a.=Thermoascus aurantiacus; T.e.=Talaromyces emersonii, S.f.=Saccharomycopsis fibuligera; C.l. (a)=Coptotermes lacteus; C.f.=Coptotermes formosanus; N.t.=Nasurtitermes takasagoensis; C.a.=Coptotermes acinaciformis; M.d.=Mastotermes darwinensis; N.w.=Nasutitermes walkeri; R.s.=Reticulitermes speratus, C.l. (b)=Chrysosporium lucknowense; N.f.=Neosartorya fischeri; R.f.=Reticulitermes flavipesC.t.=Chaetomium thermophilum -
TABLE 5 Primers Used sCBH1/2-L GACTGAATTCATAATGGTCTCCTTCACCTCC (SEQ ID NO: 59) sCBH1-R GACTCTCGAGTTACAAACATTGAGAGTAGTATGG (SEQ ID NO: 60) sCBH2-R CAGTCTCGAGTTACAAGAAAGATGGGTTAGC (SEQ ID NO: 61) 395 Te cbh1 Synt1 GCGTTGGTACCGTTTAAACGGGGCCCTTAATTAAACAAT PacI-ATG GCTAAGAAGAGCTTTACTATTGAG (SEQ ID NO: 62) 398 Te cbh1 synt CCTCCCCCGGGTTAGAAGCAGTGAAAGTGGAGTTGATTG core SmaI G (SEQ ID NO: 63) 399Trcbh1 synt CBM5 GCGACGAGTCAACCCTCCAGGTGGTAACAGAGGTACTA MlyIHincII CCAC (SEQ ID NO: 64) 400 Trcbh1 synt CBM5 GCGACTCGAGGGCGCCGCCTACAAACATTGAGAGTAGTA AscIXhoI TGGGTTTA (SEQ ID NO: 65) 379 ScPGK1prom-786 GCGTTGAGCTCGGGCCCTAATTTTTATTTTAGATTCCTGA SacI + ApaI CTTCAAC (SEQ ID NO: 66) 380 ScPGK1prom EcoRI- GCGTTGAATTCTTAATTAAGTAAAAAGTAGATAATTACT PacI TCCTTG (SEQ ID NO: 67) 381 CBH2 WT EcoRI- GCGTTGAATTCTTAATTAAACAATGATTGTCGCATTCT PacI-ATG CACCACGC (SEQ ID NO: 68) 386 CBH2 WT TAA-AscI- gcgatgaattcggcgcgccTTACAGGAACGATGGGTTTGCGTTTG EcoRI (SEQ ID NO: 69) - The yeast expression vector YEpENO-BBH was created to facilitate heterologous expression under control of the S. cerevisiae enolase 1 (ENO1) gene promoter and terminator. The vector was also useful because the expression cassette from this vector could be simply excised using a BamHI, BglII digest. YEpENO1 (Den Haan et al., Metabolic Engineering. 9: 87-942007) contains the YEp352 backbone with the ENO1 gene promoter and terminator sequences cloned into the BamHI and HindIII sites. This plasmid was digested with BamHI and the overhang filled in with Klenow polymerase and dNTPs to remove the BamHI site. The plasmid was re-ligated to generate YEpENO-B. Using the same method, the BglII and then the HindIII sites were subsequently destroyed to create YEpENO-BBHtemplate. YEpENO-BBHtemplate was used as template for a PCR reaction with primers ENOBB-left (5′-GATCGGATCCCAATTAATGTGAGTTACCTCA-3′ (SEQ ID NO: 70)) and ENOBB-right (5GTACAAGCTTAGATCTCCTATGCGGTGTGAAATA-3′ (SEQ ID NO; 71)) in which the ENO1 cassette was amplified together with a 150 bp flanking region upstream anti 220 bp downstream. This product was digested with BamHI and HindIII and the over hangs filled in by treatment with Klenow polymerase and dNTPs and cloned between the two PvuII sites on yENO1 effectively replacing the original ENO1 cassette and generating YEpENO-BBH.
- Codon optimized versions of Humicola grisea cbh1 (Hgcbh1), Thermoascus aurantiacus cbh1 (Tacbh1) and Talaromyces emersonii cbh1 and cbh2 (Tecbh1 and Tecbh1) were designed and synthetic genes were ordered from GenScript Corporation (Piscataway, N.J., USA). These four synthetic cbh encoding genes received from GenScript Corporation were cloned onto the plasmid pUC57. The resulting vectors were digested with EcoRI and XhoI to excise the cbh genes which were subsequently cloned into an EcoRI and XhoI digested YEpENO-BBH. This created the plasmids pRDH103 (with Hgcbh1), pRDH104 (with Tacbh1), pRDH105 (with Tecbh1) and pRDH106 (with Tecbh2) with the cbh encoding genes under transcriptional control of the ENO1 promoter and terminator. Additionally, pRDH101 was created to express the T. reesei CBH1 from pBZD_10631_20641. Takara ExTaq enzyme was used as directed and to amplify the sTrcbh1 from pBZD_10631_20641 using primers sCBH1/2 L and sCBH1R. The fragment was then isolated and digested with EcoRI and XhoI. YEpENO-BBH was also digested with EcoRI and XhoI and the relevant bands were isolated and ligated. A 1494 bp fragment encoding the T. reesei cbh1 gene was amplified from the plasmid pBZD_10631_20641, with primers sCBH1/2-L and sCBH2 R (5′-CAGTCTCGAGTTACAAGAAAGATGGGTTAGC-3′ (SEQ ID NO: 61)). digested with EcoRI and XhoI and cloned into the EcoRI and XhoI sites of pJC1 (Crouse el ah, Curr. Gen. 28: 467-473 (1995)) placing if under transcriptional control of S. cerevisiae phosphoglycerate kinase 1 (PGK1) gene promoter and terminator. This plasmid was designated pRDH107. Subsequently the expression cassettes from pRDH103, pRDH104 and pRDH105 were excised with BamHI and BglII digestion and cloned into the BamHI site of pRDH107 to yield pRDH118, pRDH120, pRDH108 and pRDH109, respectively. pRDH1109 contains the same expression cassettes as pRDH105 but in pRDH105 the gene expression cassettes are in the reverse orientation relative to each other. These plasmids and their basic genotypes are summarized in Table 4.
- Two additional 2-micron vectors for expression of Chrysosporium lucknowense CBH2b and the T. emersonii CBH1 with a c-terminal fusion of the CBM of T. reesei CBH1 were also created. The fusion between T. emersonii cbh1 and the CBM of T. reesei cbh1 was generated by ligation of three fragments. Table 5 lists the oligonucleotides used for these constructs. A PCR product was amplified with the oligonucleotides 395 Te cbhI Syntl PacI-ATG and 398 Te chhI synt core SmaI using pRDH105 as the template, digested with PmlI and SmaI and the 800 bp fragment was Isolated. A second PCR product was amplified with oligonucleotides 399 Trcbh1 synt CBM5 MlyHIincII and 400 Trcbh1 synt CBM AscIXhoI with pRDH101 as the template, digested with MlyI and XhoI and the 180 bp fragment was isolated. The two PCR fragments were ligated with the 6.9 kb PmlI-XhoI fragment of pRDH105 resulting in pMU624.
- The genomic 3900 bp DNA sequence of Chrysosporium lucknowense cbh2b gene (described in Published United States Patent Application No: 2007/0238155) was analyzed for putative in Irons using the NetAspGene 1.0 Server (http://www.cbs.dtu.dk/services/NetAspGene/). Removal of the predicted introns from the genomic sequence resulted in an open reading frame of 482 amino acids which was synthesized at Codon Devices and codon optimized for expression in S. cerevisiae and cloned into pUC57 vector. Plasmid pAJ401 (Saloheimo et al. Mol. Microbiol. 13:219-228, 1994), which contains the PGK1 promoter and terminator, was modified for expression of T. reesei cbh2 between Pad and AscI restrictions sites. The PGK1 promoter was amplified with primers 379 ScPGK1prom −786 SacI+ApaI and 380 ScPGK1prom EcoRI-PacI and pAJ41Q as the template and digested with Pad and EcoRI. The T. reesei cbh2 ORF was amplified from pTTc01 (Teeri et al., Gene 57:43-52, 1987) with oligonucleotides 381 CBH2 WT EcoRI-PacI-ATG and 386 CBH2 WT TAA-AscI-EcoRI, digested with Pad and EcoRI, and ligated with the SacI-EcoRI digested pAJ401 resulting in pMI508. The Pact-AscI fragment in pMI508 was replaced by a synthetic 1.4 kb T. reesei eglI gene resulting in pM1522. The 1.9 kb fragment of pM1522 was digested with PmlI and XhoI and ligated to the 6.4 kb PmlI-XhoI fragment of pRDH107 resulting in pMI568. pMI568 was digested with Pad and AscI and the 7 kb fragment was ligated to the 1.5 kb fragment of pMI558 producing pMU784 for the expression of C. lucknowense cbh2b.
- A set of 2-micron vectors was also constructed for the expression of endoglucanases in S. cerevisiae, as well as related plasmids to act as controls. pMU451 was created as a control vector and for cloning the cellulases under control of the ENO1 promoter and terminator. This was done by adding a Pad/AscI linker into the EcoRI/XhoI site of pMU451. Synthetic genes ordered from Codon Devices and received in pUC57 were cloned into this vector as PacI/AscI fragments. Vectors created this way and listed in Table 4 are: pMU458, pMU463, pMU465, pMU469, pMU471, pMU472, pMU473, pMU475, pMU499, pMU500, and pMU503.
- Vectors for integrating secreted versions of cellulases at the delta integration sites in S. cerevisiae, or for integration into the genome of K. marxianus were created from the pBKD_1 and pBKD_2 constructs. The S. fibuligera BGL1 (SfBGLI) was cloned by PCR from ySFI (van Rooyen el al., J. Biotechnol 120: 284-95 (2005)). The endoglucanase (TrEGI) used was the sequence give in Table 1. The cellulase encoding genes were cloned via PCR (using Pad and AscI sites) into pBKD_1 and pRKD_2—to create pBKD1-BGL1 and pBKD2-sEG1. The ENO1P-sEG1-ENO1T cassette from pBKD2-sEG1 was subsequently sub cloned as a SpeI, NotI fragment to pBKD1-BGL1 to create pBKD1-BGL1-sEG1.
- pMU562, used for integrating cellulases into K. maximus, was generated by cutting with pMU185 (pUG66) with NotI and isolating a 1190 bp lox P ZeoR containing insert. This insert was ligated into a NotI digested 4.5 Kb delta-integration vector to produce pMU562. pMU576 was generated by cutting T. reesei CBH2 containing plasmid pMU291 with AscI/PacI, isolating a 1491 bp CBH12 gene and ligating it into delta-integration vector pMU562 cut with AscI/PacI. pMU577 was generated by cutting T. emersonii CBH1 from pMU398 with AscI/PacI, isolating a 1380 bp CBH1 gene and ligating into delta-integration vector pMU562 cut with AscI/PacI. Similarly, a set of recombinant cellulase constructs (pMU661 to pMU668 and pMU750, pMU755, pMU809—see Table 4), including a variety of endoglucanases and cellobiohydrolases, was incorporated into pMU562 for co-transformation. Synthetic sequences for these cellulase genes were originally obtained from Codon Devices and subsequently cloned into 2μ expression vectors for use in S. cerevisiae. They were then transferred from these vectors to the integrating vectors as detailed (including digests used) in Table X. Together these constructs formed a library that could be transformed separately or together and then screened by activity assay. Constructs were digested with enzymes that cut inside of, or very closely outside of, the delta sequences for integration. Similar constructs for integrating cellulases using the hygromycin marker (pMU721, pMU760, and pMU761) were also built.
- Yeast Transformation
- For routine transformation of whole plasmids in S. cerevisiae, standard chemical transformation was used (Sambrook a al. Molecular cloning: A laboratory manual. New York: Cold Spring Harbor laboratory Press (1989)). For some transformations, a modified protocol described by Hill et al. (Nucleic Adds Res. 19: 5791 (1991)) was used.
- A protocol for electrotransformation of yeast was developed based on Cho et al. (1999) and on Ausubel et. al. (1994). Linear fragments of DNA were created by digesting pBD1-BGL1-sEG1 with AccI. AccI has a unique site in the 8 sequence. The fragments were purified by precipitation with 3M NaAc and ice cold ethanol, subsequent washing with 70% ethanol, and resuspension in USB dH2O (DNAse and RNAse free, sterile. water) after drying in a 70° C. vacuum oven.
- S. cerevisiae cells for transformation were prepared by growing to saturation in 5 mL YPD cultures, 4 mL of the culture was sampled, washed 2× with cold distilled water, and resuspended in 640 μL cold distilled water. 80 μL of 100 mM Tris-HCl, 10 nM EDTA, pH 7.5 (10× TE buffer—filter sterilized) and 80 μL of 1 M lithium acetate, pH 7.5 (10×LiAc—filter sterilized) were added, and the cell suspension was incubated at 30° C. for 45 min. with gentle shaking. 20 μL of 1M DTT was added and incubation continued for 15 min. The cells were then centrifuged, washed once with cold distilled water, and once with electroporation buffer (1M sorbitol, 20 mM HEPES), and finally resuspended in 267 μL electroporation buffer. The same protocol was used for transforming K. lactis and K. marxianus strains, except that 50 mLs of YPD was inoculated with 0.5 mL from an overnight culture, grown for 4 hours at 37° C., and then centrifuged and prepared as above. Additionally, incubations and recovery steps were carried out at 37° C.
- For electroporation, 10 μg of linearized DNA (measured by estimation on a gel) was combined with 50 μL of the cell suspension in a sterile 1.5 mL microcentrifuge tube. The mixture was then transferred to a 0.2 cm electroporation cuvette, and a pulse of 1.4 kV (200μ, 25 μF) was applied to the sample using the Biorad Gene Pulser device. 1 mL of YPD with 1M sorbitol adjusted to pH 7.0 (YPDS) was placed in the cuvette and the cells were allowed to recover for ˜3 hrs. 100-200 μL cell suspension were spread out on YPDS agar plates with appropriate antibiotic, which were incubated at 30° C. for 3-4 days until colonies appeared.
- Yeast Strains
- The yeast strains listed in Table 6 were created using the vectors and transformation protocols as described.
-
TABLE 6 Yeast Strains. Background Genes expressed and/or Name strain knocked out Constructs M0013 Saccharomyces Genotype: α, leu2-3,112 ura3-52 None cerevisiae his3 trp1-289 Y294 (ATCC 201160) M0243 M0013 SfBGLI, TrEGI pBKD1-BGLI-sEGI M0244 M0013 SfBGLI, TrEGI (native sequence) pCEL5 M0247 M0013 TeCBH1; delta FUR1 pRDH105 M0248 M0013 TrCBH2, TeCBH1; delta FUR1 pRDH108; pDF1 M0249 M0013 None (control); delta FUR1 pJC1; pDF1 M0265 M0013 HgCBHI; delta FUR1 pRDH103; pDF1 M0266 M0013 TaCBHI; delta FUR1 pRDH104; pDF1 M0282 M0248 SfBGLI, TrEGI, TrCBH2, pBKD1-BGLI-sEGI; TeCBH1; delta FUR1 pRDH108; pDF1 M0284 M0243 SfBGLI, TrEGI, TrCBH2, pBKD1-BGLI-sEGI; HgCBH1; delta FUR1 pRDH118; pDF1 M0286 M0243 SfBGLI, TrEGI, TrCBH2, pBKD1-BGLI-sEGI; TaCBH1; delta FUR1 pRDH120; pDF1 M0288 M0243 SfBGLI, TrEGI, TrCBH2, pBKD1-BGLI-sEGI; TeCBH1; delta FUR1 pRDH108; pDF1 M0289 M0013 TrCBH2, HgCBH1; delta FUR1 pRDH118; pDF1 M0291 M0013 TrCBH2, TaCBH1; delta FUR1 pRDH120; pDF1 M0358 M0282 SfBGLI, TrEGI, TrCBH2, pBKD1-BGLI-sEGI; TeCBH1; delta FUR1; Trp1; His3 pRDH108; pDF1 M0359 M0288 SfBGLI, TrEGI, TrCBH2, pBKD1-BGLI-sEGI; TeCBH1; delta FUR1; Trp1; His3 pRDH108; pDF1 M0361 M0249 None (control); delta FUR1; pJC1; pDF1 Trp1; His3 M0157 Kluyveromyces None None marxianus (ATCC #10606) M0158 Kluyveromyces None None lactis (ATCC #34440) M0411 M0158 (colony SfBGLI, TrEGI pBKD1-BGLI-sEGI; #1) M0412 M0158 (colony SfBGLI, TrEGI pBKD1-BGLI-sEGI; #2) M0413 M0157 (Colony SfBGLI, TrEGI pBKD1-BGLI-sEGI; #1) M0414 M0157 (Colony SfBGLI, TrEGI pBKD1-BGLI-sEGI; #2) M0491 M0414 SfBGLI, TrEGI, TeCBH1, pBKD1-BGLI-sEGI; TrCBH2 pMU576 and pMU577 M0599 M0414 SfBGLI, TrEGI, TeCBH1, pBKD1-BGLI-sEGI; TrCBH2 pMU760 and pMU761 M0600 M0414 SfBGLI, TrEGI, TeCBH1, pBKD1-BGLI-sEGI; TrCBH2 pMU760 and pMU761 M0601 to M0414 (11 SfBGLI, TrEGI, pBKD1-BGLI-sEGI; M0604; colonies Cl(a)EG, CfEG, NtEG, CaEG, pMU663, pMU755, M0611 to displaying MdEG, NwEG, RsEG, TeCBH1, pMU809, pMU576, M0617 highest TeCBH1 + CBD, TrCBH2, pMU661, pMU662, avicelase Cl(b)CBH2 pMU664, pMU665, activity) pMU667, pMU668, pMU750, pMU577 M0618 to M0157(8 Cl(a)EG, CfEG, NtEG, CaEG, pMU663, pMU755, M0625 colonies MdEG, NwEG, RsEG, TeCBH1, pMU809, pMU576, displaying TeCBH1 + CBD, TrCBH2, pMU661, pMU662, highest Cl(b)CBH2 pMU664, pMU665, avicelase pMU667, pMU668, activity) pMU750, pMU577 yENO1 M0013 ENO1 P/T YEpENO-BBH; pDF1 M0419 M0013 ENO1 P/T pMU451 M0420 M0013 TeCBH1 pMU272 M0423 M0013 TrEG1 pMU463 M0424 M0013 SfBGL1 pMU464 M0426 M0013 RfEG pMU469 M0446 M0013 Cl(a)EG pMU465 M0449 M0013 CfEG pMU471 M0450 M0013 NtEG pMU472 M0460 M0013 MdEG pMU499 M0461 M0013 RsEG pMU500 M0464 M0013 NwEG pMU503 M0476 M0013 NfEG pMU458 Y294/pMI529 M0013 TeCBH1 + CBM pMU624 fur1Δ Y294/pMI553 M0013 TrCBH2, TeCBH1 + CBM pMI553 fur1Δ Y294/pMI574 M0013 Cl(b)CBH2 pMI574 fur1Δ Y294/pMI577 M0013 TrCBH2, HgCBH1 pMI577 fur1Δ Y294/pMI578 M0013 TrCBH2, TeCBH1 pMI578 fur1Δ Y294/pMI579 M0013 TrCBH2, Cl(b)CBH1 pMI579 fur1Δ Y294/pMI580 M0013 Cl(b)CBH2, TeCBH1 + CBM pMI580 fur1Δ Y294/pMI581 M0013 Cl(b)CBH2, TeCBH1 pMI581 fur1Δ Y294/pMI582 M0013 Cl(b)CBH2, HgCBH1 pMI582 fur1Δ Y294/pMI583 M0013 Cl(b)CBH2, Cl(b)CBH1 pMI583 fur1Δ - The plasmid pBKD1-BGL1-sEG1 (pMU276) was digested with AccI and transformed to S. cerevisiae Y294 by electrotransformation to create a strain with delta integrated copies of the SfBGLI and TrEGI, designated M0243. Episomal plasmids were then transformed to S. cerevisiae Y294 and/or M0243.
- To create autoselective S. cerevisiae strains, i.e. strains that can be grown in medium without requiring selective pressure to maintain the episomal plasmid, strains were transformed with NsiI & NcoI digested pDF1 and selected on SC-ura-leu plates. This lead to the disruption of the FUR1 gene of S. cerevisiae, PCR was used to confirm FUR1 disruption with primers FUR1-left (5′-ATTTCTTCTTGAACCATGAAC-3′ (SEQ ID NO: 72)) and FUR Fright (5CTTAATCAAGACTTCTGTAGCC-3′ (SEQ ID NO: 73)). where a 2568 bp indicated a disruption.
- M0282 was created by transforming M0248 with AccI digested pBKD1-BGL1-sEGI, as described above, except that the transformation mixture was spread on plated containing 10 g/L BMCC with 10 g/L yeast extract and 20 g/L peptone.
- The presence of integrated genes was verified by colony PCR for Kluyveromyces strains. Selected yeast strains were made prototrophic by transforming with PCR products for genes to complement their auxotrophies.
- Cellulosic Substrates for Enzyme Assays
- Bacterial microcrystalline cellulose (BMCC) was a gift from CP Keleo company. BMCC as received was stirred O/N at 4 C in water. After the substrate was rehydrated, it was washed 6 times with water and resuspended in water. The dry weight of the substrate was measured by drying samples at 105 C until constant weight was obtained.
- Avicel PH105 (FMC Biopolymers) was used as provided by the manufacturer.
- Pretreated mixed hardwoods were generated by autohydrolysis of the substrate at 160 PSI for 10 minutes. Pretreated material was washed 5 times to remove inhibitors and soluble sugars and resuspended in distilled water. Samples were dried overnight at 105 C to determine the dry weight. Analysis of sugar content by quantitative saccharification showed a 50% glucan content.
- Phosphoric acid swollen cellulose (PASO was prepared as in Zhang and Lynd (2006), with only slight modifications. Avicel PIT 105 (10 g) was wetted with 100 mL of distilled water in a 4 L flask. 800 mL of 86.2% phosphoric acid was added slowly to the flask with a first addition of 300 mL followed by mixing and subsequent additions of 50 mL aliquots. The transparent solution was kept at 4° C. for 1 hour to allow complete solubilization of the cellulose, until no lumps remained. In the reaction mixture. Next, 2 L of ice-cooled distilled water was added in 500 mL aliquots with mixing between additions. 300 mL aliquots of the mixture were centrifuged at 5,000 rpm for 20 minutes at 2° C. and the supernatant removed. Addition of 300 mL cold distilled water and subsequent centrifugation was repeated 4×. 4.2 mL of 2M sodium carbonate and 300 mL of water were added to the cellulose, followed by 2 or 3 washes with distilled water, until the final pH was ˜6. Samples were dried to constant weight in a 105° C. oven to measure the dry weight.
- Enzyme Assays
- β-glucosidase activity was measured in a manner similar to McBride, J. E., et ah, (Enzyme Microb. Techol. 37: 93-101 (2005)), except that the volume of the assay was decreased and the reaction performed in a microliter plate. Briefly, yeast strains were grown to saturation in YPD or YPC media with or without appropriate antibiotics, the optical density at 600 nm (OD(600)) was measured, and an 0.5 ml, sample of the cultures was taken. This sample was centrifuged, the supernatant was separated and saved, and the cell pellet was washed 2×50 mM citrate buffer, pH 5.0. Reactions for supernatants were made up of 50 μL sample, 50 μL citrate buffer, and 50
μL 20 mM p-nitrophenyl-β-D-glucopyranoside (PNPG) substrate. Reactions with washed cells consisted of 25 μL of cells, 75 μL citrate buffer, and 50 μL PNPG substrate. If the activity was too high for the range of the standard curve, a lower cell concentration was used and the assay was re-run. The standard curve consisted of a 2-fold dilution series of nitrophenol (PNP) standards, starting at 500 nM, and ending at 7.8 nM, and a buffer blank was included. After appropriate dilutions of supernatant or cells were prepared, the microtiter plate was incubated at 37° C. for 10 minutes along with the reaction substrate. The reaction was carried out by adding the substrate, incubating for 30 min., and stopping with 150 μL of 2M Na2CO3. The plate was then centrifuged at 2500 rpm for 5 minutes, and 150 μL of supernatant was transferred to another plate. The absorbance at 405 nm was read for each well. - Endoglucanase activity was qualitatively detected by observing clearing zones on synthetic complete media (as above, but including 20 g/L glucose) plates with 0.1% carboxymethyl cellulose (CMC) stained with congo red (Beguin, Anal. Biochem. 131: 333-6 (1983)), Cells were grown for 2-3 days on the plates and were washed off the plate with 1M Tris-HCL buffer pH 7.5. The plates were then stained for 10 minutes with a 0.1% Congo red solution, and extra dye was subsequently washed off with 1M NaCl.
- CBH1 activity was detected using the substrate 4-Methylumbelliferyl-β-D-lactoside (MULac). Assays were carried out by mixing 50 μL of yeast supernatant with 50 μL of a 4 mM MUlac substrate solution made in 50 mM citrate buffer pH 5.5. The reaction was allowed to proceed for 30 minutes and then stopped with 1M Na2CO3. The fluorescence in each well was read in a microtiter plate reader (ex. 355 nm and em. 460 nm).
- Quantification of Enzyme Activity
- Enzyme activity on PASC and Avicel were measured using the protocol described in Den Haan el al., Enzyme and Microbiol Technology 40: 1291-1299 (2007). Briefly, yeast supernatants were incubated with cellulose at 4° C. to bind the cellulase. The cellulose was then filtered from the yeast supernatant, resuspended in citrate buffer and sodium azide, and incubated at 37° C. Accumulation of sugar was measured in the reaction by sampling and performing a phenol-sulfuric acid assay. (See Example 10 and Table 9.)
- Avicel activity levels were also generated using a 96-well plate method. (See Example 2.) Strains to be tested were grown in YPD in deep-well 96 well plates at 35° C. with shaking at 900 RPM. After growing, plates were centrifuged at 4000 rpm for 10 min. 300 μL substrate (2% avicel, 50 mM sodium acetate buffer, 0.02% sodium azide, 8-glucosidase—1 μL per mL) was added to a new 96-well deep well plate, without allowing the avicel to settle. 300 μL of yeast supernatant was added to this substrate, and 100 μL was taken for an initial sample. Tire assay plate is incubated at 35° C., with shaking at 800 rpm. and samples were taken at 24 and 48 hours. Samples were placed in 96-well PCR plates, and spun at 2000 rpm for 2 minutes. 50 μL of supernatant was then added to 100 μL of DNS reagent previously placed in a separate 96 well PCR plate, mixed, and heated to 99° C. for 5 minutes in a PCR machine, followed by cooling to 4° C. 50 μL was transferred to a microtiter plate and the absorbance was measured at 565 nm. The conversion of avicel was calculated as follows:
-
- Y—% of Avicel converted at 24 or 48 hrs
S—DNS/glucose calibration slope, that is 0.1 for DNS at 565 nm
A—Avicel concentration at T=0 that is 10 g/L for 1% Avicel - In order to test the ability of Kluyveromyces to express functional heterologous cellulases, two Kluyveromyces strains, Kluyveromyces marxianus (ATCC strain #10606; MO157) and Kluyveromyces lactis (ATCC strain #34440), were transformed with vectors encoding heterologous cellulases.
- Vectors containing yeast delta integration sequences, the KanMX marker and sequences encoding Sf. BGLI and T.r. EGI (pBKD-BFLI-sEG1) were transformed into Kluyveromyces according to the yeast transformation protocol as described above, and selected on G418. Transformants were verified by PCR and then tested by CMC assay. The results are shown in
FIG. 1 . The presence of the heterologous cellulase activity is indicated by a clearing zone on the CMC plate. As shown inFIG. 1 , neither an untransformed K. lactis strain (colony 8) or an untransformed K. marxianus strain (colony 16) showed endoglucanase activity. However, 6 of 7 transformed K. lactis colonies showed CMCase activity, and all 7 transformed K. marxianus colonies showed CMCase activity. MO413 and MO414 were identified as two K. marxianus colonies showing CMCase activity. - The ability of Kluyveromyces to express functional heterologous cellobiohydrolases was also examined. In these experiments, K marxianus (MO157) was transformed with constructs containing T. reesei CBH2. T. emersonii CBH1 or both. Similarly, MO414 (K, marxianus transformed with Sf BGLI and T.r, EGI) was transformed with constructs containing T. reesei CBH2, T. emersonii CBH3 or both.
- Transformations were performed as described in above. CBH1 activity was then detected using the substrate 4-Methylumbelliferyl-β-D-lactoside (MU-Lac) as described above. The assay was performed on eight colonies of each transformant and the three colonies showing the highest activity were averaged. The results are shown in
FIG. 2 and demonstrate that strains transformed with T. emersonii CBH1 had high MU-lac activity. - The activity of Kluyveromyces strains expressing heterologous cellobiohydrolases on Avicel was also assessed. In one experiment, MO413 was transformed with vectors containing T. reesei CBH2 and T. emersonii CBH1 coding sequences along with a zeocin marker. Novel strain MO491 was created by this transformation and showed MU-lactoside activity. In a second experiment, MO413 was transformed with vectors containg T. reesei CBH2 and T. emersonii CBH1 coding sequences along with a hygromycin marker, and strains MO599 and MO600 were isolated from this transformation. Activity on Avicel was assessed at 48 hours as described above, and the results, shown in
FIG. 3 , demonstrate that Kluyveromyces expressing heterologous cellulases have Avicelase activity at 35° C. Avicelase activity at 45° C. was also demonstrated (data not shown). - Kluyveromyces strains were also created by transforming yeast with a library of cellulases (creation of library was described above). For example, MO413 was transformed with a library of cellulases containing a zeocin marker to produce novel strains MO601-MO604 and MO611-MO617. In addition, MO157 (K. maximus) was transformed with the same library and novel strains MO618-MO625 were identified. Activity on Avicel was assessed at 48 hours as described above, and the results, shown in
FIG. 3 , demonstrate that Kluyveromyces transformed with a library of heterologous cellulases also have Avicelase activity at 35° C. Transformants oi MO157 with the library showed the highest activity. Avicelase activity at 45° C. was also demonstrated (data not shown). - In order to determine if Kluyveromyces expressing heterologous cellulases could produce ethanol from Avicel, precultures were grown in for 24 hours in YPD (YPD as above, with 20 g/I. glucose; 25 mL in a 250 ml, shake flask) with shaking at 300 rpm at 35° C. After 24 and 48 hours, 40 g/L of additional glucose was added. At 72 hours, the pH of the cultures was adjusted to ˜5.0 with citrate buffer (initial pH of buffer was 5.5, final concentration was 50 mM), and the culture was added to a seated plastic shake flask containing 5.5 grams of Avicel (
final concentration 10% (w/v). Avicel PH105 (FMC Biopolymers) was used as provided by the manufacturer. The culture was incubated at 35° C. with shaking at 150 rpm. - Quantification of ethanol in fermentation samples was carried out by HPLC analysis, and initial ethanol concentrations in bottles (from precultures) was subtracted from all subsequent data points (initial ethanol concentrations ranged between 0 and about 6 g/L). The initial glucose concentration for all strains except MO603 was 0.000 g/L. For this strain it was 0.069 g/L, which would result in a maximum in 0.035 g/L of ethanol from the initial sugar.
- The results, as shown in
FIG. 4 , demonstrate that Engineered K. marxianus strains were also able to produce ethanol directly front Avicel. Strain MO157, the untransformed control, showed a steady decrease in ethanol concentration over the course of the experiment. This is due to ethanol consumption by the strain because of the presence of a small amount of oxygen in the flasks. - Of the two strains transformed with T. reesei CBH2 and T. emersonii CBH1 with the hygromycin marker (MO599 and M600), one (MO599) showed ethanol production. In addition, of the five strains transformed with T. reesei CBH2 and T. emersonii CBH1 with the zeocin marker, four (MO601, MO602, MO604 and MO491) showed ethanol production. This demonstrates that engineered thermotolerant K. maximus are capable of producing ethanol directly from the recalcitrant crystalline cellulose, Avicel.
- S. cerevisiae expressing heterologous cellulases were also produced and tested for their ability to grove on media containing bacterial microcrystalline cellulose (BMCC). In these experiments, microaerobie conditions were maintained by growing strains on BMCC in scaled hungate tubes with an air atmosphere.
- Strains expressing T. emersonii CBH1 and T. reesei CBH2 (MO248) were transformed with a construct allowing T. reesei EGI and S. fibuligera BGLI expression (pKD-BGLI-sEGI). That transformation was plated on a BMCC solid agar plate and five colonies appeared on the plate after seven days (data not shown). Yeast from the largest of the five colonies was isolated as strain MO282. (MO282 is described in more detail above.) The three control strains were tested for growth on the same plates. One strain expressed with T. emersonii CBH1 and T. reesei CBH2, and two strains expressed T. reesei EGI and S. fibuligera BGLI. No colonies appeared on plates with control yeast strains (data not shown).
- The ability of MO282 to grow on BMCC was also tested using liquid media.
FIG. 5 shows that MO2S2. which expresses all 4 secreted cellulases grew to a much greater extent on BMCC than a plasmid only control (MO249), a strain expressing only T emersonii CBH1 and T. reesei CBH2 (MO249), and a strain expressing 4 tethered cellulases (MO144). - These results indicate that yeast expressing secreted T. emersonii CBH1, T. reesei CBH2, T. reesei EGI and S. fibuligera BGLI heterologously are able to grow on bacterial microcrystalline cellulose.
- In order to determine if transformed S. cerevisiae can produce ethanol directly from cellulose without exogenously added cellulase enzymes, transformed strains were grown on Avicel as the sole carbon source. Avicel PH105 (FMC Biopolymers) was used as provided by the manufacturer.
- Avicel media was made using the non-glucose components of synthetic complete medium for yeast including, yeast nitrogen base without amino acids—6.7 g/L, and supplemented with a complete amino acid mix (complete supplemental mixture), In some cases yeast extract (10 g/L) and peptone (20 g/L) (YP) were used as supplements in growth experiments. Cultivation conditions were anaerobic and were maintained by Hushing sealed glass bottles with N2 alter carbon source addition and before autoclaving. Non-carbon media components were added as 10× solutions by filter sterilizing after autoclaving. Inoculation into Avicel cultures was done at 20% by volume. Quantification of ethanol in fermentation samples was carried out by HPLC analysis, and initial ethanol concentrations in bottles (from precultures) was subtracted from all subsequent data points.
- As shown in
FIG. 6 , Strain MO288 (expressing S. fibuligera BOLT, T. reesei EGI, T. reesei CBH2, and 71 emersonii CBH1) was able to produce ethanol directly from avicel PH105 as compared to the control strain (MO249) when YNB media components were used. - The ability of MO288 to produce ethanol from cellulose was also demonstrated using pretreated hardwoods. Pretreated mixed hardwoods were generated by autohydrolysis of the substrate at 160 PSI for 10 minutes. Pretreated material was washed 5 times to remove inhibitors and soluble sugars and resuspended in distilled water. Samples were dried overnight at 105° C. to determine the dry weight. Analysis of sugar content by quantitative saccharification showed a 50% glucan content. Media and culture conditions were as described above for Avicel experiments except that cultures were inoculated at 10% by volume.
- The data presented in
FIG. 7 demonstrates that MO288 was also able to make ethanol from pretreated hardwoods without added enzyme. The strain made ˜0.5 g/L more than the control when YP was used as media, and ˜0.2 g/i, when YNB was used. - These data demonstrate that yeast expressing secreted T. emersonii CBH1, T. reesei CBH2, T. reesei EGI and S. fibuligera BGLI heterologously are able to produce ethanol from cellulose without the addition of any exogenous cellulases.
- Production of ethanol from biomass is currently achieved using an SSF type of process where cellulase enzymes are added exogenously to a reaction containing pretreated cellulosic biomass, yeast growth media, and yeast. In order to determine if yeast expressing recombinant cellulases could improve this process, recombinant yeast expressing secreted cellulases were cultured in the presence of a range of exogenously added cellulase concentrations. Growth and media conditions were as described in previous examples.
- In these experiments, a recombinant yeast strain expressing four secreted cellulases (MO288) was compared directly to the control strain (MO249) under the same conditions. External cellulases were added at concentrations of 25 mg cellulase per gram cellulose (100%), 22.5 mg cellulase per gram cellulose (90%), 18.75 mg cellulase per gram cellulose (75%) or 6.25 mg cellulase per gram cellulose (25%). Experiments were also performed without adding any external cellulases (0%). Pretreated mixed hardwoods (prepared as described in examples above) at an initial solids concentration of 5% were used as a cellulose source. The data is presented in
FIG. 8 . From this data, it is clear that, the strain producing cellulases makes additional ethanol relative to the control strain for each of the cellulase loading concentrations tested. - In order to examine this effect in more detail, ethanol production at different external cellulase concentrations was evaluated in two different types of media using pretreated mixed hardwood. The results are shown in
FIG. 9 . In YP media, MO288 makes 6-9% more ethanol at the higher cellulase loadings, only 1% more at a 25% loading, and 100% more when no cellulase is loaded. In YNB media MO288 makes 20-40% more ethanol at low cellulase loadings, and ˜10% more ethanol at higher cellulase loadings. These results can be used to determine the amount of cellulase that can be removed from the process with the same overall ethanol yield being, achieved. For YP media cellulase loading can be reduced ˜15% compared to the control, and for YNB media, cellulase loading can be reduced ˜5%. At non-zero cellulase loadings ethanol productivity was increased between 5 and 20% for strains expressing cellulases in YP media as compared to the control. It was increased between 10 and 20% for strains cultured in YNB media compared to the control. - These data demonstrate that previous SSF processes can be improved in terms of ethanol yield from biomass and ethanol productivity if strains expressing secreted cellulases are used in combination with exogenously added cellulases. Similarly, cellulase loadings required to achieve a particular percentage of theoretical ethanol yield can be reduced when strains expressing recombinant cellulases are added.
- To test whether this same trend would hold at high substrate concentrations these experiments were repeated using 15% Avicel PH105 as substrate instead of 5% pretreated mixed hardwood. The results are shown in
FIGS. 10 and 11 . The strain making cellulases (MO288) routinely produced more ethanol from Avicel than the control yeast strain (MO249) under identical conditions, even at increased ethanol concentrations (FIG. 10 ). For example, when 25 mg cellulase per gram cellulose was loaded in the SSF reaction, the test strain (MO288) produced 54 g/L, while the control (MO249) produced 50 g/L. - To examine cellulase displacement the percentage of theoretical ethanol yield achieved at different cellulase loadings was determined. The results presented in
FIG. 12 were repeated in triplicate for MO288 and MO249, allowing standard deviations for the increased ethanol yields to be calculated. The data that can be used for calculating cellulase displacement is presented inFIG. 12 .FIG. 12 presents cellulase enzyme savings based on theoretical ethanol yield at 168 hours in an SSF experiment. SSF was performed in 30 ml of nitrogen purged YP+15% Avicel in pressure bottles. External cellulase mix at a ratio of 5 Spyzme:1 Novozyme-188 was used. The experiment was continued for 168 hours and sampling was done each day for ethanol estimation by HPLC. The arrows in the figure depict the necessary cellulase loading needed to achieve the same ethanol production from cellulose as the control. This loading is consistently lower than for the control (i.e. the ethanol yield is consistently higher). For data at 168 hours, the average cellulase displacement (amount less that needs to be loaded) is 13.3%±4.9%. - In order to design a CBH1 protein with efficient cellulase activity, 17 CBM1 protein sequences from NCBI database (Table 7) were aligned.
-
TABLE 7 Fungal CBH1 genes used for alignment. Organism Genbank# Neosartorya fischeri XM_001258277 Gibberella zeae AY196784 Penicillium janthinellum X59054 Nectria haematococca AY502070 Fusarium poae AY706934 Chaetomium thermophilum AY861347 Aspergillus terreus XM_001214180 Penicillium chrysogenum AY790330 Neurospora crassa X77778 Trichoderma viride AY368686 Humicola grisea X17258 Thermoascus aurantiacus AF421954 Talaromyces emersonii AAL89553 Trichoderma reesei P62694 Phanerochaete chrysosporium Z29653 Aspergillus niger XM_001391971 Aspergillus niger XM_001389539 - The artificial protein sequence was designed as a consensus (the most common) sequence for these proteins. The predicted signal sequence was exchanged by S. cerevisiae alpha mating factor pre signal sequence, and the sequence of the consensus CBH1 protein is shown below. Capital letters indicate the S. cerevisiae alpha mating factor pre signal sequence.
-
(SEQ ID NO: 43) MRFPSIFTAVLFAASSALAqqagtltacthpsltwqkctsggscttvng svvidanwrwvhatsgstncytgntwdttlcpddvtcaqncaldgadys stygvttsgnslrlnfvtqgsqknvgsrlylmeddttyqmfkllgqeft fdvdvsnlpcglngalyfvamdadggmskypgnkagakygtgycdsqcp rdlkfingqanvegwepssndanagignhgsccaemdiweansistaft phpedtigqtmeegdscggtyssdryggtcdpdgcdfnpyrmgnktfyg pgktvdttkkvtvvtqfitgssgtlseikrfyvqngkvipnsestisgv sgnsittdfetaqktafgdtddfakkgglegmgkalaqgmvlvmslwdd haanmlwldstyptdatsstpgaargscdtssgvpadveanspnsyvtf snikfgpigstftg. - An S. cerevisiae and K. lactis codon optimized sequence for expressing the CBH1 consensus sequence (SEQ ID NO:44) was developed and is shown below.
-
(SEQ ID NO: 44) atgagatttccttcaatcttcactgctgttttgttcgcagcctcaagtg ctttagcacaacaggccggaacattgacagcagaaactcatccttcctt aacctggcaaaagtgcacttctggaggttcatgcactacagtgaatgga tctgtcgtgatcgatgcaaactggagatgggttcacgcaacttcaggtt ctaccaactgttataccggaaacacttgggacaccacattgtgcccaga tgacgtcacgtgcgctcagaactgtgctttggatggagctgattacagt tcaacctatggtgtaactacatccggaaactctttgagattaaacttcg ttactcaaggaagtcaaaagaacgttggttctagattgtacttaatgga ggacgatacaacctatcaaatgttcaaattgttaggtcaggagttcacc tttgacgtagatgtcagtaacttgccatgtgggttaaacggagccttta tactttgtggcaatggatgctgacggtggaatgtccaagtatccaggaa acaaagccggtgcaaagtacggtacaggatattgtgattcacagtgccc tagagatttgaagttcattaacggtcaagcaaatgtggagggttgggaa ccatctagtaacgatgccaatgcgggtattggtaatcatgggtcctgtt gcgctgagatggatatctgggaggccaactcaatatctactgcctttac ccctcacccatgcgatacaattggtcaaactatgtgcgagggtgattca tgtggtggaacctactcctctgatagatacggaggtacatgcgatccag atggttgcgactttaatccatacagaatgggaaacaaaaccttttacgg tcctggaaagacagttgatactaccaagaaagtaacagtcgtgacccag tttatcaccggtagttctggaaccttatccgaaatcaaaagattctacg ttcagaacggtaaagtaattccaaacagtgaatctacaatttcaggagt gagtggtaattctattactaccgacttttgtacagctcagaaaacagca tttggtgacaccgatgactttgctaagaagggtggattagaaggtatgg gtaaagctttggcccagggaatggtgttagttatgtctttatgggatga tcacgccgcaaatatgttatggttggattcaacatatccaactgatgcc acaagtagtacacctggagctgccagaggttcttgtgatacatcttccg gtgttccagccgatgtagaagcaaattcctcctaactcctatgttacct tctccaatataaagtttggtccaatcggttcaacattcactggttaa - The codon optimized sequence was inserted into the episomal yeast expression vector (pMU451) under control of ENO1 promoter and terminator into PacI/AscI sites. The resulting expression constructs (pMU505) was transformed into MO375 host strain that derived from Y294 (MOO 13) in which His3 and Trp1 auxotrophies were rescued by transformation with S. cerevisiae His3 and Trp1 PGR products. The resulting strain expressing the CBH1 consensus sequence was named MO429.
- In order to determine if MO429 had cellulase activity, an Avicel conversion assay was performed as described above and measured at 24 hours. As shown in
FIG. 14 , S. cerevisiae expressing the consensus Cbh1 sequence (MO429) showed cellulase activity as compared to a negative control transformed with an empty vector (MO419). The cellulase activity of MO429 was also compared to that of yeast strains expressing other heterologous cellulases. The strains tested are summarized in Table 8 below. -
TABLE 8 Cellulytic Strains Used in Avicel Conversion Assay Strain # Description Cellulase Family Organism Activity Signal M0419 MO375 + pM none none U451 M0420 MO375 + pM CBH1 Fungi Talaromyces exo native U272 emersonii M0429 MO375 + pM fungal Fungi N/A exo S.c.αMFpre U505 CBH1 consensus M0445 MO375 + pM CBH1 Fungi Neosartorya exo S.c.αMFpre U459 fischeri M0456 MO375 + pM CBH1 Fungi Chaetomium exo S.c.αMFpre U495 thermophilum M0457 MO375 + pM CBH1 Fungi Aspergillus exo S.c.αMFpre U496 terreus M0458 MO375 + pM CBH1 Fungi Penicillium exo S.c.αMFpre U497 chrysogenum - All of the strains in Table 8 were, derived from the same parental MO375 strain and were transformed with an episomal yeast vector. MO420, MO429, MO445, MO456, MO457 and MO458 were created using episomal yeast vectors containing the heterologous cellulase genes as listed in the table which were codon optimized for expression in S. cerevisiae and K. lactis. The cellulases in MO429, MO445, MO456, MO457 and MO458 were expressed under control of S. cerevisiae ENO1 promoter and terminator. T. emersonii CBH1 was expressed with its own native signal sequence. As shown in
FIG. 14 , the secreted activity on Avicel of the consensus CBH1 was comparable with activity of other fungal CBH1 is expressed in the same vector and in the same host strain. - S. cerevisiae were transformed with polynucleotides encoding a number of different heterologous cellobiohydrolases and their activity on PASC and Avicel was assessed as described above. The results are shown in the table below:
-
TABLE 9 Cellobiohydrolase activity in S. cerevisiae. Act. (PASC) Act. (Avicel) Plasmid Expression Cassette(s) (mU/gDCW) (mU/gDCW) yENO1 ENO1p/t 2.68 ± 1.1 2.99 ± 0.7 M0265 ENO1p/t-sH.g.cbh1 32.82 ± 6.5 34.85 ± 2.0 M0266 ENO1p/t-sT.a.cbh1 38.56 ± 5.9 38.15 ± 4.1 M0247 ENO1p/t-sT.e.cbh1 75.60 ± 13.1 21.42 ± 6.1 M0248 PGK1p/t-sT.r.cbh2 & 174.35 ± 6.5 40.5 ± 4.9 ENO1p/t-sT.e.cbh1 M0289 PGK1p/t-sT.r.cbh2 & Not measured 106.2 ± 6.8 ENO1p/t-sH.g.cbh1 M0291 PGK1p/t-sT.r.cbh2 & Not measured 32.7 ± 5.7 ENO1p/t-sT.a.cbh1 - In addition, activity on Avicel was assayed using a 96-plate assay, and the results are shown in
FIG. 14 . In the Figure, for each strain, the first bar indicates the sugar released at 24 hours, and the second bar indicates the sugar released by 48 hours, CBH1s expressed individually, or in combination with T. reesei CBH2 showed some avicel activity-reaching 10% conversion of avicel in 48 hours. Combinations of CBH1 with CBH2 from C. lucknowense reached much higher avicel conversions of about 22% conversion in 48 hours in combination with T. emersonii CBH1 with CBD attached. - The avicel activity data for endoglucanases tested in S. cerevisiae is shown in
FIG. 15 . The data demonstrate that among the EGs tested the C. formosanus EG demonstrated the highest avicel activity when expressed in S. cerevisiae. - A co-culture of a number of cellulase, producing yeast strains also showed the ability to make ethanol from Avicel PH105 in YNB media (
FIG. 16 ). In thisexperiment 5 strains independently producing T. emersonii CBH1 (M0247), T. aurantiacus CBH1 (M0266), H. grisea CBH1 (M0265), a combination of T. emersonii CBH1 and T. reesei CBH2 (M0248), and a combination of T. reesei EGI and S. fibuligera BGLI (M0244) were mixed in equal proportion by volume and then inoculated at 20% by volume. Each of the heterologously expressed cellulases in each of these strains was secreted. Media and culture conditions were as described above for Avicel experiments. The data inFIG. 16 demonstrate that heterologous cellulases do not need to be expressed in an individual yeast strain in order to produce ethanol from cellulose. Instead, yeast strains expressing different secreted heterologous cellulases can be cultured together in order to produce ethanol from cellulose without the addition of any exogenous cellulases. - A co-culture using a different combination of cellulases was also evaluated. In (his set of co-culture experiments, four yeast strains were cultured together: M0566 (M0424 with FUR deletion): Secreted SfBGLI; M0592 (M0449 with FUR deletion): Secreted CfEGI; M0563 (same as Y294/pMI574 furlΔ): Secreted Cl CBH2b; and M0567 (same as Y294/pMI529 furlΔ): Secreted TeCBH1+CBD. These strains were grown in liquid YPD for 3 days, until the culture was saturate for pre-culture. At this point they were used to inoculate experiments where avicel (10%) was used as the substrate, and the 4 strains were mixed at equal volume prior to inoculation.
-
FIG. 17 demonstrates that the co-cultured strains are capable of producing ethanol directly from avicel in the absence of any added cellulose enzyme. The co-culture produces about 4-fold more ethanol after 168 hours as compared to the control strain, and about 3-fold more than MO288. - This co-culture was also used in SSF experiments where Zoomerase cellulase enzyme cocktail was used at 5 different loadings (10 mg protein/g avicel, 7.5 mg/g, 5 mg/g, and 2.5 mg/g, and 0 mg/g), and strains were inoculated at 10% by volume,
-
FIG. 18 presents the raw data for ethanol production at a variety of cellulase loadings by the co-culture, MO288, and MO249.FIG. 18A shows that at all cellulase loadings tested, the co-cultured strains produced significantly more ethanol than a control not producing cellulase.FIG. 18B shows that at all cellulase loadings tested, the co-culture produced more ethanol than the previously tested strain MO288.FIG. 19 shows the percentage of the theoretical yield of ethanol that could be achieved with each of these cultures after 168 hours of SSF using a variety of cellulase loadings. The data demonstrate that the co-cultured strains would achieve about a 2-fold reduction in cellulase relative to the control strain, and approximately a 35% reduction compared to MO288. - These data demonstrate that the combination of cellulases in this co-culture is highly efficient in the production of ethanol.
- M0509 (ATCC deposit designation ______, deposited on Nov. 23, 2009) is a strain of Saccharomyces cerevisiae that combines the ability to metabolize xylose with the robustness required to ferment sugars in the presence of pretreated hardwood inhibitors. M0509 was created in a three-step process. First, industrial strains of S. cerevisiae were benchmarked to identify strains possessing a level of robustness/hardiness sufficient for simultaneous saccharification and fermentation (SSF) of pretreated mixed hardwood substrates. Strain M0086, a diploid strain of strain of S. cerevisiae, satisfied this first requirement. Second, M0086 was genetically engineered with the ability to utilize xylose, resulting in strain M0407. Third, M0407 was adapted for several weeks in a chemostat containing xylose media with pretreatment inhibitors, generating strain M0509.
- Strain M0407 was genetically engineered from M0086 to utilize xylose. This engineering required seven genetic modifications. The primary modification was the functional expression of the heterologous xylose isomerase gene, XylA, isolated from the anaerobic fungus Piromyces sp. E2. The S. cerevisiae structural genes coding for all five enzymes involved in the conversion of xylulose to glycolytic intermediates were also overexpressed: xylulokinase, ribulose 5-phosphate isomerase, ribulose 5-phosphate epimerase, transketolase and transaldolase. In addition, the GRES gene encoding aldose reductase was deleted to minimise xylitol production. The seven modified genes are listed in
FIG. 39 . The genetic modifications at the GRE3, RKI1, RPE1, TAL1, and TKL1 loci were designed to leave behind minimal vector DMA and no antibiotic markers. Each locus' DNA was sequenced to confirm the expected results. Each of the seven genetic modifications were sequentially introduced into strain M0086.FIG. 40 shows the progression of modifications from top to bottom together with the designations for the strain at each step in the process, starting with M0086 and finishing with M0407. - The deletion of GRES and the increased expression of RKI1, RPE1, TAL1, and TKL1 involve modifications of the endogenous S. cerevisiae loci. In the case of GRES, both alleles were deleted. For the other four loci, only a single allele was modified. All of the modifications of endogenous loci required the use of selectable antibiotic markers including kanr from the Escherichia coli transposon Tn903 (confers resistance to G418), nail from Streptomyces noursei (confers resistance to clonNAT/nourseothricin), and dsdA from Escherichia coli (confers resistance to D-serine.) After selection for a desired genomic modification, the antibiotic marker was excised from the genome using the loxPlcre recombinase system. The ere recombinase was carried on plasmid pMU210 which contains a zeocin resistance marker. Loss of pMU210 as well as all antibiotic markers was tested on the appropriate selective media. Subsequent PCR genotyping and DNA sequencing confirmed removal of the antibiotic markers from the modified genomic loci.
- The overexpression of RKI1, RPE1, TAL1, and TKL1 was achieved by placing the S. cerevisiae Loose phosphate isomerase promoter, TP1, immediately 5′ of each of the four ORFs. For TAL1 and RKI1, small portions of their endogenous promoters were deleted. To avoid disruption of adjacent. ORFs and possible transcriptional regulatory elements, the introduction of the TP1 promoter at the RPE1 and TKL1 loci was done such that the RPE1 and TKL1 loci were duplicated with the duplicate copies of both loci being regulated by the TPI promoter.
- In order to boost M0407's xylose-utilization and increase its pretreatment inhibitor tolerance, the strain was maintained in a chemostat for four weeks under the following sequential conditions described in Table 10.
-
TABLE 10 Conditions to Improve M0407. Duration Residence (days) Time (h) Media 5 24 YPX, 20 g/ L xylose 5 18 YPX, 20 g/L xylose 7 24 YPX + 25% of a 30% MS129 washate (21.5 g/L xylose) 14 24 YPX + 75% of a 30% MS129 washate (~22% solids equivalent) - An aliquot of the adapted chemostat culture was plated on YPXi50% and nine M0407 “adapted” colonies were screened in YPDXi media (100 g/L glucose, 50 g/L xylose, 25% MS149 pressate). M0407 and M0228 (a xylose-utilizing strain created at Mascoma containing XlyA and XKS1 on plasmids) were included as controls. At 24 hours, the glucose had been entirely consumed by all strains, M0407 and M0228 had utilized 30 and 25 g/L of xylose respectively. All nine M0407 “adapted” colonics had utilized more than 44 g/L, of xylose. The highest amount of xylose consumed was 48 g/L. This strain was designated M0509.
- 18S rDNA sequencing was used to confirm strain M0509 as Saccharomyces cerevisiae (Kurtzman C P and Robnett, C J; FEMS Yeast Research 3 (2003) 417-432). A 1774 bp fragment spanning the 18S rDNA was amplified from M0509 genomic ON A and sent for sequencing. The 1753 bp of M0509 18S rDNA sequence exhibited a 100% match to the NCBI sequence for S. cerevisiae 18S (nucleotide accession #Z75578).
- Since strain M0509 was obtained by cultivating M0407 in a chemostat for four weeks, the length of cultivation separating tire two strains provides a means to asses the stability of the engineered genetic modifications. Comparison of the DNA sequence of M0407 and M0509 at the GRE3, RKI1, RPE1, TALL and TKL1 loci showed no changes.
- This suggests that the genetic modifications at these loci are genetically stable, at least under the growth conditions used.
- Real Time PCR analysis was used to estimate the copy number of integrations of the XylA/XKS1 vector. M0407 has approximately 10 copies of the vector, whereas M0509 has approximately 20 copies. This suggests that the copy number of the XylA/XKS1 vector can be increased by extended cultivation on xylose media.
- To further asses the stability of the XylA/XKS1 integrations, M0509 was cultivated for ˜50 generations in liquid media with either glucose or xylose as the sole carbon source. After 50 generations, an individual colony was isolated from each culture and the number of XylA/XKS1 integrations quantified and compared to the original M0509 freezer stock. The colony isolated from the xylose-culture had ˜20 copies of XylA/XKS1, the same as the freezer stock. The glucose-cultured colony exhibited a slightly decreased copy number, ˜16.
- The slight decrease in XylA/XKS1 copy number of the glucose-colony raises the question of the strain's performance. To partially address this question, xylose consumption was compared between the xylose-isolate, glucose-isolate, and freezer stock.
- The freezer and xylose-propagated isolates utilized all of the xylose in 24 hours and produced identical amounts of ethanol, but the glucose-propagated strain consumed only half as much xylose.
FIG. 20 . - M1105 is capable of fermentation at temperatures above 40° C. in the presence of 8 g/L acetate. M1105 was constructed in a M0509 background and is therefore an industrially robust strain capable of converting both glucose and xylose into ethanol.
- M1105 was isolated following four rounds of selection/adaptation in a cytostat as outlined in
FIG. 41 and described as follows. The temperature was increased from 38° C. to 41° C. during the course of the experiment. M1017 (ATCC deposit designation ______, deposited on Nov. 23, 2009) was isolated from this first cytostat nan and was later confirmed by PCR of the GRE3 locus to be a descendant of M0509. M1017 was used to inoculate a second cytostat run using YMX media (yeast nitrogen base, 2 g/L xylose) at 41° C. M1046 was isolated from this second cytostat run. At 42° C. on YPX50, M1046 grew slowly yet with a doublingtime 36% shorter than M1017. M1080 was isolated from a cytostat inoculated with M1046 and YMX media at 40° C., M1080 grew with a specific growth rate of 0.22 h−1 on YMX at 40° C. M1105 was isolated from M1080 based on selection in the cytostat using YPD2×10+acetate media (2 g/L glucose, 10 g/L xylose, 8 g/L acetate, pH 5.4) at 39° C. - M1105 grows 10-20% faster than M0509 in rich media at 35° C. In addition, M1105 has increased acetate tolerance as the strain can grow more quickly than its ancestral strains in the presence of acetate.
FIG. 21 . While, the parental strains required glucose for tolerance to acetate at high temperatures, M1105 does not require glucose or complex medium components to grow in the presence of 7 g/L acetate at pH 5.4. - To test fermentation performance, M1105 was inoculated at approximately 0.7 g/L DCW in 18% MS419 using 3.8 mg Zoomerase/g feedstock at 40° C. M1105 produced 3.55% (w/v) ethanol by 168 hours. The time course is presented in
FIG. 22 along with a similar run performed with M1088 (described below) for comparison. A similar run using only 0.15 g/L DCW for inoculum resulted in 2.9% (w/v) ethanol and some sugar accumulation during the experiment.FIG. 23 . - M1254 is capable of fermentation at temperatures above 40° C. in the presence of 12 g/L acetate, exhibiting an increased robustness relative to the thermotolerant strain M1105.
- M1254 was isolated following three rounds of selection/adaptation in a cytostat as outlined in Table 11 and
FIG. 42 and described as follows. The first cytostat run was inoculated with M1105. YMX media (yeast nitrogen base w/o amino acids, 20 g/L xylose) plus 8 g/L acetate was used at pH 5.5 and 40° C. M1155 was isolated from this first cytostat run and used to inoculate a second cytostat containing YPD media (yeast extract, peptone, 20 g/L glucose) plus 12 g/L acetate at pH 5.4 and 41° C. M1202 was isolated from this second cytostat run. M1254 was isolated from a third cytostat run inoculated with both M1155 and M1202 in yeast nitrogen base w/o amino acids+5% solids equivalent MS419 hydrolysate media at pH 4.8, 39° C. -
TABLE 11 Evolutionary Conditions to Generate M1254 from M1105. Parental New Strain(s) Evolutionary Condition Strain M1105 Xylose minimal + 8 g/L acetate, pH 5.5, 40° C. M1155 M1155 Complex glucose + 12 g/L acetate, pH 5.4, 41° C. M1202 M1155 + 5% solids equivalent MS419 hydrolysate + M1254 M1202 yeast nitrogen base w/o amino acids, pH 4.8, 39° C. - M1254 grows 7.3±0.9% faster than M1202 and 17±2.0% faster than M1155 in 5% solids equivalent MS419 hydrolysate, which is the condition under which strain M1254 was selected. However, standard fermentation medium limits fermentation performance. Accordingly, use of this strain should be with lower ammonium concentrations, such as 1.1 g/L diammonium phosphate (DAP) or lower than 3 g/L DAP. Figure. 24 demonstrates the higher fermentation rate using the lower DAP concentration. The fermentations were performed using 18% MS149, 4 mg external cellulase/g IS, 40° C. 0.5 g/L inoculation DCW M1254 and pH 5.4. The pH was controlled using 5 M potassium hydroxide, and 1 g/L magnesium carbonate was fed with each solids feeding. All enzyme was front loaded, while the solids were fed at five time points (0, 3, 6, 24, and 48 hours) in equal size feedings of 0.3.6% TS.
- MO1360 was created from M1254 using the evolutionary conditions described in Table 12 below.
-
TABLE 12 Conditions to Generate M1360 from M1254. Parental New Strain(s) Evolutionary Condition Strain M1254 Complex with low xylose + 8 g/L acetate, pH 5.4, M1339 40° C. M1339 Complex xylose + synthetic inhibitor mixture M1360 (including 8 g/L acetate), pH 5.4, 40° C. - M1360, while still substantially inhibited by the synthetic inhibitor mixture, grows at 40° C. with a doubling time of approximately 5 hours.
FIG. 25 . In industrially relevant medium, M1360 is able to generate over 60 g/L ethanol from glucose along with 5 g/L dry cell weight in 48 h at 40° C. beginning with only 60 mg/L dry cell weight.FIG. 26 . - Enzyme activity is known to increase as temperature increases, and thus it is desirable to have thermotolerant S. cerevisiae strains.
FIG. 27 shows three equivalent SSFs with 18% PHW solids loaded. The reactions carried out at 40° C. show approximately 17% more ethanol produced than the control reaction carried out at 35° C., when both reactions were earned out at the same external enzyme loading (4 mg/g). This increased performance represents a substantial cost savings for the process. - M1088 is capable of secreting three distinct cellulolytic enzymes: β-glucosidase from S. fibuligera (SfBGL), cellobiohydrolase 2b from C. lucknowense (ClCBU2b), and
cellobiohydrolase 1 from T emersonii fused to the T. reesei cellobiohydrolase I cellulose binding domain (TeCBH1+CBDTrCBH1). The M1088 genome also contains genes that encode for polypeptides capable of providing resistance to the following antibiotics: kanamycin, nourseothricin, and hygromycin B. Plasmid pMU624, which is also present in M1088, contains a gene encoding for a polypeptide capable of providing resistance to ampicillin. The steps used to generate M1088 and M0963 from M0509 are summarized in Table 13 below. -
TABLE 13 Strains Used to Generate Strains M1088 and M0963 Strain Genotype Parent Description M0509 gre3::loxP/gre3::loxP TALI+/loxP- PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 RPE1+/loxP-PTPI-RPE1 TKL+/loxP-PTPI-TKL delta::PTPI- xylA PADH1-XKS::delta M0539 URA-3/ura-3::kanMX M0509 A single copy of the genomic URA-3 gre3::loxP/gre3::loxP TALI+/loxP- gene was deleted and replaced with a PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 kanMX cassette. The KanMX gene RPEI+/loxP-PTPI-RPEI cassette provides resistance to TKL+/loxP-PTPI-TKL delta::PTPI- kanamycin (an aminoglycoside xylA PADH1-XKS::delta antibiotic). M0544 ura-3::kanMX/ura-3::kanMX M0539 The second copy of the genomic gre3::loxP/gre3::loxP TAL1+/loxP- URA-3 gene was deleted and PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 replaced with a kanMX cassette. RPE1+/loxP-PTPI-RPE1 TKL+/loxP-PTPI-TKL delta::PTPI- xylA PADH1-XKS::delta M0749 ura-3::kanMX/ura-3::kanMX M0544 A single copy of the genomic FUR-1 gre3::loxP/gre3::loxP TAL1+/loxP- gene was deleted and replaced with a PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 Streptomyces noursei nat1 cassette. RPE1+/loxP-PTPI-RPE1 The nat1 gene cassette provides TKL+/loxP-PTPI-TKL delta::PTPI- resistance to the antibiotic xylA PADH1-XKS::delta nourseothricin/clonNAT (an (pMU782)fur1::nat aminoglycoside antibiotic). M0867 FUR-1/fur-1::nat ura-3::kanMX/ura- M0749 The plasmid pMU624 was 3::kanMX gre3::loxP/gre3::loxP transformed into the strain. pMU624 TAL1+/loxP-PTPI-TAL1 can replicate in S. cerevisiae (2 RKI1+/loxP-PTPI-RKI1 micron ori and URA-3) and E. coli RPE1+/loxP-PTPI-RPE1 (pBMR ori and ampicillin resistance TKL+/loxP-PTPI-TKL delta::PTPI- gene: beta-lactam antibiotic). xylA PADH1-XKS::delta pMU624 also carries the T. emersonii (pMU782)fur1::nat; [pMU624] CBH1 + CBDTrCBH1 gene regulated by the ENO1 promoter and terminator. M0759 fur-1::hyg/fur-1::nat ura- M0867 The second copy of the genomic 3::kanMX/ura-3::kanMX FUR-1 gene was deleted and gre3::loxP/gre3::loxP TAL1+/loxP- replaced with a hygMX cassette. The PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 hygMX gene cassette encodes for a RPE1+/loxP-PTPI-RPE1 hygromycin B phosphotransferase TKL+/loxP-PTPI-TKL delta::PTPI- that confers resistance to hygromycin xylA PADH1-XKS::delta B (an aminoglycoside antibiotic). (pMU782) fur1::nat; [pMU624]; (pMU1037) fur1::hyg M1088 fur-1::hyg/fur-1::nat ura- M0759 Two distinct integration cassettes 3::kanMX/ura-3::kanMX were transformed into the strain and gre3::loxP/gre3::loxP TAL1+/loxP- multiple copies were integrated into PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 the genome at delta site. One RPE1+/loxP-PTPI-RPE1 cassette contained the cellulolytic TKL+/loxP-PTPI-TKL delta::PTPI- genes S. fibuligeria BGL and xylA PADH1-XKS::delta [pMU624] C. lucknowense CBH2b. The other (pMU1260) delta::PGKprom- cassette contained the cellulolytic SfBGL-PGKterm, ENO1prom- genes S. fibuligeria BGL and a TeCBH + TrCBD-ENO1term T. emersonii chimeric CBH1. (pMU1169) delta::PGKprom- SfBGL-PGKterm, ENO1prom- ClCBH2-ENO1term M0963 fur-1::hyg/fur-1::nat ura- M0759 Linear DNA from the 4 plasmids 3::kanMX/ura-3::kanMX shown was transformed into M0759. gre3::loxP/gre3::loxP TAL1+/loxP- 24 of the resulting colonies were then PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 passaged for a week in YPD media RPE1+/loxP-PTPI-RPE1 containing zeocin at a low level (50 TKL+/loxP-PTPI-TKL delta::PTPI- ug/mL), and assayed. The resulting xylA PADH1-XKS::delta strain M0963 was the best of those (pMU782) fur1::nat; [pMU624]; found in the avicel assay. (pMU1037) fur1::hyg; (pMU755) delta::ZeoMX, ENO1prom-TeCBH1w/TrCBD- ENO1term; (pMU809) delta::ZeoMX, ENO1prom- ClCBH2b-ENO1term; (pMU663) delta::ZeoMX, ENO1prom-CfEG-ENO1term; (pMU864) delta::ZeoMX, ENO1prom-SfBGL-ENO1term - Endoglucanases augment the activity of cellobiohydrolases, and therefore, the ability of
family 5 endoglucanases to complement the previously identified CBH1 and CBH2 was investigated. Fivefamily 5 endoglucanases were selected and cloned under control of the ENO1 promoter/terminator using the pRDH122 expression plasmid as shown in Table 14. -
TABLE 14 Family 5 endoglucanases expressed in S. cerevisiae.Theoretical Expression enzyme Organism & Gene: CBM domain: plasmid: size Da* Aspergillus kawachii C-terminal CBM1 pRDH145 55034.58 egA Heterodera schachtii C-terminal CBM2 pRDH146 43739.46 eng1 Hypocrea jecorina N-terminal CBM1 pRDH147 44226.91 (anamorph: Trichoderma reesei) eg2 Orpinomyces sp. PC-2 2x C-terminal pRDH148 53103.40 celB CBM10 Irpex lacteus en1 N-terminal CBM1 pRDH149 42357.15 - All plasmids expressing the 5 new EG2-type cellulases were transformed to Y294 (a lab strain) and M0749 (robust xylose utilizing strain; described above) and transformants were confirmed via PCR.
FIG. 28 shows several of the M0749 strains that were spotted on SC−URA plates containing 0.2% of either CMC or lichenin or barley-β-glucan. As can be seen inFIG. 28 , the M0749 reference strain yielded small zones on the CMC containing plates. Both pMU471 (Coptotermes formosanus EG) and pRDH147 based strains yielded very good clearing zones on all the tested substrates. - Along with the reference strain and a strain expressing the Coptotermes formosanus EG (pMU471), the five eg2 expressing strains ware tested for avicel and PASC hydrolysis while the cbh2 expressing strains were tested for activity on avicel. The strains were grown in double strength SC−URA medium (3.4 g/L YNB; 3 g/L amino acid dropout pool without uracil; 10 g/L ammonium sulfate; 20 g/L glucose) that was buffered to pH 6 (20 g/L succinic acid; 12 g/L NaOH, set pH to 6 with NaOH). 10 mL Cultures in 125 mL Erlenmeyer flasks were grown at 30° C. for three days. Three flasks were inoculated for each strain. Alter incubation, samples were taken for gel analysis and activity measurement. After centrifugation of the samples, 12 μl of each was taken, added to 5 μl of protein loading buffer and boiled for 5 minutes. The samples were subsequently loaded on a 10% SDS-PAGE and separated, followed by silver staining. The results are shown in
FIG. 29 . Not all strains produced visible bands in the expected size range. The C.f.EG appeared as a band of about 55 kDa as previously seen but the band produced by M0749 seems to be slightly larger than the one produced by Y294. No bands were visible for the H. schachtii eng1, Orpinomyces celB, or L. lacteus end products. The H. jecorina EG2 produced by Y294 and M0749 was visible as ˜57 kDa bands. The increased weight compared to the predicted 44 kDA size may represent hyperglycosylation. The A. kawachii EGA produced by Y294 was visible as a ˜42 kDa band. However, the A. kawachii EGA produced by M0749 was clearly visible as a ˜120 kDa band. The extra weight may signify hyperglycosylation. - All strains were tested for activity using the high-throughput avicel conversion method as prescribed. Strains expressing endoglucanases were also tested for activity on PASC. The DNS used for the assay procedure contained phenol which, according to literature, renders greater sensitivity. Activity data can be seen in
FIG. 30 . - The M0749 strain expressing H.j.eg2 (pRDH147) produced the highest levels of secreted activity as measured on PASC or avicel of the EG2s tested. The activity of this enzyme was higher on PASC and avicel than C.f.EG (pMU471). The synthetic A.k.EGA (pRDH145) also gave appreciable activity on both substrates. This product seems to have been produced at higher levels in M0749 than in Y294 and yielded greater activity than C.f.EG on avicel and PASC when produced in this strain.
- Several strains were created to test the impact of co-expressing TrEG2 with CBHs in a robust xylose utilizing strain background. M1088 was transformed with a construct to integrate TrEG2 at the rDNA locus using the Sh-ble gene as a marker (pMU1409). A similar transformation was done, but integrating TeCBH1 w/TrCBD to increase the copy number of that gene, 43 transformants front both transformations along with duplicate M1088 cultures were grown in 20 ug/ml, zeocin containing YPD and the avicel assay was performed.
FIG. 31 shows the results of those assays. The data show that a very large proportion of strains transformed with the TrEG2 construct had significantly increased avicel conversion ability, while transformants with additional TeCBH1w/TrCBD copies had only marginal improvements in avicel hydrolysis. - Of the strains assayed, the top 9 candidates were chosen and restreaked for single colonies. These single colonies were then grown in YPD with 2 transfers to equal a total of 18 generations. The final transfer (passaged data in
FIG. 32 ) was compared to the first YPD culture (original data inFIG. 32 ), The data confirms Ural there is an ˜50% increase in ability of the yeast supernatant to convert avicel when TrEG2 is overexpressed. - In addition, strain M1403, which contains heterologous genes encoding S. fibuligera (SfBGL), cellobiohydrolase 2b from C. lucknowense (CICBH2b), cellobiohydrolase I from T. emersonii fused to the T. reesei cellobiohydrolase I cellulose binding domain (TeCBH1+CBDTrCBH1), and Heterodera schachtii eng1 was produced in the M1254 background. Strain M1284, which contains heterologous genes encoding those same four cellulases was produced in the M0509 background. Strains M1284 and M1403 are described in more detail in Table 15.
-
TABLE 15 Endogluconase Expressing Yeast Strains. Strain Genotype Parent Description M1403 (pMU1339) delta::MET3prom- M1254 Linear DNA cassettes created by SfBGL-PGKterm, ENO1prom- restriction digests of plasmids were TeCBH1 + TrCBD-ENO1term integrated in multiple copies into the (pMU1260) delta::PGKprom-SfBGL- genome at the Ty1 delta sites and PGKterm, ENO1prom- rDNA sites. TeCBH + TrCBD-ENO1term (pMU1169) delta::PGKprom-SfBGL- PGKterm, ENO1prom-ClCBH2- ENO1term (pMU1409) rDNA::ZeoMX, ENO1prom-HjEG2- ENO1term M0991 gre3::loxP/gre3::loxP TAL1+/loxP- M0509 A single copy of the genomic LEU-2 PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 gene was deleted and replaced with a RPE1+/loxP-PTPI-RPE1 hygMX cassette. TKL+/loxP-PTPI-TKL delta::PTPI- xylA PTPI-XKS LEU2/leu2D::hph M0992 gre3::loxP/gre3::loxP TAL1+/loxP- M0991 The second copy of the genomic PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 LEU-2 gene was deleted and RPE1+/loxP-PTPI-RPE1 replaced with a Streptomyces noursei TKL+/loxP-PTPI-TKL delta::PTPI- nat1 cassette. xylA PTPI-XKS leu2D::hph/ leu2D::nat M1162 gre3::loxP/gre3::loxP TAL1+/loxP- M0992 A linear DNA cassette created by PTPI-TAL1 RKI1+/loxP-PTPI-RKI1 restriction digests of plasmid RPE1+/loxP-PTPI-RPE1 pMU1379 was integrated in multiple TKL+/loxP-PTPI-TKL delta::PTPI- copies into the genome at the Ty1 xylA PTPI-XKS leu2D::hph/ delta sites. leu2D::nat (pMU1379) delta::leu2-19, ENO1prom-TeCBH + TrCBD- ENO1term M1284 gre3::loxP/gre3::loxP TAL1+/loxP- M1162 Linear DNA cassettes created by PTP1-TAL1 RKI1+/loxP-PTPI-RKI1 restriction digests of plasmids RPE1+/loxP-PTPI-RPE1 pMU1169 and pMU1409 were TKL+/loxP-PTPI-TKL delta::PTPI- integrated in multiple copies into the xylA PTPI-XKS leu2D::hph/ genome at the Ty1 delta sites and leu2D::nat rDNA sites. (pMU1379) delta::leu2-19, ENO1prom-TeCBH + TrCBD- ENO1term (pMU1169) delta::PGKprom-SfBGL-PGKterm, ENO1prom-ClCBH2-ENO1term (pMU1409) rDNA::ZeoMX, ENO1prom-HjEG2-ENO1term - Expression of cellulases in yeast, particularly CBH1 (T. emersonii CBH1 w/T. reesei CBD attached), CBH2 (C. lucknowense CBH2b), EG2 (T. reesei EG2), and BGL (S. fibuligera BGL) dramatically reduces the need for externally added enzymes during enzymatic conversion of lignocellulose to ethanol. To test the effect of overexpressing these enzymes, several strains were constructed and tested on a number of substrates.
-
FIG. 33 presents data from a CBP fermentation of paper sludge by an engineered thermotolerant S. cerevisiae host strain (parent strain M1254, cellulolytic derivative M1403). The data for M1254 alone demonstrates that the addition of cellulase (i.e. zoomerase) is required for ethanol production from paper sludge. The data for M1430 where no external cellulase is added (filled orange squares), demonstrates that this strain can convert a substantial fraction (˜80%) of the “convertible” substrate by virtue of its expressed cellulases. Fermentations with additional external cellulase added to the M1403 strain demonstrate the ultimate potential of enzymatic conversion for the paper sludge substrate. Visual inspections demonstrated that the non-CBP strain was not able to liquefy the substrate, whereas the CBP strain was. - Furthermore, the CBP strain M1179, which expresses CBH1, CBH2, RG2, and BGL can convert paper sludge to a large extent without added cellulase enzyme.
FIG. 34 . The control strain in this reaction, M0509, made only a small amount of ethanol during this reaction. The data also show that. M1179 can convert this material when loaded at lower cell density (1 g/L) as opposed to the higher cell density (10 g/L) used in other reactions. This implies that the strain is able to grow and produce cellulase throughout the fermentation experiments. - Pretreated hardwood (PHW) can also be converted by CRP strains.
FIG. 35 , shows the effect of using a cellulase expressing strain (M0963), compared to a control strain not expressing celluloses (M0509) during fermentation of PHW. The comparison demonstrates that the CBP strain can achieve the same yield of ethanol from PHW when only 2 mg/g of external enzyme are loaded compared to when 4 mg/g of M0509 are loaded in the process. This 2-fold reduction in external enzyme needed represents a large potential cost reduction in the process. - CBP strains are capable of producing high ethanol titers from PHW as well,
FIG. 36 shows that a 30% washed solids fermentation can generate titers of ethanol up to about 70 g/L with minimal external enzyme loaded 4 mg/g and a relatively low cell inoculum (2 g/L). The ability of the low cell density cultivation to eventually catch up to and pass the high cell density culture indicates that the strain grows and continues to make enzyme throughout the fermentation. - In addition to PHW, corn stover has been implicated as good substrate for conversion to ethanol via an enzymatic saccharification.
FIG. 37 demonstrates that pretreated corn stover can be converted well by GBP yeast strains. The CBP strain in this experiment was able to convert about 82% of what was converted with a high enzyme loading (15 FPU, or about 20 mg/g) could achieve. The non-CBP strain made about 60% of the ethanol that the CBP strain was able to achieve. - In order to provide additional data on the expression levels of different CBH1 enzymes, selected strains were grown in YPD-medium and activities on MULac and Avicel were assayed. Both Y294 and M0749 transformants were studied, and the results are, shown in
FIG. 38 . - These examples illustrate possible embodiments of the present invention. While the invention has been particularly shown and described with reference to some embodiments thereof, it will be understood by those skilled in the art that they have been presented by way of example only, and not limitation, and various changes in form and details can be made therein without departing from the spirit and scope of the invention. Thus, the breadth and scope of the present invention should not be limited by any of the above-described exemplary embodiments, but should be defined only in accordance with the following claims and their equivalents.
- All documents cited herein, including journal articles or abstracts, published or corresponding ITS. or foreign patent applications, issued or foreign patents, or any other documents, are each entirely incorporated by reference herein, including all data, tables, figures, and text presented in the cited documents.
Claims (26)
1-211. (canceled)
212. A method of fermenting cellulose using a thermotolerant yeast host cell, said method comprising culturing said yeast host cell in a medium that contains insoluble cellulose under suitable conditions for a period sufficient to allow saccharification and fermentation of the cellulose, and wherein said yeast host cell comprising:
a. at least one heterologous polynucleotide comprising a nucleic acid which encodes an endoglucanase;
b. at least one heterologous polynucleotide comprising a nucleic acid which encodes a β-glucosidase;
c. at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellobiohydrolase I; and
d. at least one heterologous polynucleotide comprising a nucleic acid which encodes a cellobiohydrolase II;
wherein the yeast host cell can grow at a temperature of at least 35° C. or above, wherein the endoglucanase, β-glucosidase, cellobiohydrolase I, and cellobiohydrolase II are secreted; and
wherein the host cell is capable of producing ethanol from Avicel.
213. The method of claim 212 , wherein the β-glucosidase is a Saccharomycopsis fibuligera β-glucosidase comprising the amino acids of SEQ ID NO-40.
214. The method of claim 212 , wherein the cellobiohydrolase I is a Talaromyces emersonii cellobiohydrolase I comprising the amino acids of SEQ ID NO:23.
215. The method of claim 214 , wherein the Talaromyces emersonii cellobiohydrolase I is fused to a cellulose binding module (CBM).
216. The method of claim 215 , wherein the cellulose binding module (CBM) is the CBM of Trichoderma reesei Cbh1 comprising amino acids 503 to 535 of SEQ ID NO:27 or Humicola grisea Cbh1 comprising amino acids 492 to 525 of SEQ ID NO: 21.
217. The method of claim 212 , wherein the cellobiohydrolase II is a Chrysosporium lucknowense cellobiohydrolase II comprising the amino acids of SEQ ID NO:25.
218. The method of claim 212 , wherein the endoglucanase is an Humicola grisea, Thermoascus aurantiacus, Talaromyces emersonii, Trichoderma reesei, Coptotermes lacteus, Coptotermes formosanus, Nasutitermes takasagoensis, Coptotermes acinaciformis, Mastotermes darwinensis, Nasutitermes walkeri, Saccharomycopsis fibuligera, Chrysosporium lucknowense, Reticulitermes speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Chaetomium thermophilum, Aspergillus terreus, Neurospora Crassa, Reticulitermes flavipes, or Arabidopsis thaliana endoglucanase.
219. The method of claim 212 , further comprising a heterologous polynucleotide comprising a nucleic acid which encodes a second endoglucanase.
220. The method of claim 212 , wherein the β-glucosidase is a Saccharomycopsis fibuligera β-glucosidase comprising the amino acids of SEQ ID NO:40, the cellobiohydrolase I is a Talaromyces emersonii cellobiohydrolase I comprising the amino acids of SEQ ID NO:23, and the cellobiohydrolase II is a Chrysosporium lucknowense cellobiohydrolase II comprising the amino acids of SEQ ID NO 25.
221. The method of claim 220 , further comprising a second heterologous polynucleotide comprising a nucleic acid which encodes a second endoglucanase, and wherein the endoglucanase and the second endoglucanase are selected from the group consisting of Humicola grisea, Thermoascus aurantiacus, Talaromyces emersonii, Trichoderma reesei, Coptotermes lacteus, Coptotermes formosanus, Nasutitermes takasagoensis, Coptotermes acinaciformis, Mastotermes darwinensis, Nasutitermes walkeri, Saccharomycopsis fibuligera, Chrysosporium lucknowense, Reticulitermes speratus, Thermobifida fusca, Clostridum thermocellum, Clostridium cellulolyticum, Clostridum josui, Bacillus pumilis, Cellulomonas fimi, Saccharophagus degradans, Piromyces equii, Neocallimastix patricarum, Neosartorya fischeri, Chaetomium thermophilum, Aspergillus terreus, Neurospora Crassa, Reticulitermes flavipes, or Arabidopsis thaliana endoglucanases.
222. The method of claim 212 , wherein the host cell is a Kluyveromyces host cell.
223. The method of claim 212 , wherein the host cell is a Saccharomyces cerevisiae host cell.
224. The method of claim 212 , wherein the host cell is capable of fermenting pentose sugars.
225. The method of claim 224 , wherein the host cell is capable of fermenting xylose.
226. The method of claim 225 , wherein the host cell expresses xylose isomerase, xylulokinase, ribulose 5-phosphate isomerase, ribulose 5-phosphate epimerase, transketolase, transaldolase or a combination thereof.
227. The method of claim 226 , wherein the host cell expresses xylose isomerase, xylulokinase, ribulose 5-phosphate isomerase, ribulose 5-phosphate epimerase, transketolase and transaldolase.
228. The method of claim 224 , wherein the host cell does not express the GRE3 gene encoding aldose reductase.
229. The method of claim 212 , wherein the endoglucanase is an Aspergillus kawachii, Heterodera schachtii, Hypocrea jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Chaetomium globosum, or Aspergillus fumigatus endoglucanase.
230. The method of claim 220 , further comprising a second heterologous polynucleotide comprising a nucleic acid which encodes a second endoglucanase, and wherein the endoglucanase and the second endoglucanase are selected from the group consisting of Aspergillus kawachii, Heterodera schachtii, Hypocrea jecorina, Orpinomyces sp., Irpex lacteus, Acremonium thermophilum, Chaetomium globosum, and Aspergillus fumigatus endoglucanase.
231. The method of claim 212 , wherein the endoglucanase is a Neosartorya fischeri endoglucanase comprising the amino acids of SEQ ID NO:37.
232. The method of claim 212 , wherein the thermotolerant yeast host cell can grow at temperatures of at least 38° C. or above.
233. The method of claim 212 , wherein the thermotolerant yeast host cell can grow at temperatures of at least 40° C. or above.
234. The method of claim 212 , wherein the thermotolerant yeast host cell can grow at temperature from 40° C. to 50° C.
235. The method of claim 220 , wherein the Talaromyces emersonii cellobiohydrolase I is fused to a cellulose binding module (CBM).
236. A culture comprising the host cell of claim 212 and cellulose.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/131,293 US20210388398A1 (en) | 2008-11-21 | 2020-12-22 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11698108P | 2008-11-21 | 2008-11-21 | |
PCT/US2009/065571 WO2010060056A2 (en) | 2008-11-21 | 2009-11-23 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US201213130549A | 2012-02-07 | 2012-02-07 | |
US14/788,879 US9988652B2 (en) | 2008-11-21 | 2015-07-01 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US15/985,042 US20180258449A1 (en) | 2008-11-21 | 2018-05-21 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US17/131,293 US20210388398A1 (en) | 2008-11-21 | 2020-12-22 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/985,042 Continuation US20180258449A1 (en) | 2008-11-21 | 2018-05-21 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
Publications (1)
Publication Number | Publication Date |
---|---|
US20210388398A1 true US20210388398A1 (en) | 2021-12-16 |
Family
ID=42198846
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/130,549 Active US9102955B2 (en) | 2008-11-21 | 2009-11-23 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US14/788,879 Active US9988652B2 (en) | 2008-11-21 | 2015-07-01 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US15/985,042 Abandoned US20180258449A1 (en) | 2008-11-21 | 2018-05-21 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US17/131,293 Pending US20210388398A1 (en) | 2008-11-21 | 2020-12-22 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
Family Applications Before (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/130,549 Active US9102955B2 (en) | 2008-11-21 | 2009-11-23 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US14/788,879 Active US9988652B2 (en) | 2008-11-21 | 2015-07-01 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US15/985,042 Abandoned US20180258449A1 (en) | 2008-11-21 | 2018-05-21 | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
Country Status (10)
Country | Link |
---|---|
US (4) | US9102955B2 (en) |
EP (1) | EP2361311B1 (en) |
CN (2) | CN102272303A (en) |
AU (1) | AU2009316309B2 (en) |
BR (1) | BRPI0921966B1 (en) |
CA (3) | CA2964245C (en) |
DK (1) | DK2361311T3 (en) |
ES (1) | ES2621181T3 (en) |
NZ (1) | NZ593469A (en) |
WO (1) | WO2010060056A2 (en) |
Families Citing this family (51)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9994835B2 (en) | 2008-05-11 | 2018-06-12 | Lallemand Hungary Liquidity Management Llc | Construction of protrophic/celluloytic yeast strains expressing tethered and secreted cellulases |
CA2964245C (en) | 2008-11-21 | 2020-10-27 | Universiteit Stellenbosch | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
CN102666849A (en) | 2009-10-26 | 2012-09-12 | 斯泰伦博斯大学 | Heterologous expression of fungal cellobiohydrolase 2 genes in yeast |
US20130071884A1 (en) | 2009-11-06 | 2013-03-21 | Agrivida, Inc. | Plants expressing cell wall degrading enzymes and expression vectors |
BR112012028290B1 (en) | 2010-05-05 | 2021-02-02 | Lallemand Hungary Liquidity Management Llc. | recombinant yeast, process to convert biomass into ethanol and fermentation medium comprising said yeast |
EP2576762A4 (en) | 2010-06-03 | 2013-12-04 | Mascoma Corp | Yeast expressing saccharolytic enzymes for consolidated bioprocessing using starch and cellulose |
US9598700B2 (en) | 2010-06-25 | 2017-03-21 | Agrivida, Inc. | Methods and compositions for processing biomass with elevated levels of starch |
US10443068B2 (en) | 2010-06-25 | 2019-10-15 | Agrivida, Inc. | Plants with engineered endogenous genes |
HRP20221096T1 (en) * | 2010-12-22 | 2022-11-25 | Neste Oyj | An integrated process for producing biofuels |
WO2012103350A1 (en) | 2011-01-26 | 2012-08-02 | Novozymes A/S | Polypeptides having cellobiohydrolase activity and polynucleotides encoding same |
US9068176B2 (en) | 2011-01-26 | 2015-06-30 | Novozymes A/S | Polypeptides having endoglucanase activity and polynucleotides encoding same |
CA2829207C (en) * | 2011-03-07 | 2022-10-11 | Agrivida, Inc. | Consolidated pretreatment and hydrolysis of plant biomass expressing cell wall degrading enzymes |
CN103649321B (en) | 2011-04-05 | 2019-07-16 | 拉勒曼德匈牙利流动性管理有限责任公司 | For the method by product yield and yield in addition alternately electron acceptor improvement microorganism |
WO2013071112A1 (en) | 2011-11-10 | 2013-05-16 | Mascoma Corporation | A genetically modified strain of s. cerevisiae engineered to ferment xylose and arabinose |
US9708591B2 (en) | 2011-11-18 | 2017-07-18 | Novozymes Inc. | Polypeptides having endoglucanase activity and polynucleotides encoding same |
DK2791350T3 (en) * | 2011-12-13 | 2019-05-06 | Danisco Us Inc | ENZYMCOCKTAILS MADE BY MIXED CULTURES |
WO2013091577A1 (en) | 2011-12-22 | 2013-06-27 | Novozymes, Inc. | Hybrid polypeptides having cellobiohydrolase activity and polynucleotides encoding same |
JP2013169154A (en) * | 2012-02-17 | 2013-09-02 | Toyota Motor Corp | Polypeptide enhancing cellulosic biomass degradation activity |
US20140024064A1 (en) | 2012-07-23 | 2014-01-23 | Butamax(Tm) Advanced Biofuels Llc | Processes and systems for the production of fermentative alcohols |
CN102851324A (en) * | 2012-08-24 | 2013-01-02 | 太仓市周氏化学品有限公司 | Method for producing ethanol by simultaneous saccharification and fermentation by using thermotolerant yeast |
CA2883627A1 (en) | 2012-09-12 | 2014-03-20 | Butamax Advanced Biofuels Llc | Processes and systems for the production of fermentation products |
AU2013329024A1 (en) | 2012-10-11 | 2015-03-12 | Butamax Advanced Biofuels Llc | Processes and systems for the production of fermentation products |
EP2914719A1 (en) * | 2012-10-31 | 2015-09-09 | Danisco US Inc. | Compositions and methods of use |
KR20150079676A (en) * | 2012-10-31 | 2015-07-08 | 다니스코 유에스 인크. | Beta-glucosidase from magnaporthe grisea |
EP3498829A1 (en) | 2012-11-09 | 2019-06-19 | Lallemand Hungary Liquidity Management LLC | Method for acetate consumption during ethanolic fermentation of cellulosic feedstocks |
MX2015007234A (en) | 2012-12-12 | 2015-10-29 | Danisco Us Inc | Variants of cellobiohydrolases. |
US10612061B2 (en) | 2013-03-15 | 2020-04-07 | Lallemand Hungary Liquidity Management Llc | Expression of beta-glucosidases for hydrolysis of lignocellulose and associated oligomers |
US9850512B2 (en) | 2013-03-15 | 2017-12-26 | The Research Foundation For The State University Of New York | Hydrolysis of cellulosic fines in primary clarified sludge of paper mills and the addition of a surfactant to increase the yield |
CN103409333B (en) * | 2013-05-20 | 2015-01-28 | 山东大学 | Recombinant saccharomyces cerevisiae strain for continuously and efficiently secreting beta-glucosidase and applications thereof |
US10358370B2 (en) * | 2013-06-12 | 2019-07-23 | Renescience A/S | Methods of processing municipal solid waste (MSW) using microbial hydrolysis and fermentation |
MX2016001881A (en) | 2013-08-15 | 2016-08-03 | Lallemand Hungary Liquidity Man Llc | Methods for the improvement of product yield and production in a microorganism through glycerol recycling. |
WO2015042543A2 (en) * | 2013-09-20 | 2015-03-26 | The Trustees Of Columbia University In The City Of New York | Biofuel production enzymes and uses thereof |
CN103805673B (en) * | 2014-03-01 | 2015-12-09 | 青岛科技大学 | A kind of method utilizing transgenic yeast mixed fermentation to produce straw ethanol |
US9951363B2 (en) | 2014-03-14 | 2018-04-24 | The Research Foundation for the State University of New York College of Environmental Science and Forestry | Enzymatic hydrolysis of old corrugated cardboard (OCC) fines from recycled linerboard mill waste rejects |
CN104046605A (en) * | 2014-05-29 | 2014-09-17 | 中国科学院广州能源研究所 | Mesophile ethanol-tolerant beta-glucosidase, and coding gene and application thereof |
CN107002056A (en) | 2014-09-05 | 2017-08-01 | 诺维信公司 | Carbohydrate binding module variant and the polynucleotides for encoding them |
DK3191587T3 (en) | 2014-09-08 | 2019-10-14 | Novozymes As | Cellobiohydrolase variants and polynucleotides encoding them |
CN104357340B (en) * | 2014-11-17 | 2017-08-01 | 中国食品发酵工业研究院 | A kind of method that bioconversion fumaric acid produces L malic acid |
US10557127B2 (en) | 2015-02-24 | 2020-02-11 | Novozymes A/S | Cellobiohydrolase variants and polynucleotides encoding same |
JP6985934B2 (en) * | 2015-04-29 | 2021-12-22 | フレッド ハッチンソン キャンサー リサーチ センター | Manipulated hematopoietic stem / progenitor cells and non-T effector cells, as well as their use |
WO2016176652A2 (en) | 2015-04-29 | 2016-11-03 | Fred Hutchinson Cancer Research Center | Modified stem cells and uses thereof |
CN106086087A (en) * | 2016-08-18 | 2016-11-09 | 吉林中之林农业科技有限公司 | A kind of microbial co culture prepares the system of biomass monomer |
BR112019024520B1 (en) | 2017-05-23 | 2023-03-14 | Lallemand Hungary Liquidity Management Llc | RECOMBINANT YEAST HOST CELL AND FERMENTATION MEDIA COMPRISING IT |
EP3502126A1 (en) * | 2017-12-19 | 2019-06-26 | CIC nanoGUNE - Asociación Centro de Investigación Cooperativa en Nanociencias | Ancestral cellulases and uses thereof |
CN108707510B (en) * | 2018-06-07 | 2021-07-06 | 湖北中烟工业有限责任公司 | Preparation method and application of red date and tobacco composite Maillard reactant |
CN108823102B (en) * | 2018-06-10 | 2021-09-03 | 东北农业大学 | Cold region straw rotten fungus Mortierella sarnyensis strain and application thereof in rice straw rotten |
CN109593662B (en) * | 2018-12-11 | 2021-12-03 | 大连理工大学 | Kluyveromyces marxianus strain with co-utilization of acetic acid and xylose and screening method |
CN109981620A (en) * | 2019-03-14 | 2019-07-05 | 山东浪潮云信息技术有限公司 | A kind of back office interface management system |
CN110438019B (en) * | 2019-06-06 | 2021-04-06 | 浙江工业大学 | Complex microbial inoculant and application thereof in preparation of organic liquid fertilizer by fermenting kitchen waste |
CN112852649B (en) * | 2019-11-28 | 2022-08-23 | 华东理工大学 | High-temperature-resistant saccharomyces cerevisiae strain for producing cellulosic ethanol and fermentation application thereof |
CN112899294B (en) * | 2021-02-04 | 2022-07-22 | 温氏食品集团股份有限公司 | Multifunctional enzyme gene HG27 and application thereof |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005116271A2 (en) * | 2004-05-25 | 2005-12-08 | The Trustees Of Dartmouth College | Selection of microorganisms with growth dependent upon extracytoplasmic enzymes |
US20060234364A1 (en) * | 2003-05-02 | 2006-10-19 | Vineet Rajgarhia | Genetically modified yeast species and fermenation processes using genetically modified yeast |
US20070238155A1 (en) * | 1996-10-10 | 2007-10-11 | Gusakov Alexander V | Construction of highly efficient cellulase compositions for enzymatic hydrolysis of cellulose |
WO2008064314A2 (en) * | 2006-11-22 | 2008-05-29 | The Trustees Of Dartmouth College | Recombinant yeast strains expressing tethered cellulase enzymes |
US9102955B2 (en) * | 2008-11-21 | 2015-08-11 | Lallemand Hungary Liquidity Management Llc | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US9315833B2 (en) * | 2009-02-20 | 2016-04-19 | Lallemand Hungary Liquidity Management Llc | Yeast cells expressing an exogenous cellulosome and methods of using the same |
Family Cites Families (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB9400623D0 (en) * | 1994-01-14 | 1994-03-09 | Univ Leeds | Exploitation of the cellulase enzyme complex of neurospora |
US5811381A (en) | 1996-10-10 | 1998-09-22 | Mark A. Emalfarb | Cellulase compositions and methods of use |
JP3645394B2 (en) | 1997-03-12 | 2005-05-11 | 日立建機株式会社 | Tire roller |
BR0111979A (en) * | 2000-06-26 | 2003-07-01 | Univ Florida Res Foudantion In | Composition for degrading an oligosaccharide, method for degrading an oligosaccharide, host cell, methods for enhancing degradation of an oligosaccharide, for making a recombinant host cell, for expressing an endoglycanase in a host cell, and for producing ethanol from a source of oligosaccharide, vector, method for degrading an oligosaccharide, and enzyme extract |
US7045331B2 (en) * | 2001-12-18 | 2006-05-16 | Genencor International, Inc. | EGVII endoglucanase and nucleic acids encoding the same |
US7344876B2 (en) | 2003-01-24 | 2008-03-18 | Phage Biotechnology, Inc. | Kluyveromyces strains metabolizing cellulosic and hemicellulosic materials |
JP5796925B2 (en) * | 2004-07-16 | 2015-10-21 | ディーエスエム アイピー アセッツ ビー.ブイ. | Metabolic engineering of xylose-fermenting eukaryotic cells |
US8304212B2 (en) | 2006-07-10 | 2012-11-06 | Dyadic International, Inc. | Methods and compositions for degradation of lignocellulosic material |
WO2008155665A2 (en) | 2007-05-09 | 2008-12-24 | University Of Stellenbosch | Method for enhancing cellobiose utilization |
US7923236B2 (en) | 2007-08-02 | 2011-04-12 | Dyadic International (Usa), Inc. | Fungal enzymes |
BRPI0911966B1 (en) | 2008-05-11 | 2018-11-13 | Univ Stellenbosch | polynucleotide encoding a cellobiohydrolase |
US9994835B2 (en) | 2008-05-11 | 2018-06-12 | Lallemand Hungary Liquidity Management Llc | Construction of protrophic/celluloytic yeast strains expressing tethered and secreted cellulases |
US8470592B2 (en) | 2008-07-07 | 2013-06-25 | Mascoma Corporation | Isolation and characterization of Schizochytrium aggregatum cellobiohydrolase I (Cbh 1) |
CN102143972A (en) | 2008-07-07 | 2011-08-03 | 马斯科马公司 | Heterologous expression of termite cellulases in yeast |
CA2748135A1 (en) | 2008-12-23 | 2010-07-01 | Mascoma Corporation | Heterologous biomass degrading enzyme expression in thermoanaerobacterium saccharolyticum |
WO2010124000A2 (en) | 2009-04-21 | 2010-10-28 | The Trustees Of Dartmouth College | Modified cipa gene from clostridium thermocellum for enhanced genetic stability |
EP2467490A1 (en) | 2009-08-21 | 2012-06-27 | Mascoma Corporation | Production of propanols, alcohols, and polyols in consolidated bioprocessing organisms |
BR112012028290B1 (en) | 2010-05-05 | 2021-02-02 | Lallemand Hungary Liquidity Management Llc. | recombinant yeast, process to convert biomass into ethanol and fermentation medium comprising said yeast |
EP2576762A4 (en) | 2010-06-03 | 2013-12-04 | Mascoma Corp | Yeast expressing saccharolytic enzymes for consolidated bioprocessing using starch and cellulose |
FI20105632A0 (en) * | 2010-06-04 | 2010-06-04 | Valtion Teknillinen | Procedure for protein production in filamentous fungi |
CA2881772C (en) | 2012-08-29 | 2023-03-21 | Lallemand Hungary Liquidity Management Llc | Expression of enzymes in yeast for lignocellulose derived oligomer cbp |
US10612061B2 (en) | 2013-03-15 | 2020-04-07 | Lallemand Hungary Liquidity Management Llc | Expression of beta-glucosidases for hydrolysis of lignocellulose and associated oligomers |
-
2009
- 2009-11-23 CA CA2964245A patent/CA2964245C/en active Active
- 2009-11-23 BR BRPI0921966-8A patent/BRPI0921966B1/en active IP Right Grant
- 2009-11-23 EP EP09828362.5A patent/EP2361311B1/en active Active
- 2009-11-23 DK DK09828362.5T patent/DK2361311T3/en active
- 2009-11-23 CN CN2009801537092A patent/CN102272303A/en active Pending
- 2009-11-23 CA CA2744495A patent/CA2744495C/en active Active
- 2009-11-23 CA CA3092340A patent/CA3092340A1/en active Pending
- 2009-11-23 CN CN201710766848.9A patent/CN108315272A/en active Pending
- 2009-11-23 AU AU2009316309A patent/AU2009316309B2/en active Active
- 2009-11-23 WO PCT/US2009/065571 patent/WO2010060056A2/en active Application Filing
- 2009-11-23 US US13/130,549 patent/US9102955B2/en active Active
- 2009-11-23 NZ NZ593469A patent/NZ593469A/en unknown
- 2009-11-23 ES ES09828362.5T patent/ES2621181T3/en active Active
-
2015
- 2015-07-01 US US14/788,879 patent/US9988652B2/en active Active
-
2018
- 2018-05-21 US US15/985,042 patent/US20180258449A1/en not_active Abandoned
-
2020
- 2020-12-22 US US17/131,293 patent/US20210388398A1/en active Pending
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20070238155A1 (en) * | 1996-10-10 | 2007-10-11 | Gusakov Alexander V | Construction of highly efficient cellulase compositions for enzymatic hydrolysis of cellulose |
US20060234364A1 (en) * | 2003-05-02 | 2006-10-19 | Vineet Rajgarhia | Genetically modified yeast species and fermenation processes using genetically modified yeast |
WO2005116271A2 (en) * | 2004-05-25 | 2005-12-08 | The Trustees Of Dartmouth College | Selection of microorganisms with growth dependent upon extracytoplasmic enzymes |
WO2008064314A2 (en) * | 2006-11-22 | 2008-05-29 | The Trustees Of Dartmouth College | Recombinant yeast strains expressing tethered cellulase enzymes |
US9102955B2 (en) * | 2008-11-21 | 2015-08-11 | Lallemand Hungary Liquidity Management Llc | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US9988652B2 (en) * | 2008-11-21 | 2018-06-05 | Lallemand Hungary Liquidity Management Llc | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose |
US9315833B2 (en) * | 2009-02-20 | 2016-04-19 | Lallemand Hungary Liquidity Management Llc | Yeast cells expressing an exogenous cellulosome and methods of using the same |
Non-Patent Citations (6)
Title |
---|
Carrad et al. "Cellulose-binding domains promote hydrolysis of different sites on crystalline cellulose:, Proceedings of the National Academy of Sciences, 2000, Vol. 97, No. 19, pp.10342-10347. (Year: 2000) * |
GenBank reference corresponding to accession number AY081766, deposited on March 20, 2002 (Year: 2002) * |
Hong et al. "Construction of thermotolerant yeast expressing thermostable cellulase genes", Journal of Biotechnology, 2007, Vol. 130, pp.114-123. (Year: 2007) * |
Karhumaa et al. "Investigation of limiting metabolic steps in the utilization of xylose by recombinant Saccharomyces cerevisiae using metabolic engineering", Yeast, 2005, Vol. 22, Issue 5, pp.359-368. (Year: 2005) * |
Machida et al. "Nucleotide Sequences of Saccharomycopsis fibuligera Genes for Extracellular β-Glucosidases as Expressed in Saccharomyces cerevisiae", Applied and Environmental Microbiology, 1988, Vol. 54, No. 12, pp.3147-3155. (Year: 1988) * |
Ramachandran et al. "Cloning and characterization of a putative β-glucosidase (NfBGL595) from Neosartorya fischeri", Process Biochemistry, 2012, Vol. 47, Issue 1, pp.99-105. (Year: 2012) * |
Also Published As
Publication number | Publication date |
---|---|
WO2010060056A2 (en) | 2010-05-27 |
AU2009316309A1 (en) | 2011-10-20 |
CA2964245A1 (en) | 2010-05-27 |
US20160010117A1 (en) | 2016-01-14 |
EP2361311A2 (en) | 2011-08-31 |
EP2361311A4 (en) | 2013-03-27 |
BRPI0921966B1 (en) | 2019-05-07 |
ES2621181T3 (en) | 2017-07-03 |
US20180258449A1 (en) | 2018-09-13 |
US9102955B2 (en) | 2015-08-11 |
BRPI0921966A2 (en) | 2017-10-24 |
CN108315272A (en) | 2018-07-24 |
BRPI0921966A8 (en) | 2017-12-12 |
WO2010060056A3 (en) | 2010-07-15 |
CA2964245C (en) | 2020-10-27 |
US20120129229A1 (en) | 2012-05-24 |
CA2744495C (en) | 2017-05-30 |
CN102272303A (en) | 2011-12-07 |
US9988652B2 (en) | 2018-06-05 |
NZ593469A (en) | 2012-12-21 |
CA2744495A1 (en) | 2010-05-27 |
DK2361311T3 (en) | 2017-04-24 |
CA3092340A1 (en) | 2010-05-27 |
AU2009316309B2 (en) | 2016-07-07 |
EP2361311B1 (en) | 2017-01-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210388398A1 (en) | Yeast expressing cellulases for simultaneous saccharification and fermentation using cellulose | |
US10428322B2 (en) | Heterologous expression of termite cellulases in yeast | |
US20230028975A1 (en) | Yeast expressing saccharolytic enzymes for consolidated bioprocessing using starch and cellulose | |
US11530428B2 (en) | Nucleic acids encoding fungal cellobiohydrolases for expression in yeast | |
US11168315B2 (en) | Expression of beta-glucosidases for hydrolysis of lignocellulose and associated oligomers | |
US9994835B2 (en) | Construction of protrophic/celluloytic yeast strains expressing tethered and secreted cellulases | |
US10196622B2 (en) | Heterologous expression of fungal cellobiohydrolase 2 genes in yeast | |
US20130230888A1 (en) | Heterologous Expression of Fungal Cellobiohydrolase 2 Genes in Yeast |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |