US20210380997A1 - Glucanase production and methods of using the same - Google Patents
Glucanase production and methods of using the same Download PDFInfo
- Publication number
- US20210380997A1 US20210380997A1 US17/355,698 US202117355698A US2021380997A1 US 20210380997 A1 US20210380997 A1 US 20210380997A1 US 202117355698 A US202117355698 A US 202117355698A US 2021380997 A1 US2021380997 A1 US 2021380997A1
- Authority
- US
- United States
- Prior art keywords
- glucanase
- sequence
- plant
- feed
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000000034 method Methods 0.000 title claims abstract description 171
- 238000004519 manufacturing process Methods 0.000 title description 23
- 230000009261 transgenic effect Effects 0.000 claims abstract description 161
- 241001465754 Metazoa Species 0.000 claims abstract description 98
- 102000004190 Enzymes Human genes 0.000 claims abstract description 91
- 108090000790 Enzymes Proteins 0.000 claims abstract description 91
- 230000000694 effects Effects 0.000 claims abstract description 77
- 239000000203 mixture Substances 0.000 claims abstract description 47
- 241000196324 Embryophyta Species 0.000 claims description 257
- 240000008042 Zea mays Species 0.000 claims description 137
- 235000002017 Zea mays subsp mays Nutrition 0.000 claims description 125
- 150000007523 nucleic acids Chemical class 0.000 claims description 110
- 235000005911 diet Nutrition 0.000 claims description 102
- 230000037213 diet Effects 0.000 claims description 97
- 229940088598 enzyme Drugs 0.000 claims description 91
- 102000039446 nucleic acids Human genes 0.000 claims description 87
- 108020004707 nucleic acids Proteins 0.000 claims description 87
- 235000013339 cereals Nutrition 0.000 claims description 84
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 claims description 83
- 235000009973 maize Nutrition 0.000 claims description 83
- 230000014509 gene expression Effects 0.000 claims description 53
- 229920001282 polysaccharide Polymers 0.000 claims description 46
- 239000005017 polysaccharide Substances 0.000 claims description 44
- 150000004804 polysaccharides Chemical class 0.000 claims description 44
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 claims description 42
- 235000005822 corn Nutrition 0.000 claims description 42
- 150000001413 amino acids Chemical group 0.000 claims description 36
- 239000006052 feed supplement Substances 0.000 claims description 31
- 239000004615 ingredient Substances 0.000 claims description 31
- 230000000593 degrading effect Effects 0.000 claims description 29
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 28
- 235000021307 Triticum Nutrition 0.000 claims description 27
- 241000209140 Triticum Species 0.000 claims description 27
- 229920002498 Beta-glucan Polymers 0.000 claims description 26
- 230000003301 hydrolyzing effect Effects 0.000 claims description 23
- 108010059892 Cellulase Proteins 0.000 claims description 22
- 239000008188 pellet Substances 0.000 claims description 22
- 235000007340 Hordeum vulgare Nutrition 0.000 claims description 21
- 240000005979 Hordeum vulgare Species 0.000 claims description 21
- 235000002639 sodium chloride Nutrition 0.000 claims description 21
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 claims description 20
- 108091033319 polynucleotide Proteins 0.000 claims description 20
- 102000040430 polynucleotide Human genes 0.000 claims description 20
- 239000002157 polynucleotide Substances 0.000 claims description 20
- 238000002156 mixing Methods 0.000 claims description 19
- 239000000463 material Substances 0.000 claims description 18
- 239000001913 cellulose Substances 0.000 claims description 17
- 229920002678 cellulose Polymers 0.000 claims description 17
- 235000012054 meals Nutrition 0.000 claims description 17
- 101710121765 Endo-1,4-beta-xylanase Proteins 0.000 claims description 16
- 235000011684 Sorghum saccharatum Nutrition 0.000 claims description 16
- 108010011619 6-Phytase Proteins 0.000 claims description 15
- 108010065511 Amylases Proteins 0.000 claims description 15
- 102000013142 Amylases Human genes 0.000 claims description 15
- 108091005804 Peptidases Proteins 0.000 claims description 15
- 235000019418 amylase Nutrition 0.000 claims description 15
- GUBGYTABKSRVRQ-CUHNMECISA-N D-Cellobiose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-CUHNMECISA-N 0.000 claims description 14
- 230000001965 increasing effect Effects 0.000 claims description 14
- 239000011780 sodium chloride Substances 0.000 claims description 14
- 239000004382 Amylase Substances 0.000 claims description 13
- 235000010469 Glycine max Nutrition 0.000 claims description 13
- 239000004365 Protease Substances 0.000 claims description 13
- 235000010755 mineral Nutrition 0.000 claims description 13
- 239000011707 mineral Substances 0.000 claims description 13
- 229940085127 phytase Drugs 0.000 claims description 13
- 229920001221 xylan Polymers 0.000 claims description 13
- 150000004823 xylans Chemical class 0.000 claims description 13
- FYGDTMLNYKFZSV-URKRLVJHSA-N (2s,3r,4s,5s,6r)-2-[(2r,4r,5r,6s)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2r,4r,5r,6s)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1[C@@H](CO)O[C@@H](OC2[C@H](O[C@H](O)[C@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O FYGDTMLNYKFZSV-URKRLVJHSA-N 0.000 claims description 12
- 235000006109 methionine Nutrition 0.000 claims description 12
- 229930182817 methionine Natural products 0.000 claims description 12
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims description 11
- 239000007787 solid Substances 0.000 claims description 11
- 239000004470 DL Methionine Substances 0.000 claims description 10
- 235000019738 Limestone Nutrition 0.000 claims description 10
- 235000019764 Soybean Meal Nutrition 0.000 claims description 10
- 239000004473 Threonine Substances 0.000 claims description 10
- 239000001506 calcium phosphate Substances 0.000 claims description 10
- 239000003925 fat Substances 0.000 claims description 10
- 235000019197 fats Nutrition 0.000 claims description 10
- 229910052500 inorganic mineral Inorganic materials 0.000 claims description 10
- 239000006028 limestone Substances 0.000 claims description 10
- FFEARJCKVFRZRR-UHFFFAOYSA-N methionine Chemical compound CSCCC(N)C(O)=O FFEARJCKVFRZRR-UHFFFAOYSA-N 0.000 claims description 10
- 239000004455 soybean meal Substances 0.000 claims description 10
- 229960002898 threonine Drugs 0.000 claims description 10
- 239000001763 2-hydroxyethyl(trimethyl)azanium Substances 0.000 claims description 9
- 235000019743 Choline chloride Nutrition 0.000 claims description 9
- 244000068988 Glycine max Species 0.000 claims description 9
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 claims description 9
- 235000019742 Vitamins premix Nutrition 0.000 claims description 9
- SGMZJAMFUVOLNK-UHFFFAOYSA-M choline chloride Chemical compound [Cl-].C[N+](C)(C)CCO SGMZJAMFUVOLNK-UHFFFAOYSA-M 0.000 claims description 9
- 229960003178 choline chloride Drugs 0.000 claims description 9
- 150000003839 salts Chemical class 0.000 claims description 9
- 239000011669 selenium Substances 0.000 claims description 9
- 229910052711 selenium Inorganic materials 0.000 claims description 9
- 235000011649 selenium Nutrition 0.000 claims description 9
- XOIQMTLWECTKJL-HXPDMXKUSA-M sodium;(3r,4s)-4-[(2s,5r,7s,8r,9s)-2-[(2r,5s)-5-ethyl-5-[(2r,3s,5r)-5-[(2s,3s,5r,6r)-6-hydroxy-6-(hydroxymethyl)-3,5-dimethyloxan-2-yl]-3-methyloxolan-2-yl]oxolan-2-yl]-7-hydroxy-2,8-dimethyl-1,10-dioxaspiro[4.5]decan-9-yl]-3-methoxy-2-methylpentanoate Chemical compound [Na+].C([C@@](O1)(C)[C@H]2CC[C@@](O2)(CC)[C@H]2[C@H](C[C@@H](O2)[C@@H]2[C@H](C[C@@H](C)[C@](O)(CO)O2)C)C)C[C@@]21C[C@H](O)[C@@H](C)[C@@H]([C@@H](C)[C@@H](OC)C(C)C([O-])=O)O2 XOIQMTLWECTKJL-HXPDMXKUSA-M 0.000 claims description 9
- WPLOVIFNBMNBPD-ATHMIXSHSA-N subtilin Chemical compound CC1SCC(NC2=O)C(=O)NC(CC(N)=O)C(=O)NC(C(=O)NC(CCCCN)C(=O)NC(C(C)CC)C(=O)NC(=C)C(=O)NC(CCCCN)C(O)=O)CSC(C)C2NC(=O)C(CC(C)C)NC(=O)C1NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C1NC(=O)C(=C/C)/NC(=O)C(CCC(N)=O)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C2NC(=O)CNC(=O)C3CCCN3C(=O)C(NC(=O)C3NC(=O)C(CC(C)C)NC(=O)C(=C)NC(=O)C(CCC(O)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)CC=4C5=CC=CC=C5NC=4)CSC3)C(C)SC2)C(C)C)C(C)SC1)CC1=CC=CC=C1 WPLOVIFNBMNBPD-ATHMIXSHSA-N 0.000 claims description 9
- 235000019739 Dicalciumphosphate Nutrition 0.000 claims description 8
- 108010055059 beta-Mannosidase Proteins 0.000 claims description 8
- 229910000390 dicalcium phosphate Inorganic materials 0.000 claims description 8
- 229940038472 dicalcium phosphate Drugs 0.000 claims description 8
- 235000019354 vermiculite Nutrition 0.000 claims description 8
- 239000010455 vermiculite Substances 0.000 claims description 8
- 229910052902 vermiculite Inorganic materials 0.000 claims description 8
- 229940106157 cellulase Drugs 0.000 claims description 7
- 102100032487 Beta-mannosidase Human genes 0.000 claims description 6
- 230000001580 bacterial effect Effects 0.000 claims description 5
- 229940098396 barley grain Drugs 0.000 claims description 5
- 229910001575 sodium mineral Inorganic materials 0.000 claims description 3
- 108091093088 Amplicon Proteins 0.000 claims description 2
- 235000019752 Wheat Middilings Nutrition 0.000 claims description 2
- 238000005453 pelletization Methods 0.000 claims description 2
- 240000006394 Sorghum bicolor Species 0.000 claims 5
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 claims 2
- 230000008569 process Effects 0.000 abstract description 8
- 238000003556 assay Methods 0.000 description 64
- 238000006243 chemical reaction Methods 0.000 description 63
- 239000000523 sample Substances 0.000 description 55
- 241000287828 Gallus gallus Species 0.000 description 52
- 108090000623 proteins and genes Proteins 0.000 description 42
- 239000000047 product Substances 0.000 description 38
- 235000018102 proteins Nutrition 0.000 description 38
- 108020004414 DNA Proteins 0.000 description 37
- 235000001014 amino acid Nutrition 0.000 description 37
- 102000004169 proteins and genes Human genes 0.000 description 37
- 229940024606 amino acid Drugs 0.000 description 36
- 125000003275 alpha amino acid group Chemical group 0.000 description 35
- 239000002773 nucleotide Substances 0.000 description 35
- 125000003729 nucleotide group Chemical group 0.000 description 35
- 108091028043 Nucleic acid sequence Proteins 0.000 description 32
- 239000013598 vector Substances 0.000 description 32
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 29
- 239000008103 glucose Substances 0.000 description 29
- 238000003752 polymerase chain reaction Methods 0.000 description 29
- 239000000758 substrate Substances 0.000 description 29
- 108090000765 processed proteins & peptides Proteins 0.000 description 28
- 235000000346 sugar Nutrition 0.000 description 25
- 150000008163 sugars Chemical class 0.000 description 25
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 24
- 229920001184 polypeptide Polymers 0.000 description 24
- 102000004196 processed proteins & peptides Human genes 0.000 description 24
- 210000003608 fece Anatomy 0.000 description 23
- 210000000349 chromosome Anatomy 0.000 description 21
- 244000144977 poultry Species 0.000 description 21
- 235000013594 poultry meat Nutrition 0.000 description 21
- 238000003753 real-time PCR Methods 0.000 description 21
- 238000011282 treatment Methods 0.000 description 21
- 238000009396 hybridization Methods 0.000 description 20
- 239000013641 positive control Substances 0.000 description 20
- 238000002835 absorbance Methods 0.000 description 19
- 238000010790 dilution Methods 0.000 description 18
- 239000012895 dilution Substances 0.000 description 18
- 239000003550 marker Substances 0.000 description 18
- 241000271566 Aves Species 0.000 description 16
- 230000010354 integration Effects 0.000 description 16
- 239000006228 supernatant Substances 0.000 description 16
- 230000009466 transformation Effects 0.000 description 16
- 239000000872 buffer Substances 0.000 description 15
- 239000013604 expression vector Substances 0.000 description 15
- 238000003780 insertion Methods 0.000 description 15
- 230000037431 insertion Effects 0.000 description 15
- 239000003153 chemical reaction reagent Substances 0.000 description 14
- 210000005069 ears Anatomy 0.000 description 14
- 239000000835 fiber Substances 0.000 description 14
- 235000016709 nutrition Nutrition 0.000 description 14
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- 101710112457 Exoglucanase Proteins 0.000 description 13
- 229920002472 Starch Polymers 0.000 description 13
- 108700019146 Transgenes Proteins 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 13
- 235000019698 starch Nutrition 0.000 description 13
- 239000008107 starch Substances 0.000 description 13
- 101001065065 Aspergillus awamori Feruloyl esterase A Proteins 0.000 description 12
- 244000062793 Sorghum vulgare Species 0.000 description 12
- 239000012634 fragment Substances 0.000 description 12
- 239000013642 negative control Substances 0.000 description 12
- 238000012545 processing Methods 0.000 description 12
- 239000000126 substance Substances 0.000 description 12
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 11
- 239000000284 extract Substances 0.000 description 11
- 230000035764 nutrition Effects 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 10
- 230000037396 body weight Effects 0.000 description 10
- 230000002708 enhancing effect Effects 0.000 description 10
- 235000019419 proteases Nutrition 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 9
- 108010084185 Cellulases Proteins 0.000 description 9
- 102000005575 Cellulases Human genes 0.000 description 9
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 9
- 230000000875 corresponding effect Effects 0.000 description 9
- 230000029087 digestion Effects 0.000 description 9
- 235000013312 flour Nutrition 0.000 description 9
- 239000013589 supplement Substances 0.000 description 9
- 235000019786 weight gain Nutrition 0.000 description 9
- 230000003197 catalytic effect Effects 0.000 description 8
- 239000011536 extraction buffer Substances 0.000 description 8
- 238000000751 protein extraction Methods 0.000 description 8
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 7
- 239000002028 Biomass Substances 0.000 description 7
- 240000007594 Oryza sativa Species 0.000 description 7
- 235000007164 Oryza sativa Nutrition 0.000 description 7
- 235000014590 basal diet Nutrition 0.000 description 7
- 238000011534 incubation Methods 0.000 description 7
- 238000002887 multiple sequence alignment Methods 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 238000011160 research Methods 0.000 description 7
- 235000009566 rice Nutrition 0.000 description 7
- 108010008885 Cellulose 1,4-beta-Cellobiosidase Proteins 0.000 description 6
- 235000019754 Grower Diet Nutrition 0.000 description 6
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 6
- 238000002944 PCR assay Methods 0.000 description 6
- 239000007983 Tris buffer Substances 0.000 description 6
- 108090000848 Ubiquitin Proteins 0.000 description 6
- 102000044159 Ubiquitin Human genes 0.000 description 6
- 108010047754 beta-Glucosidase Proteins 0.000 description 6
- 102000006995 beta-Glucosidase Human genes 0.000 description 6
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 6
- 230000007071 enzymatic hydrolysis Effects 0.000 description 6
- 238000006047 enzymatic hydrolysis reaction Methods 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 101150091511 glb-1 gene Proteins 0.000 description 6
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 6
- 235000015097 nutrients Nutrition 0.000 description 6
- 229920001542 oligosaccharide Polymers 0.000 description 6
- 150000002482 oligosaccharides Chemical class 0.000 description 6
- 239000001814 pectin Substances 0.000 description 6
- 229920001277 pectin Polymers 0.000 description 6
- 235000010987 pectin Nutrition 0.000 description 6
- 229910001415 sodium ion Inorganic materials 0.000 description 6
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 5
- 244000303965 Cyamopsis psoralioides Species 0.000 description 5
- 108091034117 Oligonucleotide Proteins 0.000 description 5
- 108010059820 Polygalacturonase Proteins 0.000 description 5
- 229920001213 Polysorbate 20 Polymers 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 235000019755 Starter Diet Nutrition 0.000 description 5
- 239000002253 acid Substances 0.000 description 5
- 239000003674 animal food additive Substances 0.000 description 5
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 5
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000007398 colorimetric assay Methods 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 238000013461 design Methods 0.000 description 5
- 230000000378 dietary effect Effects 0.000 description 5
- 239000006047 digesta Substances 0.000 description 5
- 108010093305 exopolygalacturonase Proteins 0.000 description 5
- 238000000855 fermentation Methods 0.000 description 5
- 230000004151 fermentation Effects 0.000 description 5
- 230000035784 germination Effects 0.000 description 5
- 238000010438 heat treatment Methods 0.000 description 5
- 229910001629 magnesium chloride Inorganic materials 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- PSGAAPLEWMOORI-PEINSRQWSA-N medroxyprogesterone acetate Chemical compound C([C@@]12C)CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2CC[C@]2(C)[C@@](OC(C)=O)(C(C)=O)CC[C@H]21 PSGAAPLEWMOORI-PEINSRQWSA-N 0.000 description 5
- 238000003801 milling Methods 0.000 description 5
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 5
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 5
- 102220092319 rs876657875 Human genes 0.000 description 5
- 239000006054 starter diet Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 235000019746 Digestible methionine Nutrition 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 4
- 102100022624 Glucoamylase Human genes 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 4
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 108091022912 Mannose-6-Phosphate Isomerase Proteins 0.000 description 4
- 102000048193 Mannose-6-phosphate isomerases Human genes 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 238000012408 PCR amplification Methods 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 241000282849 Ruminantia Species 0.000 description 4
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 4
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 238000005903 acid hydrolysis reaction Methods 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 108010089934 carbohydrase Proteins 0.000 description 4
- 238000006555 catalytic reaction Methods 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 235000013330 chicken meat Nutrition 0.000 description 4
- 239000006027 corn-soybean meal Substances 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000000227 grinding Methods 0.000 description 4
- 239000006055 grower diet Substances 0.000 description 4
- 238000003306 harvesting Methods 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 150000002772 monosaccharides Chemical class 0.000 description 4
- 235000021048 nutrient requirements Nutrition 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 239000004460 silage Substances 0.000 description 4
- 238000005549 size reduction Methods 0.000 description 4
- 239000001488 sodium phosphate Substances 0.000 description 4
- 229910000162 sodium phosphate Inorganic materials 0.000 description 4
- 239000012064 sodium phosphate buffer Substances 0.000 description 4
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 4
- 239000011782 vitamin Substances 0.000 description 4
- 235000013343 vitamin Nutrition 0.000 description 4
- 229940088594 vitamin Drugs 0.000 description 4
- 229930003231 vitamin Natural products 0.000 description 4
- 241000589158 Agrobacterium Species 0.000 description 3
- 101710130006 Beta-glucanase Proteins 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 238000007400 DNA extraction Methods 0.000 description 3
- 108010001817 Endo-1,4-beta Xylanases Proteins 0.000 description 3
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 3
- 108010068370 Glutens Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 108090000637 alpha-Amylases Proteins 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 239000012131 assay buffer Substances 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 210000002421 cell wall Anatomy 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000018109 developmental process Effects 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 235000019621 digestibility Nutrition 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 235000021050 feed intake Nutrition 0.000 description 3
- 235000013305 food Nutrition 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- 108010002430 hemicellulase Proteins 0.000 description 3
- 239000004310 lactic acid Substances 0.000 description 3
- 235000014655 lactic acid Nutrition 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 238000011068 loading method Methods 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 150000003722 vitamin derivatives Chemical class 0.000 description 3
- 238000005303 weighing Methods 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- PKAUICCNAWQPAU-UHFFFAOYSA-N 2-(4-chloro-2-methylphenoxy)acetic acid;n-methylmethanamine Chemical compound CNC.CC1=CC(Cl)=CC=C1OCC(O)=O PKAUICCNAWQPAU-UHFFFAOYSA-N 0.000 description 2
- 235000019737 Animal fat Nutrition 0.000 description 2
- 108020004491 Antisense DNA Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 2
- 240000002791 Brassica napus Species 0.000 description 2
- 241000701489 Cauliflower mosaic virus Species 0.000 description 2
- 235000019750 Crude protein Nutrition 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 235000019745 Digestible lysine Nutrition 0.000 description 2
- 235000019748 Digestible threonine Nutrition 0.000 description 2
- 235000019767 Digestible tryptophane Nutrition 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 235000019733 Fish meal Nutrition 0.000 description 2
- 108010093031 Galactosidases Proteins 0.000 description 2
- 102000002464 Galactosidases Human genes 0.000 description 2
- 229920001503 Glucan Polymers 0.000 description 2
- 229920002488 Hemicellulose Polymers 0.000 description 2
- 102000004157 Hydrolases Human genes 0.000 description 2
- 108090000604 Hydrolases Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 108010029541 Laccase Proteins 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 108090001060 Lipase Proteins 0.000 description 2
- 102000004882 Lipase Human genes 0.000 description 2
- 239000004367 Lipase Substances 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 238000010222 PCR analysis Methods 0.000 description 2
- 241000286209 Phasianidae Species 0.000 description 2
- 108010064785 Phospholipases Proteins 0.000 description 2
- 102000015439 Phospholipases Human genes 0.000 description 2
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 244000082988 Secale cereale Species 0.000 description 2
- 235000007238 Secale cereale Nutrition 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- 241000282898 Sus scrofa Species 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- 239000011543 agarose gel Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- JAZBEHYOTPTENJ-JLNKQSITSA-N all-cis-5,8,11,14,17-icosapentaenoic acid Chemical compound CC\C=C/C\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O JAZBEHYOTPTENJ-JLNKQSITSA-N 0.000 description 2
- 102000004139 alpha-Amylases Human genes 0.000 description 2
- 108010084650 alpha-N-arabinofuranosidase Proteins 0.000 description 2
- 229940024171 alpha-amylase Drugs 0.000 description 2
- 229940025131 amylases Drugs 0.000 description 2
- 239000003816 antisense DNA Substances 0.000 description 2
- YZXBAPSDXZZRGB-DOFZRALJSA-N arachidonic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O YZXBAPSDXZZRGB-DOFZRALJSA-N 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 229910021538 borax Inorganic materials 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000004202 carbamide Substances 0.000 description 2
- 235000021466 carotenoid Nutrition 0.000 description 2
- 150000001747 carotenoids Chemical class 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 239000003086 colorant Substances 0.000 description 2
- 238000004825 constant-volume calorimetry Methods 0.000 description 2
- 235000020940 control diet Nutrition 0.000 description 2
- 239000013068 control sample Substances 0.000 description 2
- 238000012937 correction Methods 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 229960005135 eicosapentaenoic acid Drugs 0.000 description 2
- JAZBEHYOTPTENJ-UHFFFAOYSA-N eicosapentaenoic acid Natural products CCC=CCC=CCC=CCC=CCC=CCCCC(O)=O JAZBEHYOTPTENJ-UHFFFAOYSA-N 0.000 description 2
- 235000020673 eicosapentaenoic acid Nutrition 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 238000001952 enzyme assay Methods 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000004467 fishmeal Substances 0.000 description 2
- 239000004459 forage Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 230000007062 hydrolysis Effects 0.000 description 2
- 238000006460 hydrolysis reaction Methods 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000000968 intestinal effect Effects 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 235000021374 legumes Nutrition 0.000 description 2
- 238000012417 linear regression Methods 0.000 description 2
- 235000019421 lipase Nutrition 0.000 description 2
- 235000018977 lysine Nutrition 0.000 description 2
- 238000007403 mPCR Methods 0.000 description 2
- 239000011738 major mineral Substances 0.000 description 2
- 235000011963 major mineral Nutrition 0.000 description 2
- 235000013372 meat Nutrition 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 2
- 239000011574 phosphorus Substances 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- 235000020777 polyunsaturated fatty acids Nutrition 0.000 description 2
- 235000019833 protease Nutrition 0.000 description 2
- 238000011002 quantification Methods 0.000 description 2
- 230000035484 reaction time Effects 0.000 description 2
- 230000001172 regenerating effect Effects 0.000 description 2
- 235000019515 salmon Nutrition 0.000 description 2
- 229940016590 sarkosyl Drugs 0.000 description 2
- 108700004121 sarkosyl Proteins 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- KSAVQLQVUXSOCR-UHFFFAOYSA-M sodium lauroyl sarcosinate Chemical compound [Na+].CCCCCCCCCCCC(=O)N(C)CC([O-])=O KSAVQLQVUXSOCR-UHFFFAOYSA-M 0.000 description 2
- 235000010339 sodium tetraborate Nutrition 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 239000011573 trace mineral Substances 0.000 description 2
- 235000013619 trace mineral Nutrition 0.000 description 2
- BSVBQGMMJUBVOD-UHFFFAOYSA-N trisodium borate Chemical compound [Na+].[Na+].[Na+].[O-]B([O-])[O-] BSVBQGMMJUBVOD-UHFFFAOYSA-N 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 230000003442 weekly effect Effects 0.000 description 2
- FYGDTMLNYKFZSV-WFYNLLPOSA-N (2s,3r,4s,5s,6r)-2-[(2r,4r,5r,6s)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2r,3s,4r,5r,6s)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1[C@@H](CO)O[C@@H](O[C@@H]2[C@H](O[C@H](O)[C@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O FYGDTMLNYKFZSV-WFYNLLPOSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108010013043 Acetylesterase Proteins 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 241000272525 Anas platyrhynchos Species 0.000 description 1
- 229920000189 Arabinogalactan Polymers 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000228245 Aspergillus niger Species 0.000 description 1
- JEBFVOLFMLUKLF-IFPLVEIFSA-N Astaxanthin Natural products CC(=C/C=C/C(=C/C=C/C1=C(C)C(=O)C(O)CC1(C)C)/C)C=CC=C(/C)C=CC=C(/C)C=CC2=C(C)C(=O)C(O)CC2(C)C JEBFVOLFMLUKLF-IFPLVEIFSA-N 0.000 description 1
- 235000007319 Avena orientalis Nutrition 0.000 description 1
- 241000209763 Avena sativa Species 0.000 description 1
- 235000007558 Avena sp Nutrition 0.000 description 1
- 241000194108 Bacillus licheniformis Species 0.000 description 1
- 235000016068 Berberis vulgaris Nutrition 0.000 description 1
- 241000335053 Beta vulgaris Species 0.000 description 1
- 241000219310 Beta vulgaris subsp. vulgaris Species 0.000 description 1
- 108700038091 Beta-glucanases Proteins 0.000 description 1
- 235000014698 Brassica juncea var multisecta Nutrition 0.000 description 1
- 235000006008 Brassica napus var napus Nutrition 0.000 description 1
- 240000007124 Brassica oleracea Species 0.000 description 1
- 235000003899 Brassica oleracea var acephala Nutrition 0.000 description 1
- 235000011301 Brassica oleracea var capitata Nutrition 0.000 description 1
- 235000001169 Brassica oleracea var oleracea Nutrition 0.000 description 1
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 1
- 244000188595 Brassica sinapistrum Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 241000747028 Cestrum yellow leaf curling virus Species 0.000 description 1
- 240000006162 Chenopodium quinoa Species 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 102100028717 Cytosolic 5'-nucleotidase 3A Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 101710089042 Demethyl-4-deoxygadusol synthase Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 101710098247 Exoglucanase 1 Proteins 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 235000019753 Finisher Diet Nutrition 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010073032 Grain Proteins Proteins 0.000 description 1
- 208000015580 Increased body weight Diseases 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 235000019735 Meat-and-bone meal Nutrition 0.000 description 1
- 240000003433 Miscanthus floridulus Species 0.000 description 1
- 102100036617 Monoacylglycerol lipase ABHD2 Human genes 0.000 description 1
- KWYHDKDOAIKMQN-UHFFFAOYSA-N N,N,N',N'-tetramethylethylenediamine Chemical compound CN(C)CCN(C)C KWYHDKDOAIKMQN-UHFFFAOYSA-N 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 241001520808 Panicum virgatum Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 235000019779 Rapeseed Meal Nutrition 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 241001148115 Rhizobium etli Species 0.000 description 1
- 108010003581 Ribulose-bisphosphate carboxylase Proteins 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 244000300264 Spinacia oleracea Species 0.000 description 1
- 235000009337 Spinacia oleracea Nutrition 0.000 description 1
- 235000021536 Sugar beet Nutrition 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 235000019772 Sunflower meal Nutrition 0.000 description 1
- 241000223257 Thermomyces Species 0.000 description 1
- 241000204666 Thermotoga maritima Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 241000223262 Trichoderma longibrachiatum Species 0.000 description 1
- 241001557886 Trichoderma sp. Species 0.000 description 1
- WGLPBDUCMAPZCE-UHFFFAOYSA-N Trioxochromium Chemical compound O=[Cr](=O)=O WGLPBDUCMAPZCE-UHFFFAOYSA-N 0.000 description 1
- 235000019714 Triticale Nutrition 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- LEHOTFFKMJEONL-UHFFFAOYSA-N Uric Acid Chemical compound N1C(=O)NC(=O)C2=C1NC(=O)N2 LEHOTFFKMJEONL-UHFFFAOYSA-N 0.000 description 1
- TVWHNULVHGKJHS-UHFFFAOYSA-N Uric acid Natural products N1C(=O)NC(=O)C2NC(=O)NC21 TVWHNULVHGKJHS-UHFFFAOYSA-N 0.000 description 1
- 229920002000 Xyloglucan Polymers 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 108700007346 Zea mays oleosin Proteins 0.000 description 1
- 229920002494 Zein Polymers 0.000 description 1
- 238000011481 absorbance measurement Methods 0.000 description 1
- 108010093941 acetylxylan esterase Proteins 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000002154 agricultural waste Substances 0.000 description 1
- OENHQHLEOONYIE-UKMVMLAPSA-N all-trans beta-carotene Natural products CC=1CCCC(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C OENHQHLEOONYIE-UKMVMLAPSA-N 0.000 description 1
- 108010061261 alpha-glucuronidase Proteins 0.000 description 1
- 238000009165 androgen replacement therapy Methods 0.000 description 1
- 235000019730 animal feed additive Nutrition 0.000 description 1
- 235000019728 animal nutrition Nutrition 0.000 description 1
- 230000000433 anti-nutritional effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000008346 aqueous phase Substances 0.000 description 1
- 235000019312 arabinogalactan Nutrition 0.000 description 1
- 229940114079 arachidonic acid Drugs 0.000 description 1
- 235000021342 arachidonic acid Nutrition 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000013793 astaxanthin Nutrition 0.000 description 1
- 239000001168 astaxanthin Substances 0.000 description 1
- MQZIGYBFDRPAKN-ZWAPEEGVSA-N astaxanthin Chemical compound C([C@H](O)C(=O)C=1C)C(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)C(=O)[C@@H](O)CC1(C)C MQZIGYBFDRPAKN-ZWAPEEGVSA-N 0.000 description 1
- 229940022405 astaxanthin Drugs 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 108010019077 beta-Amylase Proteins 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 235000013734 beta-carotene Nutrition 0.000 description 1
- 239000011648 beta-carotene Substances 0.000 description 1
- TUPZEYHYWIEDIH-WAIFQNFQSA-N beta-carotene Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)C=CC=C(/C)C=CC2=CCCCC2(C)C TUPZEYHYWIEDIH-WAIFQNFQSA-N 0.000 description 1
- 229960002747 betacarotene Drugs 0.000 description 1
- 239000012496 blank sample Substances 0.000 description 1
- 239000002374 bone meal Substances 0.000 description 1
- 229940036811 bone meal Drugs 0.000 description 1
- 235000019751 broiler diet Nutrition 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- YYRMJZQKEFZXMX-UHFFFAOYSA-L calcium bis(dihydrogenphosphate) Chemical compound [Ca+2].OP(O)([O-])=O.OP(O)([O-])=O YYRMJZQKEFZXMX-UHFFFAOYSA-L 0.000 description 1
- 238000004422 calculation algorithm Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 235000012682 canthaxanthin Nutrition 0.000 description 1
- FDSDTBUPSURDBL-DKLMTRRASA-N canthaxanthin Chemical compound CC=1C(=O)CCC(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)C(=O)CCC1(C)C FDSDTBUPSURDBL-DKLMTRRASA-N 0.000 description 1
- 230000034149 carbohydrate storage Effects 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000004534 cecum Anatomy 0.000 description 1
- FYGDTMLNYKFZSV-ZWSAEMDYSA-N cellotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@@H](O[C@@H]2[C@H](OC(O)[C@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O FYGDTMLNYKFZSV-ZWSAEMDYSA-N 0.000 description 1
- 108010080434 cephalosporin-C deacetylase Proteins 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000002485 combustion reaction Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 238000012864 cross contamination Methods 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 102000038379 digestive enzymes Human genes 0.000 description 1
- 108091007734 digestive enzymes Proteins 0.000 description 1
- 230000023011 digestive tract development Effects 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- UKWLRLAKGMZXJC-QIECWBMSSA-L disodium;[4-chloro-3-[(3r,5s)-1-chloro-3'-methoxyspiro[adamantane-4,4'-dioxetane]-3'-yl]phenyl] phosphate Chemical compound [Na+].[Na+].O1OC2([C@@H]3CC4C[C@H]2CC(Cl)(C4)C3)C1(OC)C1=CC(OP([O-])([O-])=O)=CC=C1Cl UKWLRLAKGMZXJC-QIECWBMSSA-L 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- YERABYSOHUZTPQ-UHFFFAOYSA-P endo-1,4-beta-Xylanase Chemical compound C=1C=CC=CC=1C[N+](CC)(CC)CCCNC(C(C=1)=O)=CC(=O)C=1NCCC[N+](CC)(CC)CC1=CC=CC=C1 YERABYSOHUZTPQ-UHFFFAOYSA-P 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 108010038658 exo-1,4-beta-D-xylosidase Proteins 0.000 description 1
- 210000003746 feather Anatomy 0.000 description 1
- 230000002550 fecal effect Effects 0.000 description 1
- 239000006056 finisher diet Substances 0.000 description 1
- 235000019688 fish Nutrition 0.000 description 1
- 235000021323 fish oil Nutrition 0.000 description 1
- -1 flavorings Substances 0.000 description 1
- 238000001917 fluorescence detection Methods 0.000 description 1
- 235000012041 food component Nutrition 0.000 description 1
- 239000000446 fuel Substances 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 229940098330 gamma linoleic acid Drugs 0.000 description 1
- VZCCETWTMQHEPK-UHFFFAOYSA-N gamma-Linolensaeure Natural products CCCCCC=CCC=CCC=CCCCCC(O)=O VZCCETWTMQHEPK-UHFFFAOYSA-N 0.000 description 1
- VZCCETWTMQHEPK-QNEBEIHSSA-N gamma-linolenic acid Chemical compound CCCCC\C=C/C\C=C/C\C=C/CCCCC(O)=O VZCCETWTMQHEPK-QNEBEIHSSA-N 0.000 description 1
- 210000003736 gastrointestinal content Anatomy 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000021312 gluten Nutrition 0.000 description 1
- 235000011868 grain product Nutrition 0.000 description 1
- 230000005484 gravity Effects 0.000 description 1
- 239000004519 grease Substances 0.000 description 1
- 239000004463 hay Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229940059442 hemicellulase Drugs 0.000 description 1
- 210000003405 ileum Anatomy 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 230000003871 intestinal function Effects 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 235000004213 low-fat Nutrition 0.000 description 1
- 235000012680 lutein Nutrition 0.000 description 1
- 229960005375 lutein Drugs 0.000 description 1
- 239000001656 lutein Substances 0.000 description 1
- KBPHJBAIARWVSC-RGZFRNHPSA-N lutein Chemical compound C([C@H](O)CC=1C)C(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\[C@H]1C(C)=C[C@H](O)CC1(C)C KBPHJBAIARWVSC-RGZFRNHPSA-N 0.000 description 1
- ORAKUVXRZWMARG-WZLJTJAWSA-N lutein Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)C=CC=C(/C)C=CC2C(=CC(O)CC2(C)C)C ORAKUVXRZWMARG-WZLJTJAWSA-N 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002742 methionines Chemical class 0.000 description 1
- 235000019713 millet Nutrition 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 235000019691 monocalcium phosphate Nutrition 0.000 description 1
- 229910000150 monocalcium phosphate Inorganic materials 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- CKQVRZJOMJRTOY-UHFFFAOYSA-N octadecanoic acid;propane-1,2,3-triol Chemical compound OCC(O)CO.CCCCCCCCCCCCCCCCCC(O)=O CKQVRZJOMJRTOY-UHFFFAOYSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 108010087558 pectate lyase Proteins 0.000 description 1
- 239000004466 pelleted feed Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000002367 phosphate rock Substances 0.000 description 1
- 230000037039 plant physiology Effects 0.000 description 1
- 230000010152 pollination Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000004456 rapeseed meal Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 210000004767 rumen Anatomy 0.000 description 1
- 239000004576 sand Substances 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- XOIQMTLWECTKJL-FBZUZRIGSA-M sodium;(2s,3r,4s)-4-[(2s,5r,7s,8r,9s)-2-[(2r,5s)-5-ethyl-5-[(2r,3s,5r)-5-[(2s,3s,5r,6r)-6-hydroxy-6-(hydroxymethyl)-3,5-dimethyloxan-2-yl]-3-methyloxolan-2-yl]oxolan-2-yl]-7-hydroxy-2,8-dimethyl-1,10-dioxaspiro[4.5]decan-9-yl]-3-methoxy-2-methylpentanoate Chemical compound [Na+].C([C@@](O1)(C)[C@H]2CC[C@@](O2)(CC)[C@H]2[C@H](C[C@@H](O2)[C@@H]2[C@H](C[C@@H](C)[C@](O)(CO)O2)C)C)C[C@@]21C[C@H](O)[C@@H](C)[C@@H]([C@@H](C)[C@@H](OC)[C@H](C)C([O-])=O)O2 XOIQMTLWECTKJL-FBZUZRIGSA-M 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000010907 stover Substances 0.000 description 1
- 239000010902 straw Substances 0.000 description 1
- 235000020238 sunflower seed Nutrition 0.000 description 1
- 230000000153 supplemental effect Effects 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 230000001502 supplementing effect Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 235000008521 threonine Nutrition 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- OGIDPMRJRNCKJF-UHFFFAOYSA-N titanium oxide Inorganic materials [Ti]=O OGIDPMRJRNCKJF-UHFFFAOYSA-N 0.000 description 1
- KBPHJBAIARWVSC-XQIHNALSSA-N trans-lutein Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CC(O)CC1(C)C)C=CC=C(/C)C=CC2C(=CC(O)CC2(C)C)C KBPHJBAIARWVSC-XQIHNALSSA-N 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 235000019731 tricalcium phosphate Nutrition 0.000 description 1
- 229910000391 tricalcium phosphate Inorganic materials 0.000 description 1
- 229940078499 tricalcium phosphate Drugs 0.000 description 1
- 150000004043 trisaccharides Chemical class 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229940116269 uric acid Drugs 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 241000228158 x Triticosecale Species 0.000 description 1
- FJHBOVDFOQMZRV-XQIHNALSSA-N xanthophyll Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CC(O)CC1(C)C)C=CC=C(/C)C=CC2C=C(C)C(O)CC2(C)C FJHBOVDFOQMZRV-XQIHNALSSA-N 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
- 239000005019 zein Substances 0.000 description 1
- 229940093612 zein Drugs 0.000 description 1
- OENHQHLEOONYIE-JLTXGRSLSA-N β-Carotene Chemical compound CC=1CCCC(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C OENHQHLEOONYIE-JLTXGRSLSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
- C12Q1/6895—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for plants, fungi or algae
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/30—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/30—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
- A23K10/37—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms from waste material
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K10/00—Animal feeding-stuffs
- A23K10/30—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms
- A23K10/37—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms from waste material
- A23K10/38—Animal feeding-stuffs from material of plant origin, e.g. roots, seeds or hay; from material of fungal origin, e.g. mushrooms from waste material from distillers' or brewers' waste
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/105—Aliphatic or alicyclic compounds
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/158—Fatty acids; Fats; Products containing oils or fats
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/174—Vitamins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/189—Enzymes
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/195—Antibiotics
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/20—Inorganic substances, e.g. oligoelements
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/20—Inorganic substances, e.g. oligoelements
- A23K20/28—Silicates, e.g. perlites, zeolites or bentonites
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/20—Inorganic substances, e.g. oligoelements
- A23K20/30—Oligoelements
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K40/00—Shaping or working-up of animal feeding-stuffs
- A23K40/10—Shaping or working-up of animal feeding-stuffs by agglomeration; by granulation, e.g. making powders
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K50/00—Feeding-stuffs specially adapted for particular animals
- A23K50/10—Feeding-stuffs specially adapted for particular animals for ruminants
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K50/00—Feeding-stuffs specially adapted for particular animals
- A23K50/70—Feeding-stuffs specially adapted for particular animals for birds
- A23K50/75—Feeding-stuffs specially adapted for particular animals for birds for poultry
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/24—Hydrolases (3) acting on glycosyl compounds (3.2)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6809—Methods for determination or identification of nucleic acids involving differential detection
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6811—Selection methods for production or design of target specific oligonucleotides or binding molecules
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6813—Hybridisation assays
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2600/00—Oligonucleotides characterized by their use
- C12Q2600/13—Plant traits
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P60/00—Technologies relating to agriculture, livestock or agroalimentary industries
- Y02P60/80—Food processing, e.g. use of renewable energies or variable speed drives in handling, conveying or stacking
- Y02P60/87—Re-use of by-products of food processing for fodder production
Definitions
- This disclosure relates to transgenic plants expressing glucanases with improved thermal stability, nucleic acids encoding the same, as well as methods of processing transgenic plants and tissues, and producing and utilizing animal feed.
- This disclosure also relates to feed additives and grain and fiber processing additives that include glucanases.
- NSPs non-starch polysaccharides
- cellulose, hemicellulose, xyloglucans, arabionxylans, galactans, arabinogalactans, etc. are among the primary structural components of plant cell wall (cellulose, hemicellulose, xyloglucans, arabionxylans, galactans, arabinogalactans, etc.) and can also serve as carbohydrate storage reserves in some plants. Additionally, pectins and gums are considered non-cell wall NSP.
- NSPs Because of their various structural and biological roles, NSPs often bind or encase the starch, proteins, fats and other nutrients that are present in plant-based feed ingredients (such as cereals, legumes, silage etc.) and other ingredients, inhibiting the animal's ability to digest nutrients efficiently. Increased levels of NSPs in the diet may increase viscosity of intestinal contents, which can interfere with digestive enzymes and reduce the digestibility of nutrients, thereby increasing feed conversion (mass of feed divided by the mass of meat produced) and reducing body weight gain (Iji, P. A. 1999. The impacts of cereal non-starch polysaccharides on intestinal development and function in the broiler chickens. Worlds Poult. Sci. J.
- NSPs have also been known to inadvertently trigger immune responses in the gut, which may further detract from efficiency of feed utilization and have implications for animal health.
- diets now also routinely contain DDGS (dried distillers grains and solubles) that is also not easily digested.
- DDGS diet metabolizable energy
- ME diet metabolizable energy
- carbohydrases to corn-soybean meal-based broiler diets, when formulated to have a 3% reduction in dietary ME, has been accomplished without compromising the feed conversions of broilers reared under either hot or cool seasons. It has been determined that the hydrolyzed ⁇ -d-glucan is responsible for improved growth.
- the invention relates to a method of identifying maize event 4588.259, 4588.757 or 4588.652 in a sample.
- the method comprises contacting a sample with a first primer and a second primer.
- the method comprises amplifying a nucleic acid in the sample to obtain an amplified product.
- the method also comprises detecting the amplified product specific to a target sequence in maize event 4588.259, 4588.757 or 4588.652.
- the invention relates to an animal feedstock comprising a transgenic plant or part thereof.
- the transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase.
- the glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- the invention relates to a method of producing an animal feedstock.
- the method includes mixing a transgenic plant or part thereof with plant material to form a mixture.
- the transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase.
- the glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- the invention relates to a method of increasing metabolizable energy of a diet.
- the method includes mixing a transgenic plant or part thereof with a feed ingredient.
- the transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase comprising an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- the invention relates to a method of enhancing production of fermentable sugars from grains.
- the method includes mixing grains derived from any one of the transgenic plants described herein with grains derived from a different plant to form mixed grains.
- the method also includes processing mixed grains into fermentable sugars.
- the fermentable sugars are subsequently converted into ethanol or a similar fermentation product, which may include butanol, lactic acid, citric acid, acetic acid, or other fuels or chemicals.
- the invention relates to a transgenic plant, transgenic grain, or transgenic biomass comprising a synthetic nucleic acid encoding a glucanase.
- the glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6.
- the glucanase is capable of degrading one or more polysaccharides.
- the invention relates to a synthetic polypeptide or a fragment thereof.
- the synthetic polypeptide or a fragment thereof comprises an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6.
- the glucanase is capable of degrading one or more polysaccharides.
- FIG. 1 illustrates the expression vector pAG4258 carrying a single feed glucanase expression unit.
- FIG. 2 illustrates the expression vector pAG4588 carrying a single feed glucanase expression unit.
- FIG. 3 illustrates the expression vector pAG4597 carrying a single feed glucanase expression unit.
- FIG. 4 illustrates the expression vector pAG4708 carrying a single feed glucanase expression unit.
- FIG. 5 illustrates the expression vector pAG4766 carrying two feed glucanase expression units.
- FIG. 6 illustrated the expression vector pAG4767 carrying two feed glucanase expression units.
- FIG. 7 illustrates the expression vector pAG4770 carrying three feed glucanase expression units.
- FIG. 8 illustrates the expression vector pAG4771 carrying three feed glucanase expression units.
- FIG. 9 is a chart illustrating the range of glucanase activity recovered from ears of the maize plants that carried pAG4588 construct.
- FIG. 10 is a chart illustrating the range of glucanase activity recovered from ears of the maize plants that carried pAG4597 construct.
- FIG. 11 is a diagram showing the T-DNA integration site in chromosome 7 of maize event 4588.652.
- FIG. 12 is a chart illustrating glucanase activity observed in T1 plants.
- FIG. 13 is a chart illustrating the glucanase activity in the seeds of hemizygous, homozygous, and hybrid plants.
- FIG. 14 illustrates general design of the real-time PCR assay used to determine presence of the T-DNA locus (standard and real-time PCR) and zygosity (real-time PCR only) in transgenic events.
- Letters A, B, X and Y with arrows indicate primer binding sites.
- Rectangular boxes A+B and X+Y represent PCR products amplified from respective primer pairs.
- FIG. 15 illustrates general design of the standard PCR assay used to determine presence of the T-DNA locus and zygosity in transgenic events.
- Letters A, B, and C with arrows indicate primer binding sites.
- Rectangular boxes A+B and A+C represent PCR products amplified from respective primer pairs.
- FIG. 16 illustrates the standard multiplex PCR analysis of the selfed segregating 4588.652 plants.
- FIG. 17 is a graph illustrating real-time PCR data to determine presence of the T-DNA locus and zygosity for maize event 4588.259 (FG259).
- FIGS. 18A and 18B are charts illustrating glucanase activity in the Grower Diet ( FIG. 18A ) and the Starter Diet ( FIG. 18B ) before and after pelleting.
- FIGS. 19A and 19B are charts illustrating glucanase activity in wild type (WT) flour mixed with microbial glucanase and transgenic flour producing glucanase after heat treatment at temperatures of 130° C. ( FIG. 19A ) and 94° C. ( FIG. 19B ).
- FIGS. 20 and 21 are graphs illustrating the optimum pH for measuring AGR2314 activity in an assay at 37° C. ( FIG. 20 ) and 80° C. ( FIG. 21 ).
- FIG. 22 is a graph illustrating an example of the optimum pH of the feed glucanase that is produced in transgenic flour.
- FIGS. 23A and 23B are charts illustrating glucanase activity on multiple substrates at 37° C. ( FIG. 23A ) and 80° C. ( FIG. 23B ).
- FIGS. 24A and 24B are charts illustrating enzymatic hydrolysis of untreated seeds fiber of transgenic maize plants expressing AGR2314.
- FIG. 24A shows glucose yield and
- FIG. 24B shows xylose yield.
- FIGS. 25A and 25B are charts illustrating enzymatic hydrolysis of seed fiber of transgenic maize plants expressing AGR2314 pretreated with the dilute acid.
- FIG. 25A shows glucose yield and
- FIG. 25B shows xylose yield.
- FIG. 26 is a chart illustrating the body weight gain (BWG) during the 28-day poultry feeding trial.
- FIG. 27 is a chart illustrating the changes in poultry BWG per time interval during 28 day feeding trial.
- FIG. 28 is a chart illustrating feed consumption during the 28-day poultry feeding trial using two different diets (corn/barley based and corn/LF-DDGS based) with (+) or without ( ⁇ ) a glucanase.
- FIG. 29 is a chart illustrating feed conversion rate (FCR) during the 28-day poultry feeding trial with two different diets (corn/barley based and corn/LF-DDGS based diets) with (+) or without ( ⁇ ) a glucanase.
- FCR feed conversion rate
- FIG. 30 is a chart illustrating the effect of glucanase on poultry BWF in experimental treatment.
- “Synthetic nucleic acid sequence,” “synthetic polynucleotide,” “synthetic oligonucleotide,” “synthetic DNA,” or “synthetic RNA” as used herein refers to a nucleic acid sequence, a polynucleotide, an oligonucleotide, DNA, or RNA that differs from one found in nature by having a different sequence than one found in nature or a chemical modification not found in nature. This can include, but is not limited to, a DNA sequence created using biotechnology tools.
- Such tools include but are not limited to recombinant DNA technology, polymerase chain reaction (PCR), biotechnology mutagenesis techniques using PCR or recombination techniques including digestion and ligation of DNA, chemical mutagenesis techniques, chemical synthesis, or directed use of nucleases (so called “genome editing” or “gene optimizing” technologies).
- Synthetic protein refers to a protein, polypeptide, oligopeptide or peptide that was made through a synthetic process.
- the synthetic process can include, but is not limited, to chemical synthesis or recombinant technology.
- the synthetic process may include production of a protein, polypeptide, oligopeptide or peptide by expression of a synthetic nucleic acid sequence in a living cell or by in vitro expression using a cell-free extract.
- variant refers to a molecule that retains a biological activity that is the same or substantially similar to that of the original sequence.
- the variant may be from the same or different species or be a synthetic sequence based on a natural or prior molecule.
- alignment refers to a plurality of nucleic acid or amino acid sequences aligned lengthwise for visual identification of commonly shared nucleotides or amino acids. The percentage of commonly shared nucleotides or amino acid is related to homology or identity between sequences. An alignment may be determined by or used to identify conserved domains and relatedness between the sequences. An alignment may be determined by computer programs such as CLUSTAL 0 (1.2.1) (Sievers et al. (2011) Molecular Systems Biology 7: 539 doi: 10. 1038/msb.2011.75).
- a synthetic nucleic acid encoding a glucanase is provided.
- the synthetic nucleic acid may include a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 1 [AGR2314], SEQ ID NO: 2 [AGR2414], and SEQ ID NO: 3 [AGR2514].
- the encoded glucanase may be capable of degrading one or more polysaccharides.
- An embodiment includes a glucanase that includes a synthetic polypeptide having a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414], and SEQ ID NO: 6 [AGR2514].
- the glucanase may be capable of degrading one or more polysaccharides.
- the glucanase may be modified for improved thermal stability.
- a glucanase modified for thermal stability can be produced by standard molecular biological techniques and then screened.
- the glucanase can be subjected to mutation and then screened for thermal stability.
- Screening systems that can be utilized include lambda phage, yeast, or other expression systems that allow production of the protein and/or testing of its physical and/or functional characteristics. From a population of modified proteins, candidates can be isolated and analyzed further. Further analysis may include DNA sequencing, functional assays, structural assays, enzyme activity assays, and monitoring changes in thermal stability, or structure in response to elevated temperature conditions.
- a glucanase may be produced in a plant or plant tissue.
- the glucanase may be isolated from the plant or plant tissue.
- An embodiment includes a composition comprising, consisting essentially of, or consisting of one or more glucanases.
- the composition may be, but is not limited, to a transgenic plant including the one or more glucanases, an animal feedstock or animal feed additive including the one or more glucanases or an enzyme mixture including the one or more glucanases.
- a glucanase in the composition may be encoded by any one of the synthetic nucleic acids described herein.
- the term “glucanase” refers to an enzyme capable of catalyzing the degradation or depolymerization of complex carbohydrates.
- a glucanase in the composition may be capable of degrading one or more of disaccharides, trisaccharides, and oligosaccharides into lower molecular weight saccharides.
- a glucanase in the composition may be capable of degrading one or more of cellooligosaccharide, lignocellulose, cellulose, hemicellulose, and pectin.
- a glucanase of the composition may act upon cellulose or mixed linkage beta glucans Some glucanases may have broader substrate specificities and may act on a wide range of carbohydrate polymers.
- a glucanase of the composition may have enzymatic activity on a range of carbohydrate polymers.
- Such enzymatic activit may be, but is not limited to, endoglucanase, exoglucanase, ⁇ -glucosidase, cellobiohydrolase, endo-1,4- ⁇ -xylanase, ⁇ -xylosidase, ⁇ -glucuronidase, ⁇ -L-arabinofuranosidase, acetylesterase, acetylxylanesterase, ⁇ -amylase, ⁇ -amylase, glucoamylase, pullulanase, ⁇ -glucanase, hemicellulase, arabinosidase, mannanase, pectin hydrolase, or pectate lyase activities.
- the glucanase of the composition may be capable of degrading one or more of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
- Assays for determining activity of a glucanase for degrading various substrates are known in the art.
- the beta-glucosidase assay, endocellulase assay, exocellulase (cellobiohydrolase) assay, amylase assay, endoxylanase assay, pectinase assay, 1,3-beta-glucosidase assay, 1,4-beta-glucosidase assay are described herein in Example 13.
- a glucanase of the composition may comprise, consist essentially of, or consist of an amino acid sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414] and SEQ ID NO: 6 [AGR2514].
- An embodiment includes a composition comprising, consisting essentially of, or consisting of an individual glucanase or a combination of two or more glucanases herein.
- a glucanase of the composition may be a variant.
- Variants may include conservative amino acid substitutions; i.e., substitutions with amino acids having similar properties.
- Conservative substitutions may be a polar for polar amino acid (Glycine (G, Gly), Serine (S, Ser), Threonine (T, Thr), Tyrosine (Y, Tyr), Cysteine (C, Cys), Asparagine (N, Asn) and Glutamine (Q, Gln)); a non-polar for non-polar amino acid (Alanine (A, Ala), Valine (V, Val), Thyptophan (W, Trp), Leucine (L, Leu), Proline (P, Pro), Methionine (M, Met), Phenilalanine (F, Phe)); acidic for acidic amino acid (Aspartic acid (D, Asp), Glutamic acid (E, Glu)); basic for basic amino acid (Arginine (R, Arg), Histidine (H,
- Conservative nucleotide substitutions may be made in a nucleic acid sequence by substituting a codon for an amino acid with a different codon for the same amino acid. Variants may include non-conservative substitutions.
- a variant may have 40% glucanase activity in comparison to the unchanged glucanase.
- a variant may have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% activity, or an integer between any of the two values herein, in comparison to the unchanged glucanase.
- the one or more proteins having less than 100% identity to its corresponding amino acid sequence of SEQ ID NOS: 4-6 is a variant of the referenced protein or amino acid.
- an isolated protein, polypeptide, oligopeptide, or peptide having a sequence with at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a protein having the sequence of any one of SEQ ID NOS: 4-6 may be a less than full length protein having the sequence with at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity any one of SEQ ID NO: 4-6 along 6, 10 to 50, 10 to 100, 10 to 150, 10 to 300, 10 to 400, 10 to 500, 10 to 600, 10 to 700, 10 to 800, 10 to 900, or 10 to all amino acids of a protein.
- sequence lengths encompasses every full length protein in SEQ ID NOS: 4-6 and every smaller length within the list, even for proteins that do not include over 400 amino acids. For example, the lengths of 6, 10 to 50, 10 to 100, 10 to 150, 10 to 300, 10 to 400, and 10 to all amino acids would apply to a sequence with 322 amino acids.
- a range of amino acid sequence lengths recited herein includes every length of amino acid sequence within the range, endpoints inclusive. The recited length of amino acids may start at any single position within a reference sequence where enough amino acids follow the single position to accommodate the recited length.
- the fragment of the glucanase may be a subsequence of the polypeptides herein that retain at least 40% activity of the glucanase.
- the fragment may have 316, 317, or 322 amino acids.
- the fragments may include 20, 30, 40, 50, 100, 150, 200, or 300 contiguous amino acids.
- Embodiments also include nucleic acids encoding said amino acid sequences, and antibodies recognizing epitopes on said amino acid sequences.
- a less than full length amino acid sequence may be selected from any portion of one of the sequences of SEQ ID NOS: 4-6 corresponding to the recited length of amino acids.
- a less than full length amino acid sequence may be selected from a portion of any one of SEQ ID NOS: 4-6 having a catalytic domain.
- the fragment may include a catalytic domain of a glucanase.
- the catalytic domain of the glucanase of SEQ ID NO: 4 [AGR2314] includes the following sequence:
- positions 136 and 253 in SEQ ID NO: 21 are catalytic residues in the active site, and a less than full length amino acid sequence selected from SEQ ID NO: 21 may include residues 134 and 135 at any two respective, consecutive positions within the recited length.
- a less than full length amino acid sequence may be selected from a portion of any one of SEQ ID NO: 21 may have other active site residues that interact with the substrate.
- positions 20, 35, 36, 135, 198, 205, 210 and 286 of SEQ ID NO: 21 are the active site residues that interact with the substrate, and a less than full length amino acid sequence selected from SEQ ID NO: 21 may include residues 20, 35, 36, 135, 198, 205, 210 and 286 at any respective, consecutive positions within the recited length.
- a less than full length amino acid sequence may be selected from a portion of any one of SEQ ID NO: 21 may include amino acids 136-253.
- a less than full length amino acid sequence may possess the glucanase activity.
- a less than full length amino acid sequence may be capable of degrading polysaccharides.
- a less than full length amino acid sequence may contain those amino acids would contain the active site residues.
- a catalytic domain may be a conserved domain.
- a “conserved domain” herein refers to a region in a heterologous polynucleotide or polypeptide sequences where there is a relatively high degree of sequence identity between the distinct sequences. With respect to polynucleotides encoding a conserved domain is preferably at least 10 base pairs (bp) in length.
- a conserved domain of any one of polypeptides described herein refers to a domain within a glucanase that exhibits a higher degree of sequence identity
- High degree of sequence identity may be at least 50% identity, at least 55% identity, at least 60% identity, at least 65%, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or at least 100% identity to consecutive amino acid residues of a polypeptide described herein.
- conserveed domains may be identified as domains of identity to a specific consensus sequence.
- conserved domains may be identified by using alignment methods. conserveed domain may be identified with multiple sequence alignments of related proteins. These alignments reveal sequence regions containing the same, or similar, patterns of amino acids. Multiple sequence alignments, three-dimensional structure and three-dimensional structure superposition of conserved domains can be used to infer sequence, structure, and functional relationships. Since the presence of a particular conserved domain within a polypeptide is highly correlated with an evolutionarily conserved function, a conserved domain database may be used to identify the amino acids in a protein sequence that are putatively involved in functions such as degrading polysaccharides, as mapped from conserved domain annotations to the query sequence.
- Sequences herein referred to as functionally-related and/or closely-related to the sequences or domains of polypeptides having sequences of SEQ ID NOS: 4-6 may have conserved domains that share at least at least ten amino acids in length and at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% or 96%, 97%, 98%, or at least 99%, or about 100% amino acid identity to the sequences of AGR2314, AGR2414 and AGR2514, and have similar functions that the polypeptides of the instant description.
- sequences of AGR2314, AGR2414, and AGR2514 may be aligned as shown below.
- AGR2414 sequence is a sequence of Thermotoga maritima Cel5A (3AMC in Protein Data Bank and in PubMed protein sequence database). Residues that interact with the substrate are underlined and are shown in enlarged bold characters: N20, H95, H96, N135, E136 (catalytic residue), Y198, H205, W210, E253 (catalytic residue), W286. (T. Wu et al. (2011), Biochim. Biophys. Acta 1814, 1.832-1840, which is incorporated herein by reference as if fully set forth). The numbering of these residues in AGR2514 is one higher because of the presence of one additional residue at the N-terminus in this sequence.
- sequences of AGR2314 and AGR2414 have 305 residues conserved out of 317 residues and have 96% identity.
- sequences of AGR2414 and AGR2514 below have 310 residues conserved out of 318 residues and have 97% identity.
- sequences of AGR2314 and AGR2514 have 308 residues conserved out of 318 residues and have 97% identity.
- glucanase variants, or fragments thereof, may be determined using any methods.
- the functionality of a glucanase may be measured by any one of the assays described in Example 3.
- Any one or more glucanases herein may be expressed in a plant upon introduction into the plant genome of any one more of synthetic nucleic acids described herein.
- the methods of introduction of synthetic nucleic acids into the plants are known in the art.
- the method may be transformation of the plant with a vector that includes synthetic nucleic acids.
- the synthetic polynucleotide may include any one of the synthetic nucleic acids described here
- a vector is provided.
- the vector may include any one of the synthetic polynucleotides or nucleic acids described herein.
- synthetic nucleic acids are provided having a sequence as set forth in any one of the nucleic acids listed herein or the complement thereof.
- isolated nucleic acids having a sequence that hybridizes to a nucleic acid having the sequence of any nucleic acid listed herein or the complement thereof are provided.
- the hybridization conditions are low stringency conditions.
- the hybridization conditions are moderate stringency conditions.
- the hybridization conditions are high stringency conditions.
- the hybridization may be along the length of the synthetic nucleic acid. Examples of hybridization protocols and methods for optimization of hybridization protocols are described in the following publications: Molecular Cloning, T. Maniatis, E. F. Fritsch, and J.
- moderate conditions may be as follows: membranes loaded with DNA samples are prehybridized for at least 15 minutes at 55° C. in the hybridization buffer (12% (w/v) urea, 0.5M NaCl, 4% (w/v) blocking reagent). The labeled probe is added to the same solution and hybridization is carried overnight at 55° C. The membranes are washed for 10 minutes at 55° C. in the primary wash solution (2M urea, 0.1% (W/v) SDS, 50 mM of 0.5M Na phosphate pH 7.0, 150 mM NaCl, 1 mM of 1.0 M Mg Cl 2 and 0.2% (w/v) of blocking reagent).
- the washing procedure is repeated.
- the membranes are placed in a clean container and washed for 5 minutes in a secondary buffer (1M Tris base, and 2M NaCl).
- the washing in the secondary solution is performed two more time.
- Chemoluminescence was detected using CDP-STAR® substrate for alkaline phosphatase.
- Low stringency refers to hybridization conditions at low temperatures, for example, between 37° C. and 60° C.
- High stringency refers to hybridization conditions at high temperatures, for example, over 68° C.
- moderate conditions may be as follows: filters loaded with DNA samples are pretreated for 2-4 hours at 68° C. in a solution containing 6 ⁇ citrate buffered saline (SSC; Amresco, Inc., Solon, Ohio), 0.5% sodium dodecyl sulfate (SDS; Amresco, Inc., Solon, Ohio), 5 ⁇ Denhardt's solution (Amresco, Inc., Solon, Ohio), and denatured salmon sperm (Invitrogen Life Technologies, Inc. Carlsbad, Calif.).
- SSC 6 ⁇ citrate buffered saline
- SDS sodium dodecyl sulfate
- Amresco, Inc., Solon, Ohio 5 ⁇ Denhardt's solution
- denatured salmon sperm Invitrogen Life Technologies, Inc. Carlsbad, Calif.
- Hybridization is carried in the same solution with the following modifications: 0.01 M EDTA (Amresco, Inc., Solon, Ohio), 100 ⁇ g/ml salmon sperm DNA, and 5-20 ⁇ 10 6 cpm 32 P-labeled or fluorescently labeled probes. Filters are incubated in hybridization mixture for 16-20 hours and then washed for 15 minutes in a solution containing 2 ⁇ SSC and 0.1% SDS. The wash solution is replaced for a second wash with a solution containing 0.1 ⁇ SSC and 0.5% SDS and incubated an additional 2 hours at 20° C. to 29° C. below Tm (melting temperature in ° C.).
- Tm 81.5+16.61 Log 10 [Na + ]/(1.0+0.7[Na + ]))+0.41(%[G+C]) ⁇ (500/n) ⁇ P-F.
- [Na+] Molar concentration of sodium ions.
- %[G+C] percent of G+C bases in DNA sequence.
- N length of DNA sequence in bases.
- P a temperature correction for % mismatched base pairs (1° C. per 1% mismatch).
- Low stringency conditions refers to hybridization conditions at low temperatures, for example, between 37° C.
- nucleic acids having a sequence that has at least 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity along its length to a contiguous portion of a nucleic acid having any one of the sequences set forth herein or the complements thereof are provided.
- the contiguous portion may be the entire length of a sequence set forth herein or the complement thereof.
- a synthetic nucleic acid may encode the fragment of a glucanase that have 316, 317, or 322 amino acids.
- the synthetic nucleic acids may encode the fragments that include 20, 30, 40, 50, 100, 150, 200, or 300 contiguous amino acids and retain at least 40% activity of the glucanase.
- the functionality of a glucanase, variants, or fragments thereof, may be determined using any methods.
- the functionality of a glucanase may be measured by any one of the assays described in Example 3.
- Determining percent identity of two amino acid sequences or two nucleic acid sequences may include aligning and comparing the amino acid residues or nucleotides at corresponding positions in the two sequences. If all positions in two sequences are occupied by identical amino acid residues or nucleotides then the sequences are said to be 100% identical. Percent identity can be measured by the Smith Waterman algorithm (Smith T F, Waterman M S 1981 “Identification of Common Molecular Subsequences,” Journal of Molecular Biology 147: 195-197, which is incorporated by reference in its entirety as if fully set forth).
- synthetic nucleic acids, polynucleotides, or oligonucleotides are provided having a portion of the sequence as set forth in any one of the nucleic acids listed herein or the complement thereof.
- These isolated nucleic acids, polynucleotides, or oligonucleotides are not limited to but may have a length in the range from 10 to full length, 10 to 800, 10 to 10 to 600, 10 to 500, 10 to 400, 10 to 300, 10 to 200, 10 to 100, 10 to 90, 10 to 80, 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 35, 10 to 30, 10 to 25, 10 to 20, 10 to 15, or 20 to 30 nucleotides or 10, 15, 20 or 25 nucleotides.
- a synthetic nucleic acid, polynucleotide, or oligonucleotide having a length within one of the above ranges may have any specific length within the range recited, endpoints inclusive.
- a hybridization probe or primer is 85 to 100%, 90 to 100%, 91 to 100%, 92 to 100%, 93 to 100%, 94 to 100%, 95 to 100%, 96 to 100%, 97 to 100%, 98 to 100%, 99 to 100%, or 100% complementary to a nucleic acid with the same length as the probe or primer and having a sequence chosen from a length of nucleotides corresponding to the probe or primer length within a portion of a sequence as set forth in any one of the nucleic acids listed herein.
- a hybridization probe or primer hybridizes along its length to a corresponding length of a nucleic acid having the sequence as set forth in any one of the nucleic acids listed herein.
- the hybridization conditions are low stringency. In an embodiment, the hybridization conditions are moderate stringency. In an embodiment, the hybridization conditions are high stringency.
- a transgenic plant comprising a synthetic nucleic acid encoding any one or more of the glucanases described herein.
- the one or more glucanases expressed in the transgenic plant herein may have activity at a pH ranging from 2.0 to 10.00.
- the pH may be 2.0, 3.0, 4.0, 5.0, 5.5, 6.0, 7.0, 7.5, 8.0, 9.0, 9.5, or 10, or a pH within a range between any two of the foregoing pH values (endpoints inclusive).
- the one or more glucanases expressed in a transgenic plant herein may have activity when exposed to a temperature in the range of 25° C. to 130° C., endpoints inclusive.
- the temperature may be 25° C., 30° C., 35° C., 40° C., 45° C., 50° C., 55° C., 65° C., 70° C., 75° C., 80° C., 85° C., 90° C., 95° C., 100° C., 105° C., 110° C., 115° C., 120° C., 125° C., 130° C., 25° C., to 30° C., 25° C. to 35° C., 25° C. to 40° C., 25° C. to 45° C., 25° C. to 50° C., 25° C. to 55° C., 25° C. to 60° C., 25° C.
- the glucanase expressed in the transgenic plant may have the improved activity compared to the glucanase having an identical amino acid sequence but expressed in a bacterial cell.
- the glucanase may have improved thermal stability compared to the activity of the glucanase expressed in the bacterial cell.
- the one or more glucanase may be produced in any transgenic plant.
- the transgenic plant may be but is not limited to wheat, maize, soybean, barley, and sorghum.
- a method of making a transgenic plant that includes a glucanase may include contacting a plant cell with any one of the synthetic nucleic acids herein.
- the synthetic nucleic acids may be part of any one of the vectors described herein.
- the vector may include a synthetic nucleic acid encoding a glucanase.
- the glucanase may comprise, consist essentially of, or consist of an amino acid sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414] and SEQ ID NO: 6 [AGR2514].
- the method may also include regenerating a transgenic plant from the transgenic plant cell.
- the method may include selecting the transgenic plant expressing a glucanase.
- the transgenic plant herein is also referred to as an “event.”
- An event is characterized by presence of the transgene comprising a synthetic nucleic acid encoding a glucanase.
- the term “event” also refers to the genomic region of the transformed parent comprising the inserted synthetic nucleic acid sequence and the parent genomic sequences flanking the insertion.
- the term “event” also refers to progeny produced by crossing of the transgenic plant and a non-transgenic plant of the same genetic background.
- the term “line” also refers to progeny produced by crossing of the transgenic plant and a non-transgenic plant with any genetic background. After repeated crosses, the transgene and the flanking sequences of the originally transformed parent may be present in a progeny plant in the same location in the genome or on the same chromosome as in the transformed parent.
- the transgenic plant may be homozygous for the transgene comprising a synthetic nucleic acid encoding a glucanase.
- the transgenic plant may be hemizygous for the transgene comprising a synthetic nucleic acid encoding a glucanase.
- a hemizygous transgenic plant may be self-crossed. Progeny may be obtained from such crosses.
- the progeny may include homozygous, hemizygous and wild type plants.
- a hemizygous plant may be phenotypically indistinguishable from the wild type plants.
- the method may include analyzing the progeny for the presence of the transgene and selecting a progeny plant that includes the transgene. A method of identifying the homozygous event by PCR is described herein in Example 8.
- the method may further include crossing a hemizygous transgenic plant to another transgenic plant hemizygous for the same transgene.
- the method may include selecting a first progeny plant that is homozygous for the transgene.
- the method may further include crossing the transgenic plant to a wild type plant of the same, or different, genetic background. Progeny may be obtained from such crosses.
- the progeny may include hemizygous and wild type plants.
- the method may include selecting a first progeny plant that is hemizygous for the transgene.
- the method may further include selfing the first hemizygous progeny plant and selecting a second progeny plant that is homozygous for the transgene comprising a synthetic nucleic acid sequence encoding a glucanase.
- the glucanase may have activity and improved thermal stability when exposed to high temperatures as here described.
- the method of making a transgenic plant includes transformation.
- the nucleic acid may be introduced into a vector.
- Suitable vectors may be cloning vectors, transformation vectors, expression vectors, or virus-based vectors.
- the expression cassette portion of a vector may further include a regulatory element operably linked to a nucleic acid encoding a glucanase.
- operably linked means that the regulatory element imparts its function on the nucleic acid.
- a regulatory element may be a promoter, and the operably linked promoter would control expression of the nucleic acid.
- the expression of a nucleic acid encoding a glucanase from the expression cassette may be under the control of a promoter which provides for transcription of the nucleic acid in a plant.
- the promoter may be a constitutive promoter or, tissue specific, or an inducible promoter.
- a constitutive promoter may provide transcription of the nucleic acid throughout most cells and tissues of the plant and during many stages of development but not necessarily all stages.
- An inducible promoter may initiate transcription of the nucleic acid sequence only when exposed to a particular chemical or environmental stimulus.
- a tissue specific promoter may be capable of initiating transcription in a particular plant tissue.
- Plant tissue may be, but is not limited to, a stem, leaves, trichomes, anthers, cob, seed, endosperm, or embryo.
- the constitutive promoter may be, but is not limited to the maize ubiquitin promoter (ZmUbil), Cauliflower Mosaic Virus (CAMV) 35S promoter, the Cestrum Yellow Leaf Curling Virus promoter (CMP), the actin promoter, or the Rubisco small subunit promoter.
- the tissue specific promoter may be the maize globulin promoter (ZmGlb1), the rice glutelin promoter (prGTL), the maize zein promoter (ZmZ27), or the maize oleosin promoter (ZmOle).
- the promoter may provide transcription of a synthetic polynucleotide having a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of SEQ ID NO: 7 [pAG4258], SEQ ID NO: 8 [pAG4588], SEQ ID NO: 9 [pAG4597], SEQ ID NO: 10 [pAG4708], SEQ ID NO: 11 [pAG4766], SEQ ID NO: 12 [pAG4767], SEQ ID NO: 13 [pAG4770], SEQ ID NO: 14 [pAG4771], SEQ ID NO: 15 [pAG4257], SEQ ID NO: 16 [pAG4692], SEQ ID NO: 17 [pAG4693], SEQ ID NO: 18 [pAG4705] and SEQ ID NO: 19 [pAG4706] and expression of glucanase that is capable of degrading a polysacc
- the transformation in the method of making a transgenic plant may be stable transformation, wherein the nucleic acid encoding the glucanase integrates into the genome of the transformed plant.
- the transformation may be Agrobacterium -mediated transformation using a vector suitable for stable transformation described herein.
- the method of making a transgenic plant may include any other methods for transforming plants, for example, particle bombardment, or protoplast transformation via direct DNA uptake.
- the transgenic plant may include any synthetic nucleic acid, amino acid sequence, or vector herein.
- the method of making a transgenic plant may include transient transformation to transiently express the recombinant protein.
- transient expression refers to the expression of an exogenous nucleic acid molecule delivered into a cell: e.g., a plant cell, and not integrated in the plant's cell chromosome. Expression from extra-chromosomal exogenous nucleic acid molecules can be detected after a period of time following a DNA-delivery.
- Virus-based vectors may be used to carry and express exogenous nucleic acid molecules. Virus-based vectors may replicate and spread systemically within the plant. Use of virus based vectors may lead to very high levels of glucanase accumulation in transgenic plants.
- Methods of making a transgenic plant methods of increasing utilization of non-starch polysaccharides in an animal, methods for enhancing production of fermentable sugars from grains, methods for increasing metabolizable energy of a diet, methods preparing and animal feedstock and methods for producing genetically engineered plants homozygous for a synthetic nucleic acid that encodes a glucanase may comprise a method of detection herein as part of making transgenic plants and/or identifying plants, plant biomass or animal feed that comprise a synthetic nucleic acid herein.
- An embodiment comprises a kit for identifying maize event 4588.259, 4588.757 or 4588.652 in a sample.
- the kit may comprise a first primer and a second primer.
- the first primer and the second primer may be capable of amplifying a target sequence specific to an event.
- the target sequence may include a nucleic acid with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from SEQ ID NOS: 51-55.
- the target sequence may be a sequence included in a junction between a genomic sequence of a transformed plant and a sequence of the T-DNA insertion.
- the target sequence may be included in a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from SEQ ID NOS: 22-31.
- the kit may comprise the first primer comprising a nucleic acid sequence selected from SEQ ID NOS: a nucleic acid sequence selected from SEQ ID NOS: 38, 41, and 47.
- the kit may comprise the second primer comprising a nucleic acid sequence selected from SEQ ID NOS: 39, 42, 43, 45, and 46.
- the kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 38 and the second primer comprising the nucleic sequence of SEQ ID NO: 39.
- the kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 41 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 42.
- the kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 41 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 43.
- the kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 47 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 45.
- the kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 47 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 46.
- the first primer and the second primer may be capable of amplifying the target sequence to produce an amplified product.
- the amplified product or the target sequence may be capable of hybridizing to the sequence of the nucleic acid comprising a sequence of SEQ ID NO: 40, or SEQ ID NO: 44 under conditions of high stringency.
- the target sequence may be used as a probe for diagnosing any one of the events described herein.
- a sample may include any sample in which nucleic acids from plant matter are present.
- a sample may be a protein sample.
- a protein sample may include any sample in which proteins from plant matter are present.
- the sample or protein sample may include any plant matter.
- the plant matter may derive from a plant or part thereof.
- the plant material may derive from an animal feed or food.
- a method of identifying maize event 4588.259, 4588.757 or 4588.652 in a sample may include contacting a sample with a first primer and a second primer.
- the method may include amplifying a synthetic polynucleotide comprising a target sequence specific to the maize event.
- the target sequence may be any target sequence described herein.
- the first primer and the second primer may be capable of amplifying the target sequence to produce an amplified product.
- the amplified product may be used to determine whether a plant resulted from a sexual crossing or selfing contains one or more of the target sequences and diagnose specific events.
- the length of the amplified product from the sample of the maize event may differ from the length of the amplified product from the sample of wild type plant of the same genetic background.
- the amplified product from the event sample may be further used as probe that hybridizes to a synthetic polynucleotide comprising a specific region encoding a glucanase under conditions of high stringency.
- the method may include further detecting hybridization of the at least one probe to the specific region of the target sequence.
- an animal feedstock comprising any one or more of the transgenic plants described herein or parts of the transgenic plants.
- the term “animal feedstock” refers to any food, feed, feed composition, diet, preparation, additive, supplement, or mixture suitable and intended for intake by animals for their nourishment, maintenance, or growth.
- the glucanases included in the transgenic plants and in the animal feedstock may be active in the gastrointestinal or rumen environment of animals.
- the animal may be a monogastric animal.
- the animal may be a ruminant animal.
- the monogastric animal may be but is not limited to a chicken, a turkey, a duck, a swine, a fish, a cat, or a dog.
- the ruminant animal may be but is not limited to cattle, a cow, a steer, a sheep, or a goat.
- the glucanases may be active after preparation of the animal feed.
- the temperatures which feeds are exposed to during ensiling may be within range of 20° C. to 70° C.
- the temperatures which feeds are exposed to during pelleting may be within range of 70° C. to 130° C.
- the glucanases may have improved thermal stability and may retain activity after being exposed to high temperatures during feed pelleting.
- the glucanase with improved thermal stability may comprise, consist essentially of, or consist of an amino acid sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414] and SEQ ID NO: 6 [AGR2514].
- a glucanase may be isolated from the transgenic plant prior to being included into the animal feedstock.
- the glucanase may be any one of the glucanases described herein.
- the animal feedstock may further include a feed supplement.
- the feed supplement may be any plant material.
- the plant material may be a non-transgenic plant or a part thereof.
- the plant material may include an engineered plant or a mutant plant.
- the feed supplement may be a mineral.
- the mineral may be a trace mineral.
- the mineral may be a macro mineral.
- the feed supplement may be at least one vitamin.
- the at least one vitamin may be a fat-soluble vitamin.
- the feed supplement may include one or more exogenous enzymes.
- the one or more exogenous enzymes may include a hydrolytic enzyme.
- the hydrolytic enzyme may be an enzyme classified under EC3.4 as hydrolase.
- the hydrolytic enzymes may be but are not limited to xylanases, mannanases, carbohydrases, proteases, peptidases, phytases, cellulases, lipases, phospholipases, pectinases, galactosidases, laccases, amylases, hemicellulases, or cellobiohydrolases.
- the hydrolytic enzymes may be expressed in the engineered plants or parts thereof included in the feed supplement.
- the feed supplement may include purified hydrolytic enzymes.
- the feed supplements may be but are not limited to growth improving additives, coloring agents, flavorings, stabilizers, limestone, stearine, starch, saccharides, fatty acids, or a gum.
- the coloring agents may be carotenoids.
- the carotenoids may be but are not limited to cantaxanthin, beta-carotene, astaxanthin, or lutein.
- the fatty acids may be polyunsaturated fatty acids.
- the polyunsaturated fatty acids may include but are not limited to arachidonic acid, docosohexaenoic acid (DHA), eicosapentaenoic acid (EPA) or gamma-linoleic acid.
- the feed supplement may be a non-transgenic plant or a part thereof.
- the non-transgenic plant or part thereof may include at least one component selected from the group consisting of: barley, wheat, rye, oat, corn, rice, triticale beet, sugar beet, spinach, cabbage, quinoa , corn meal, corn pellets, corn oil, distillers grains, forage, wheat meal, wheat pellets, wheat grain, barley grain, barley pellets, soybean meal, soybean oilcake, lupin meal, rapeseed meal, sorghum grain, sorghum pellets, rapeseed, sunflower seed, and cotton seed.
- barley wheat, rye, oat, corn, rice, triticale beet, sugar beet, spinach, cabbage, quinoa , corn meal, corn pellets, corn oil, distillers grains, forage, wheat meal, wheat pellets, wheat grain, barley grain, barley pellets, soybean meal, soybean oilcake, lupin meal, rapeseed meal, sorghum grain, sorghum pellets, rape
- the feed supplement may include at least one component selected from the group consisting of: soluble solids, fat, vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, monensin sodium COBAN® PREMIX, vitamin premix, inorganic feed phosphates, monocalcium phosphate, dicalcium phosphate, tricalcium phosphate, monodicalcium phosphate, rock phosphate, selenium premix, choline chloride, sodium chloride, and mineral premix.
- the feed supplement may include fish meal, fish oil, bone meal, feather meal and animal fat.
- the feed supplement may include yeast or yeast extract.
- a method of producing an animal feedstock may comprise including a transgenic plant that includes any one or more glucanase described herein in the animal feedstock.
- the animal feedstock may comprise, consist essentially of or consist of the transgenic plant.
- the method may further include combining the transgenic plant with a feed supplement.
- the feed supplement may be a non-transgenic plant or a part thereof.
- the transgenic plant may be produced by any one of the methods described herein.
- the feed supplement may be a mineral.
- the supplement may include one or more exogenous enzymes.
- exogenous enzymes may be but are not limited to xylanases, mannanases, carbohydrases, proteases, peptidases, phytases, cellulases, lipases, phospholipases, pectinases, galactosidases, laccases, amylases, hemicellulases, or cellobiohydrolases.
- a method of meat production may include feeding an animal feedstock or one produced by any of the methods described herein to the animal.
- the method may include preparing an animal feedstock that includes a transgenic plant expressing a glucanase.
- a method of feeding an animal may include feeding an animal feedstock or one produced by any of the methods described herein to the animal.
- the method may include preparing an animal feedstock that includes a transgenic plant expressing a glucanase.
- a method of increasing utilization of non-starch polysaccharides in an animal may include feeding an animal with an animal feedstock that includes any one or more of the transgenic plants described herein.
- the method may include preparing the animal feedstock.
- a method of decreasing gastrointestinal viscosity in an animal may include feeding an animal with an animal feedstock that includes any one or more of the transgenic plants described herein.
- the method may include preparing the animal feedstock.
- Addition of exogenous enzymes collectively known as carbohydrases may ameliorate the effects of non-starch polysaccharides (NSPs) in the diet of an animal.
- An animal feedstock that includes any one or more of glucanases described herein may increase utilization of NSPs by the animal that ingested the feedstock, or may decrease the anti-nutritional effects of the NSP on the animal that ingested the feedstock, and improve growth of the animal.
- Preparing the animal feedstock may include combining one or more transgenic plant herein with any other feed supplement.
- the glucanase may be isolated, purified and added to the animal feedstock as a pure glucanase.
- the glucanase may be added to the animal feedstock in admixture with other feed supplements.
- the transgenic plant including the glucanase or the purified glucanase may be combined with other feed supplements to form premixes.
- An animal feedstock may be produced as mash feed.
- the animal feedstock may be produced as pellets.
- the milled feed stuffs may be mixed with the premix that includes any one of the transgenic plants that include a glucanase.
- the milled feed stuffs may include the plant material and the feed supplements described herein.
- the feed supplements may include one or more exogenous enzymes described herein. Enzymes may be added as liquid or solid formulations.
- a solid or liquid enzyme formulation may be added before or during the mixing step.
- the enzyme preparation may be added before or after the pelleting step.
- the glucanase may be included in a premix.
- the premix may also include vitamins and trace minerals. Macro minerals may be added separately to animal feedstock.
- Metabolizable energy refers to the net energy of a diet or feed that is available to an animal after the utilization of some energy in the processes of digestion and absorption and the loss of some of the material as being undigested or indigestible.
- Metabolizable energy may be apparent metabolizable energy (AME) measured as the difference between the calories of the feed consumed by an animal and excrements collected after feed consumption.
- Metabolizable energy may be true metabolizable energy (TME), which is similar to AME except that it also takes into account endogenous energy.
- Energy contents in a diet or feed ingredients may be determined using one of several methodologies (NRC. 1994. Nutrient Requirements of Poultry.
- Gross energy is direct measurement using an adiabatic bomb calorimeter, which measures the heat of combustion of a sample within a high oxygen atmosphere.
- Apparent digestible energy is GE of a feed or feedstuff minus GE of feces only.
- Apparent metabolizable energy is GE of a feed or feedstuff minus GE of feces, urine, and gaseous products from digestion.
- TME true metabolizable energy
- NE net energy
- the TME rooster assay may be used to account for endogenous (non-feed) losses of GE by including a fasted rooster and collecting excreta to correct the GE from the fed (feed/feedstuff) rooster. See Sibbald, 1976, Poultry Science 55: 303-308, which is incorporated herein by reference as if fully set forth.
- This assay has commonly been used for determining TME of individual feedstuffs rather than complete feed, and requires cecetomized roosters (ceca surgically removed) to always be on hand.
- the assay involves force-feeding (into the crop) a known quantity of an ingredient (in birds that were previously fasted 24-48 hr) and then collect feces for a 24-48 hour period.
- the roosters (or turkeys) used in TME assays are adult birds with a fully developed digestive tract. Research has shown that there are differences in ME determinations using roosters (layer breeds), turkeys and broilers when analyzing same feed ingredients (Cozannet et al, 2010 J. Anim, Sci., 88(7):2382-2392, which is incorporated herein by reference as if fully set forth). So determining TME or AME using rooster model may not be equivalent to what is observed in a young broiler, but is a commonly used proxy in research and industry.
- the AME assay may be used for determining complete feed and some energy supplying feedstuffs, as well as the effect from adding feed ingredients that aid in digestion.
- the marker method of AME determination may be used, in which no weighing of feed consumption or total fecal collection and no need to separate feed spilled from feces pan are required. With the marker method, birds are fed the marker for at least two days (but preferably five or more days). Feces are collected over several days (e.g., three days) with daily collection composited into one sample.
- Equation 1 AME using the total collection method (Equation 1) is calculated as follows:
- GE Gross Energy
- FI bomb calorimetry
- EO excreta output
- e refers to excreta content
- f refers to the feed content.
- Ileal digestible energy Another method that may be used to determine AME of feed when investigating feed additives that aid in digestion is Ileal digestible energy (IDE).
- IDE Ileal digestible energy
- This method uses the AME marker method (described above), but the birds are euthanized and a section of ileum excised and contents removed, dried and analyzed for GE and the marker.
- the IDE method may be used effectively for testing and comparing feed additives used to improve digestion/absorption of feed energy.
- the benefit of IDE is no cages with collection pans are required and can collect during a floor-pen study.
- With the marker method birds are fed the marker for at least two days (and preferably five or more days).
- AME and TME may be corrected for nitrogen retention (AMEn and TMEn).
- grams of N are multiplied by 8.22 kcal/g (GE of uric acid; primary excretory product of protein tissue oxidized for energy), which also is subtracted off of the GE consumed. See Hill, F. W., and D. L. Anderson, 1958, “Comparison of metabolizable energy and productive energy determinations with growing chicks.” J. Nutr. 64:587-603, which is incorporated herein by reference as if fully set forth. Calculations for total collection of marker method for AMEn are shown in Equation 3 and Equation 4 below, respectively. Equation 3: AMEn, total collection:
- AME n ⁇ ( GE f ⁇ FI ) ⁇ ( GE e ⁇ EO ) ⁇ [8.22 ⁇ ( N f ⁇ N e )] ⁇ / FI,
- the TME method may be used for determining ME of individual ingredients
- the AME (IDE) method may be used with broilers to measure ME in individual ingredients or total diet and testing effects improving ME by use of enzymes or other feed additives.
- a diet or feed may include any feed ingredient or mixture of ingredients including water.
- the diet may be any food, feed, feed composition, diet, preparation, additive, supplement, or mixture included in an animal feedstock described herein.
- the diets are known in the art and described at least in the following publications: Nutrient Requirements of Poultry, 1994, National Research Council, National Academy Press, Washington, D.C.; Broiler Performance and Nutrition Supplement, Cobb-500TM, L-2114-07EN, July, 2015; Broiler Performance and Nutrition Supplement, Cobb-700TM, L-21124-13EN, Dec.
- the diet may be a diet for broilers.
- the diet for broilers may be composed of one or more of the following ingredients: 51.49% (w/w)-61.86% (w/w) corn, 25.45% (w/w)-35.03% (w/w) soybean meal, 5.00% (w/w) corn distillers dry grains plus soluble solids, 2.00% (w/w) vermiculite, 0.30% (w/w)-1.99% (w/w) dicalcium phosphate, 1.00% (w/w) poultry fat, 0.81% (w/w)-4.01% (w/w) limestone, 0.24% (w/w)-0.50% (w/w) salt (NaCl), 0.13% (w/w)-0.45% (w/w) DL-methionine, 0.20% (w/w) choline chloride 60, 0.20% (w/w) mineral premix, 0.05% (w/w) vitamin premix, 0.13% (w/w)-0.23% (w/w)
- Digestible lysine in the diet may be 1.00% (w/w) to 1.20% (w/w).
- Digestible methionine in the diet may be 0.47% (w/w) to 0.54% (w/w).
- Digestible methionine and cysteine in the diet may be 0.98% (w/w) to 1.10% (w/w).
- Digestible threonine in the diet may be 0.68% (w/w) to 0.84% (w/w).
- Digestible tryptophan in the diet may be 0.17% (w/w) to 0.22% (w/w).
- Calcium in the diet may be 0.71% (w/w) to 0.96% (w/w).
- Available phosphorus in the diet may be 0.17% (w/w) to 0.46% (w/w).
- Sodium in the diet may be 0.17% (w/w) to 0.19% (w/w).
- the concentration of each ingredient within any one of the ranges herein may be any value between any two of the concentration points included in the range.
- the diet may be the diet for broilers composed of one or more of the following ingredients: 30.00% (w/w)-75.00% (w/w) corn, 5.00% (w/w)-75.00% (w/w) wheat; 5.00% (w/w)-65.00% (w/w) barley; 5.00% (w/w)-30.00% (w/w) sorghum, 5.00% (w/w)-50.00% (w/w) millet, 10.00% (w/w)-45.00% (w/w) soybean meal, 5.00% (w/w)-20.00% (w/w) Canola (Rapeseed) meal, 2.00% (w/w)-15.00% (w/w) corn gluten meal, 5.00% (w/w)-15.00% (w/w) sunflower meal, 5.00% (w/w)-30.00% (w/w) corn distillers dry grains plus soluble solids, 1.00% (w/w)-8.00% (w/w) poultry/porcine/b
- Metabolizable energy of the diet may be 1225 (kcal/lb)-1491 (kcal/lb).
- Crude protein (CP) in the diet may be 15% (w/w) to 25% (w/w).
- Digestible lysine in the diet may be 0.85% (w/w) to 1.30% (w/w).
- Digestible methionine in the diet may be 0.45% (w/w) to 0.70% (w/w).
- Digestible methionine and cystine in the diet may be 0.65% (w/w) to 1.10% (w/w).
- Digestible threonine in the diet may be 0.60% (w/w) to 0.84% (w/w).
- Digestible tryptophan in the diet may be 0.10% (w/w) to 0.25% (w/w).
- Calcium in the diet may be 0.68% (w/w) to 1.10% (w/w).
- Available phosphorus in the diet may be 0.17% (w/w) to 0.50% (w/w).
- Sodium in the diet may be 0.17% (w/w) to 0.19% (w/w).
- Phytase in the diet may be 500 FTU/kg (w/w) to 8,000 FTU/kg (w/w).
- the concentration of each ingredient within any one of the ranges herein may be any value between any two of the concentration points included in the range. Variations in the concentrations of these ingredients may also be used in a diet.
- the method may include mixing a transgenic plant or part thereof with a feed ingredient to obtain a mixture.
- the feed ingredient may be one or more ingredients included in the diet described herein.
- the transgenic plant or part thereof may be any transgenic plant or part thereof described herein.
- the method may include feeding an animal with the mixture.
- the body weight gain (BWG) in an animal fed with the mixture comprising a glucanase may be higher than the BWG in a control animal fed with identical feed ingredients not mixed with a transgenic plant including a glucanase.
- the BWG in an animal fed with the mixture comprising a glucanase may be similar to the BWG in a control animal fed with a high energy diet or a diet that includes more or higher concentrations of the ingredients compared to the mixture including a glucanase.
- the feed conversion ratio (FCR) in an animal fed with the mixture comprising a glucanase may be lower than the FCR in a control animal fed with identical feed ingredients not mixed with a transgenic plant including a glucanase.
- the FCR is defined as the mass of the feed eaten by the animal divided by the animal's mass.
- the FCR in an animal fed with the mixture comprising a glucanase may be similar to the FCR in a control animal fed with a high energy diet or a diet that includes more or higher concentrations of the ingredients compared to the mixture including a glucanase.
- a method of enhancing thermal stability of a glucanase may include producing a transgenic plant that includes a synthetic nucleic acid encoding the glucanase.
- the synthetic nucleic acid may include any one the sequences described herein.
- the glucanase may be thermally stable upon exposure to temperatures in the range of 70° C. to 130° C., endpoints inclusive.
- the glucanase may be thermally stable upon exposure to temperatures in the range of 25° C. to 130° C., endpoints inclusive.
- the glucanase may be thermally stable upon exposure to temperatures in the range from 25° C., 30° C., 35° C., 40° C., 45° C., 50° C., 55° C., 65° C., 70° C., 75° C., 80° C., 85° C., 90° C., 95° C., 100° C., 105° C., 110° C., 115° C., 120° C., 125° C., 130° C., 25° C., to 30° C., 25° C. to 35° C., 25° C.
- the glucanase may be thermally stable upon exposure to temperatures in the range of 70° C. to 130° C., endpoints inclusive.
- the glucanase may be thermally stable upon exposure to temperatures in the range from 70° C. to 75° C., 70° C. to 80° C., 70° C. to 85° C., 70° C. to 90° C., 70° C. to 95° C., 70° C. to 100° C., 70° C. to 105° C., 70° C. to 110° C., 70° C. to 115° C., 70° C. to 120° C., or 70° C. to 130° C., endpoints inclusive.
- the above mentioned synthetic nucleic acids may be provided in embodiments herein alone, as part of another nucleic acid, as part of a vector or as stated above as part of a transgenic plant.
- the transgenic plant may be derived from one of corn, rye, switchgrass, miscanthus , sugarcane or sorghum.
- the transgenic plant may be made by Agrobacterium mediated transformation using a vector having a nucleic sequence as set forth above.
- a method for enhancing production of fermentable sugars from grains may include mixing grains derived from any one of the transgenic plants described herein with grains from a different plant to form mixed grains.
- the different plant may be a non-transgenic plant.
- the different plant may be an engineered plant that includes a synthetic nucleic acid encoding at least one hydrolytic enzyme.
- the hydrolytic enzyme may be but is not limited to xylanase, an amylase, an endoglucanase, an exoglucanase, a feruloyl esterase, a glucoamylase, an intein-modified amylase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, a protease, an intein-modified protease, a phytase, or an intein-modified phytase.
- the method may include processing the mixed grains.
- the processing may include one or more operations selected from the group consisting of harvesting, baling, grinding, milling, chopping, size reduction, crushing, pellitizing, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, ensiling, mixing with silage or other biomass and ensiling, fermentation, chemical conversion, and chemical catalysis.
- the biomass may be but is not limited to hay, straw, stover, silage, compressed and pelleted feeds, soybeans, sprouted grains, legumes, feed grains, maize, rice, barley or wheat grains.
- the biomass may be any biomass derived from agricultural waste.
- the method may include converting fermentable sugars into a biochemical product.
- the biochemical product may be but is not limited to ethanol, butanol, lactic acid, citric acid, and acetic acid.
- a method for reducing the viscosity of a grain mixture may include mixing grains derived from any one of the transgenic plants described herein with grains from a different plant to form mixed grains. Water may be added to the mixed grains to form the grain mixture.
- the viscosity of the grain mixture may be lower when it includes any one of the glucanases described herein.
- the viscosity may be intestinal viscosity, which is typically measured from an intestinal sample removed from a bird or pig after euthanization. In this method, the digesta sample is centrifuged and the viscosity of supernatant is analyzed using a viscometer.
- ileal digesta was centrifuged for 10 min at 3,500 ⁇ gravity and 0.5 ml of supernatant was put in a Brookfield Cone and Plate Viscometer 1 with a CPE-40 spindle.
- ⁇ -Mannanase ameliorates viscosity-associated depression of growth in broiler chickens fed guar germ and hull fractions. Poult. Sci. 82:1925-1931, which is incorporated herein by reference as if fully set forth. Samples are analyzed for 30 sec at 40° C. and 5 rpm, to determine centipoise (cP units) readings. The higher the cP, the higher the viscosity of the sample.
- the different plant may be a non-transgenic plant.
- the different plant may be an engineered plant that includes a synthetic nucleic acid encoding at least one hydrolytic enzyme.
- the hydrolytic enzyme may be but is not limited to xylanase, an amylase, an endoglucanase, an exoglucanase, a feruloyl esterase, a glucoamylase, an intein-modified amylase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, a protease, an intein-modified protease, a phytase, or an intein-modified phytase.
- the method may include processing the grain mixture.
- the processing may include one or more operations selected from the group consisting of harvesting, grinding, milling, size reduction, crushing, heating, gelotinzing, liquefaction, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, saccharifying, fermentation, chemical conversion, and chemical catalysis.
- a method for enhancing ethanol production from grains includes performing any one of the methods for enhancing production of fermentable sugars described herein.
- a transgenic plant comprising a synthetic nucleic acid encoding a glucanase, wherein the glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- the transgenic plant of any one or more of the preceding embodiments wherein the glucanase is active upon expression in the plant and exposure to a temperature in the range from 25° C. to 130° C. 5.
- the transgenic plant of any one or more of the preceding embodiments, wherein the glucanase activity has improved stability upon expression in the plant compared to the activity of a glucanase having an identical amino acid sequence and expressed in a bacterial cell.
- a plant is selected from the group consisting of: wheat, maize, barley, rice, and sorghum. 7.
- a transgenic plant comprising a synthetic nucleic acid including a sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3, wherein the glucanase is capable of degrading one or more polysaccharides.
- the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
- the transgenic plant of any one or more of embodiments 7-12 which comprises the nucleic acid sequence of SEQ ID NO: 1 and produces an amplicon for diagnosing event 4588.259, 4588.757, or 4588.652.
- a synthetic nucleic acid comprising a sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3, wherein the glucanase is capable of degrading one or more polysaccharides.
- the synthetic nucleic acid of embodiment 14, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan. 16.
- a synthetic polynucleotide comprising a sequence with at least 70% identity to a reference sequence selected from the group consisting of SEQ ID NO: 7-19, wherein the synthetic polynucleotide comprises a synthetic nucleic acid encoding a glucanase that is capable of degrading one or more polysaccharides.
- a vector comprising a synthetic polynucleotide, or a fragment of a synthetic polynucleotide, of embodiment 17. 19.
- a method of making a transgenic plant that includes a glucanase comprising:
- a plant cell contacting a plant cell with a synthetic nucleic acid encoding an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3, wherein the glucanase is capable of degrading one or more polysaccharides;
- transgenic plant expressing a glucanase, wherein the glucanase is active and thermally stable upon exposure to a temperature in the range from 25° C. to 130° C.
- the animal feedstock of any one or both of embodiments 22-23, wherein the feed supplement is plant material.
- the animal feedstock of any one or more of embodiments 22-24, wherein the plant material is a non-transgenic plant.
- the animal feedstock of any one or more of embodiments 22-24 wherein the plant material is an engineered plant.
- the animal feedstock of any one or more of embodiments 22-26, wherein the feed supplement includes one or more exogenous enzymes.
- the one or more exogenous enzyme includes a hydrolytic enzyme selected from the group consisting of: xylanase, endoglucanase, cellulase, exoglucanase, feruloyl esterase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified cellulase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, mannanase, amylase, an intein-modified amylase, phytase, an intein-modified phytase, protease, and an intein-modified protease.
- a hydrolytic enzyme selected from the group consisting of: xylanase, endoglucanase, cellulase, exoglucanase, feruloyl esterase, an intein
- the animal feedstock of any one or more of embodiments 23-29 wherein the feed supplement includes at least one component selected from the group consisting of: soluble solids, fat and vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, COBAN®, vitamin premix, dicalcium phosphate, selenium premix, choline chloride, sodium chloride, and mineral premix.
- a method of producing an animal feedstock comprising mixing 1) a transgenic plant or part thereof of any one or more of embodiments 1-13, 2) the product of any one or more of embodiments 19-41, or 3) a synthetic polypeptide of any one or more of embodiments 51-54 with plant material.
- the method of embodiment 31 further comprising pelletizing the mixture.
- the method of embodiment 32 further comprising adding a feed supplement to the mixture.
- the feed supplement includes at least one exogenous enzyme.
- the at least one exogenous enzyme includes a hydrolytic enzyme selected from the group consisting of xylanase, endoglucanase, cellulase, exoglucanase, feruloyl esterase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified cellulase, an intein-modified feruloyl esterase, amylase, an intein-modified amylase, mannanase, phytase, and protease.
- a method of increasing utilization of non-starch polysaccharides in an animal comprising feeding an animal with an animal feedstock 1) including a transgenic plant of any one or more of embodiments 1-13, 2) of any or more of embodiments 22-30, 3) produced by the method of any one or more of embodiments 31-35, or 4) including a synthetic polypeptide of any one or more of embodiments 51-54.
- the method of embodiment 36 further comprising preparing the animal feedstock.
- a method of enhancing thermal stability of a glucanase comprising producing a transgenic plant that includes a synthetic nucleic acid comprising, consisting essentially of, or consisting of an amino acid a sequence having 70% identity to a reference sequence of selected fromthe group consisting of: SEQ ID NOS: 4-6, wherein the sequence encodes a glucanase capable of degrading one or more polysaccharides.
- the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
- 41. The method of any or both of embodiments 39-40, wherein expression of the nucleic acid produces the glucanase and the glucanse is thermally stable upon exposure to a temperature in the range of 25° C. to 130° C.
- a method for enhancing production of fermentable sugars from grains comprising:
- the different plant is an engineered plant that includes a synthetic nucleic acid encoding at least one hydrolytic enzyme.
- the at least one hydrolytic enzyme is selected from the group consisting of: xylanase, an endoglucanase, an exoglucanase, cellulase, a feruloyl esterase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified cellulase, an intein-modified feruloyl esterase, amylase, phytase and protease.
- the method of embodiment 49 wherein the plant material includes fiber, grain, or a combination thereof.
- 51. A synthetic polypeptide that includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and capable of degrading one or more polysaccharides.
- 52. The synthetic polypeptide of embodiment 51, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan. 53.
- a synthetic polypeptide that includes an amino acid sequence comprising a contiguous amino acid sequence having at least 90% identity to 50 to 100, 50 to 150, 50 to 200, 50 to 250, 50 to 300, 50 to 322, or 50 to all contiguous amino acid residues of a glucanase having the sequence of any of SEQ ID NOS: 4-6, wherein the glucanase is capable of degrading one or more polysaccharides.
- the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan. 55.
- a method of increasing metabolizable energy of a diet comprising mixing a transgenic plant or part thereof with a feed ingredient, wherein the transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase comprising an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of SEQ ID NOS: 4-6, and and capable of degrading one or more polysaccharides.
- any one or both of embodiments 55-56, wherein the synthetic nucleic acid comprises a sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3. 58.
- the feed ingredient includes at least one component selected from the group consisting of: corn meal, corn pellets, wheat meal, wheat pellets, wheat grain, wheat middlings, barley grain, barley pellets, soybean meal, soy hulls, dried distillers grain, soybean oilcake, sorghum grain and sorghum pellets. 61.
- the feed ingredient includes at least one component selected from the group consisting of: soluble solids, fat and vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, COBAN®, vitamin premix, dicalcium phosphate, selenium premix, choline chloride, sodium chloride, mineral premix, and one or more exogenous enzymes.
- a method for producing an animal feedstock comprising mixing a transgenic plant or part thereof of any one or more of embodiments 1-13 with plant material. The method may also comprise the method for producing a plant that includes a glucanase of any one or more of embodiments 63-68.
- a method for producing a plant that includes a glucanase comprising crossing a plant with a transgenic plant comprising event 4588.259, 4588.757 or 4588.652, and selecting a first progeny plant comprising event 4588.259, 4588.757 or 4588.652 and capable of degrading one or more polysaccharides.
- any one or more of embodiments 63-64 further comprising selfing the first progeny plant and selecting a second progeny plant comprising event 4588.259, 4588.757 or 4588.652 and capable of degrading one or more polysaccharides.
- 66. The method of embodiment 65, wherein the second progeny plant is homozygous for event 4588.259, 4588.757 or 4588.652.
- 67 The method of embodiment 65, wherein the second progeny plant is heterozygous for event 4588.259, 4588.757 or 4588.652. 68.
- the method of embodiment 67 further comprising selfing the second progeny plant and selecting a third progeny plant homozygous event 4588.259, 4588.757 or 4588.652 and capable of degrading one or more polysaccharides.
- a kit for identifying maize event 4588.259, 4588.757 or 4588.652 in a sample comprising a first primer and a second primer, wherein the first primer and the second primer are capable of amplifying a target sequence specific to maize event 4588.259, 4588.757 or 4588.652.
- 70 The kit of any one or more of embodiment 69 wherein, the first primer comprises a nucleic acid sequence selected from SEQ ID NOS: 38, 41, and 47.
- the kit of any one or more of embodiments 69-72, wherein the target sequence is capable of hybridizing to the sequence of the nucleic acid comprising a sequence of SEQ ID NOS: 40 or 44 under conditions of high stringency. 74.
- a method of identifying maize event 4588.259, 4588.757 or 4588.652 in a sample comprising:
- the target sequence comprises a sequence selected from SEQ ID NOS: 51-55.
- the method of identifying may be added to any one or more of embodiments 63-68.
- the target sequence is at least one sequence selected from the group consisting of SEQ ID NOS: 22-31.
- the step of detecting comprises hybridizing the amplified product to the nucleic acid comprising a sequence of SEQ ID NOS: 40 under conditions of high stringency, and selecting the amplified product specific to maize event 4588.259. 79.
- the method of embodiment 75, wherein the step of detecting comprises hybridizing the amplified product to the nucleic acid comprising a sequence of SEQ ID NOS: 44 under conditions of high stringency, and selecting the amplified product specific to maize event 4588.652.
- 80. A method for reducing the viscosity of a grain mixture comprising combining grains from a transgenic plant of any one or more of embodiments 1-13, a different plant, and liquid to form a grain mixture.
- the method of embodiment 80, wherein the different plant is a non-transgenic plant.
- 82. The method of embodiment 80, wherein the different plant is a genetically engineered plant. 83.
- the genetically engineered plant comprises a synthetic nucleic acid encoding at least one hydrolytic enzyme.
- the at least one hydrolytic enzyme is selected from the group consisting of: xylanase, an amylase, an endoglucanase, an exoglucanase, a feruloyl esterase, a glucoamylase, an intein-modified amylase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, a protease, an intein-modified protease, a phytase, or an intein-modified phytase.
- any one or more of embodiments 80-84 further comprising processing the grain mixture.
- the step of processing includes one or more operations selected from the group consisting of harvesting, grinding, milling, size reduction, crushing, heating, gelatinizing, liquefaction, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, saccharifying, fermentation, chemical conversion, and chemical catalysis.
- a codon optimized nucleotide sequence for expression of the AGR2314 feed glucanase in maize was synthesized.
- single AGR2314 expression cassettes were assembled in vectors pAG4000 (pAG4258) or pAG4500 (pAG4588, pAG4597, and pAG4708).
- the vector pAG4000 has been created by replacing the rice ubiquitin 3 promoter with the first intron by the maize ubiquitin 1 promoter containing its own first intron for driving expression of the selectable marker gene encoding E. coli phosphomannose isomerase (PMI).
- PMI E. coli phosphomannose isomerase
- the vector pAG4500 represents further improvement of pAG4000 and contains three modifications such as 1) insertion after the first maize ubiquitin intron of a 9 bp sequence (ATCCAGATC) representing the first three codons of the ubiquitin monomer with ATG converted into ATC; 2) insertion of the maize Kozak element (TAAACC) after the 9 bp sequence ubiquitin monomer; 3) replacement of the old multiple cloning site (MCS) by a new MCS that was synthesized by PCR and that was designed to contain multiple sites for several rare cutting enzymes (NotI, PacI, FseI, SwaI, AscI, AsiSI) to facilitate cloning of up to 4-5 expression cassettes on one T-DNA.
- TAAACC maize Kozak element
- FIGS. 1-4 illustrate the expression vectors pAG4258, pAG4588, pAG4597, and pAG4708, respectively, carrying a single feed glucanase expression unit.
- the vector pAG4258 ( FIG. 1 ; SEQ ID NO 7) has been cloned by assembling an expression cassette that was composed of the maize Glb1 promoter fused to the maize codon optimized AGR2314 sequence in KpnI-AvrII sites of pAG4000.
- the vectors pAG4588 ( FIG. 2 ; SEQ ID NO 8) and pAG4597 FIG.
- FIGS. 5-6 illustrate the expression vectors pAG4766 and pAG4767, respectively, carrying two feed glucanase expression units.
- FIGS. 7-8 illustrate the expression vectors pAG4770 and pAG4771, respectively, carrying three feed glucanase expression units.
- the unique rare cutting restriction sites that are available within the MCS of the pAG4500 were subsequently used in order to develop additional expression constructs containing either double AGR2314 expression units, such as pAG4766 ( FIG. 5 ; SEQ ID NO 11) and pAG4767 ( FIG. 6 ; SEQ ID NO 12), or triple AGR2314 expression units, such as pAG4770 ( FIG. 7 ; SEQ ID NO 13) and pAG4771 ( FIG. 8 ; SEQ ID NO 14), on the same T-DNA.
- the constructed vectors for expression of AGR2314 glucanase in plants are listed in Table 1. E. coli strains carrying the expression vectors were used for conjugation with Agrobacterium and subsequent transformation of maize.
- Expression cassettes for related beta glucanases were prepared using similar strategies, and sequences are provided for these expression cassettes as they are found in the expression vectors pAQ4257 pAQ4692, pAQ4693, pAQ4705, pAQ4706, pAQ4766, pAQ4257, pAQ4692, pAQ4693, pAQ4705, and pAQ4706.
- Flour was prepared from about 20 transgenic seeds by milling in an Udy cyclone mill or knife mill with 0.5 mm or 1 mm screen. About 0.5 ml of protein extraction buffer (100 mM sodium phosphate, pH 6.5, 0.01% Tween 20) was added to 20 mg flour in a 2 ml tube. In some cases, 2 g, 10 g, or 20 g ground samples was mixed with 10 ml, 50 ml or 100 ml of the extraction buffer in 15 ml tubes or 250 ml bottles. Larger masses and volumes can be used by scaling these amounts appropriately. After vortexing, the tubes were placed on a rotating platform in a 60° C. incubator and rotated for 1 hour for protein extraction.
- protein extraction buffer 100 mM sodium phosphate, pH 6.5, 0.01% Tween 20
- the supernatant was diluted 20-fold for enzyme assay by adding 20 ⁇ l supernatant to 380 ⁇ l protein extraction buffer. In some cases, other dilution factors were used, as necessary.
- the activity was recorded as A590/mg flour after multiplying the dilution factors: A590xAx(500/50)/20 mg, where A is protein extraction dilution factor; 500 is the volume (ml) of buffer used for protein extraction; 50 is the volume of protein extraction (ml) used in the activity test.
- the assay involves the quantitation of reducing sugars that are released during a time course digestion of a model substrate (barley- ⁇ -glucan) obtained from Megazyme (Wicklow, Ireland).
- Test 2 ml tubes were labeled with “+” sign, and 5 mg barley- ⁇ -glucan substrate (reaction) was added to each test tube; no substrate was added to control tubes (control).
- a tube with 2 ml of diluted grain protein extract, extracted as described above was placed in the Thermo-shaker to be pre-warmed.
- BCA quantification of glucose reducing equivalents Glucose standards were prepared in protein extraction buffer at the following concentrations: 0.05 mM, 0.1 mM, 0.2 mM, 0.4 mM, 0.6 mM, and 0.8 mM.
- BCA reagent (from Thermo Scientific) was prepared by mixing reagent A with reagent B in a ratio of 50:1.
- 75 ⁇ l of buffer were dispensed into the first well of row A (A1) in a microplate and 75 ⁇ l of each glucose standard were dispensed into wells A2 through A7.
- the microplate was sealed and incubated at 80° C. in a heat block. After 10 min incubation, the microplate was chilled on ice for 10 minutes and centrifuged to bring down condensate. Subsequently, the absorbance at 560 nm of each well was measured on a microplate reader.
- Unit Activity Measurement detects the reducing sugars such as glucose released from the model substrate (barley- ⁇ -glucan) by glucanase treatment at 80° C. for 40 minutes or 90 minutes.
- the initial velocity is detected within 40 minutes (grain product) or 90 minutes (feed sample) of the reaction.
- the reactions were carried out in 96-well block (Costar, Cat #3960) or strip tubes (VWR, Cat #29442-610).
- the cluster tubes were used for 90 minutes endpoint activity unit assay of feed samples. Protein extract was diluted to 2-, 6-, 10- and 20-fold dilutions.
- Purified protein diluted 100-fold was used as a positive control for assay validation.
- Purified glucanase protein (200,000 ppb) was stored in 50 mM MES, 150 mM sodium chloride, pH6.3 buffer plus 40% glycerol at ⁇ 20° C.
- Ten microliters of protein were mixed with 990 ⁇ l of the extraction buffer, and 50 ⁇ l were used for activity assay.
- Barley- ⁇ -glucan digestion by feed glucanase was carried out at a water bath set at 80° C.
- 450 ⁇ l of the substrate were dispensed into tubes of A2 to D12 referring Table 2. These rows served as the reaction.
- the tubes were covered with CorningTM Storage Mat III, the Corning Storage Mat Applicator was used to seal the tubes.
- the plate was shaken at a low speed.
- the block was placed in the water bath at 80° C. for the 90 minutes incubation period.
- the reaction was terminated by adding 100 ⁇ l of 0.5 N HCl to each well and cooling the block on ice.
- BCA quantification of glucose reducing equivalents Glucose standards were prepared in 100 mM sodium phosphate buffer, pH6, at the following concentrations: 0.05 mM, 0.1 mM, 0.2 mM, 0.4 mM, 0.6 mM, and 0.8 mM.
- BCA reagent (from Thermo Scientific) was prepared by mixing reagent A with reagent B in a ratio of 50:1.
- 75 ⁇ l of buffer was dispensed into the first well of row A (A1) and 75 ⁇ l of each glucose standard were dispensed into wells A2 through A7.
- the dilution factor of 24 was determined by comparing the ratio of the total reaction volume to the portion of the reaction that was used in the BCA assay.
- the total reaction volume was 600 ⁇ l including 500 ⁇ l reaction and 100 ⁇ l of HCl used to stop the reaction.
- the portion of the reaction that was used in the BCA assay was 25 ⁇ l. Therefore, the dilution factor of 24 was calculated by dividing 600 ⁇ l by 25 ⁇ l.
- the amount of protein in the assay was calculated as follows.
- the concentration of the positive control was 2000 ng/ml, 50 ⁇ l was the aliquot of the positive control used in the test (or 50/1000 if calculated in mL).
- the amount of protein calculated in nanograms was 2000 ⁇ (50/1000), or 2000 ⁇ (50/1000)/1000000 if calculated in milligrams.
- FIG. 9 illustrates the range of activities recovered from 42 independent ears.
- the numbers along the abscissa correspond to individual event identifiers. The highest activity was observed in the event 259.
- the activity was about 25 A590/mg.
- the average activity of the homozygous seeds derived from the first generation of the selfed plants was approximately 116 f 15 A590/mg.
- the activity of heterozygous seeds from this population was about 59 f 18 A590/mg.
- FIG. 10 illustrates the range of activities recovered from 15 independent ears. In this figure, the numbers along the abscissa correspond to individual event identifiers. The highest activity was observed in the event 460.
- Event 4588.259 The event 4588.259 carries two independent T-DNA integration sites that are located on the maize chromosomes 4 and 8.
- the chromosomal locations of the T-DNA integration sites were determined through BLASTN searches, in which the maize genomic DNA sequences that are contained in OB-2880, OB-2832 and OB-3252 sequences isolated from T-DNA insertion sites at the right and left T-DNA borders, were used as the queries for screening publicly available maize B73 genome sequence databases, such as the Maize Genetics and Genome Database, htt)://www.maizegdb.org/(Accessed May 8, 2016) See also Andorf, C M, Cannon, E K, Portwood, J L, Gardiner, J M, Harper, L C, Schaeffer, M L, Braun, B L, Campbell, D A, Vinnakota, A G, Sribalusu, V V, Huerta, M, Cho, K T, Wimalanathan, K, Richter, J D
- flanks OB-2880, OB-2832 and OB-3252 which are provided below, the maize genomic DNA is shown in the uppercase letters, while the pAG4588 vector sequences are indicated in the lowercase letters and are underlined.
- the T-DNA integration site on the maize chromosome 4 is characterized by the 795 bp right T-DNA border flanking sequence OB-2880, which contains 677 bp of maize genomic.
- the isolated 677 bp maize genomic DNA flank has 99.3% sequence identity to the sequence derived from the antisense DNA strand of the maize chromosome 4 (nucleotide coordinates 56612593-56612026).
- the T-DNA insertion site on the chromosome 8 is characterized by the sequences OB-2832 and OB-3252 that represent, accordingly, left and right flanks for the T-DNA integrated into this locus.
- the 1211 bp OB-2832 sequence contains 864 bp of maize genomic DNA.
- the isolated 864 bp maize genomic DNA flank has 99.65% sequence identity to the sequence derived from the maize chromosome 8 with nucleotide coordinates 100613054-100613915.
- the 696 bp OB-3252 sequence contains 95 bp of maize genomic DNA.
- the OB-3252 does not contain left T-DNA border sequence.
- the isolated 95 bp flank has 100% sequence identity to the sequence derived from the antisense DNA strand of the maize chromosome 8 with nucleotide coordinates 100613034-100612940.
- the maize genomic DNA flanks in sequences OB-2832 and OB-3252 are separated by 20 nucleotides on the maize chromosome 8, which indicates that during T-DNA integration 20 bp of the original maize genomic DNA sequence were replaced by the inserted T-DNA sequences.
- the 970 bp OB-2861 sequence consists of the re-arranged pAG4588 sequences including a partial 223 bp Nos terminator sequence (uppercase letters, nucleotides 3290-3512 in pAG4588); the 73 bp sequence near the left T-DNA border with the first 3 bp of the processed left T-DNA border sequence (italicized lowercase letters, nucleotides 3513-3585); the 299 bp sequence near the right T-DNA border with 5 bp of the processed right T-DNA border sequence and polylinker sequence with multiple cloning sites (lowercase letters, nucleotides 9647-9945); the 359 bp 5′ sequence of the rice glutelin promoter prGTL-03 (uppercase letters, nucleotides 9946-10304).
- the underlined are 18 bp of a duplicated sequence that has been created during T-DNA integration
- the 1127 bp OB-2868 sequence consists of re-arranged pAG4588 sequences including the 595 bp 3′ sequence of the PMI marker gene (uppercase letters, nucleotides 2594-3188 in pAG4588); the 48 bp sequence between PMI and Nos terminator (lowercase letters, nucleotides 3189-3236); the 276 bp Nos terminator sequence (uppercase letters, nucleotides 3237-3512); the 73 bp sequence near the left T-DNA border with the first 3 bp of the processed left T-DNA border sequence (italicized lowercase letters, nucleotides 3513-3585); the 119 bp sequence near the right T-DNA border with 5 bp of the processed right T-DNA border and a partial polylinker sequence (lowercase letters, nucleotides 9647-9765).
- the underlined are 18 bp of a duplicated sequence that has been created during T-DNA integration process.
- Event 4588.757 The event 4588.757 carries one T-DNA integration site that is located on the maize chromosome 8.
- the chromosomal location of the T-DNA integration site was determined through BLASTN searches, in which the maize genomic DNA sequences that are contained in OB-3170 and OB-3237 sequences isolated accordingly from T-DNA insertion sites at the right or left T-DNA borders, were used as the queries for screening publicly available maize B73 genome sequence databases, such as http://www.maizegdb.org/. See also Andorf, C M et al.
- flanks OB-3170 and OB-3237 which are provided below, the maize genomic DNA is shown in the uppercase letters, while the pAG4588 vector is indicated in the lowercase underlined letters.
- the 1303 bp OB-3170 right T-DNA border flanking sequence consists of the 975 bp maize genomic DNA attached to the 328 bp of the pAG4588 vector borderless sequence proximal to the right T-DNA border site.
- the isolated 975 bp maize genomic DNA flank has 99.38% sequence identity to the sequence derived from the maize chromosome 8 with nucleotide coordinates 62661042-62662016.
- the OB-3170 sequence is as follows:
- the 960 bp OB-3237 left T-DNA border flanking sequence consists of the 620 bp of the maize genomic DNA attached to the 340 bp pAG4588 vector sequence (nucleotides 3260-3599 in pAG4588), which includes 253 bp Nos terminator sequence and 70 bp sequence upstream of the 17 bp processed left T-DNA border sequence.
- the isolated 620 bp maize genomic DNA flank has 100% sequence identity to the sequence derived from the maize chromosome 8 with nucleotide coordinates 62662037-62662642.
- the OB-3237 sequence is as follows:
- the maize genomic DNA flanks in sequences OB-3170 and OB-3237 are separated by 21 nucleotides on the maize chromosome 8, which indicates that during T-DNA integration 21 bp of the original maize genomic DNA sequence were replaced by the inserted T-DNA sequences.
- FIG. 11 illustrates a diagram showing positions of the characterized flanking sequences in 4588.652.
- T-DNA in the event 4588.652 has integrated into chromosome 7 of the maize genome in BxA genotype, which was used for maize transformation with the pAG4588 construct.
- the T-DNA insertion occurred between nucleotides 141683320-141683357 of the publicly available reference B73 maize genome.
- the T-DNA integration displaced 38 bp of the native maize genomic sequence at this site. This 38 bp DNA is underlined and the sequences of pAG4588 are underlined and shown in bold characters in the sequences of the T-DNA insertions shown below.
- the diagram illustrated in FIG. 11 depicts locations of the sequences in the locus in 4588.652.
- the following wild type maize genomic DNA sequences were used for reference: the WT_BxA (OB-4541; SEQ ID NO: 32), the WT_E sequence (OB-4545, OB-4546; SEQ ID NO: 33), the WT_G sequence (OB-4547, OB-4548; SEQ ID NO: 34), the Null_BC2ES2_512x sequence (OB-4578 to OB-4580; SEQ ID NO: 35), the Null_BC1GS2_518x sequence (OB-4582 to OB-4584; SEQ ID NO: 36), and the WT_B73Chr7_141681606-141685147 reference sequence (SEQ ID NO: 37).
- the right and the left border flanks were additionally isolated and entirely sequenced from the more advanced 4588_652 transgenic progeny BC2ES2_472x.
- the entire 4044 bp BxA genomic sequence containing the right and the left border flanking sequences have high BLASTN identity hits to two nucleotide positions 141681606-141682538 and 141682550-141685147 on the chromosome 7 in the maize B73 genome.
- the left T-DNA border flank OB-4451 has 98.66% BLASTN sequence identity to nucleotides 141683358-141685147 on the maize chromosome 7 in B73 genome.
- Multiple sequence alignment of the left border specific sequences from the wild type genotypes B73, BxA, 19545 (E), 15009 (G), nulls BC2ES2_512x and BC1GS2_518x as well as 4588_652 transgenic progenies 116_F1G and BC2ES2_472x and the reference public sequence of B73 genome revealed that these 1.8 kb sequences are nearly 100% identical between all genotypes.
- the 2218 bp right border flank OB-4448 has high BLASTN sequence identity to two nucleotide positions 141681606-141682538 and 141682550-141683319 on the maize chromosome 7 in B73 genome.
- Multiple sequence alignment of the right border specific sequences from 4588_652 transgenic progenies 116_F1G and BC2ES2_472x with the WT sequence of BxA revealed that these three 2.2 kb sequences are nearly 100% identical.
- a 521 bp “unique” sequence that is specific to the right T-DNA border flank has originated from genotype BxA, which was used for transformation with the pAG4588 construct. No BLASTN sequence identity hits to this sequence were identified at the T-DNA integration site within the reference B73 genome. On the other hand, the 521 bp sequence has multiple BLASTN identity hits on different chromosomes in maize B73 genome indicating that this sequence is highly repetitive. The 521 bp sequence is shown in italicized lowercase letters.
- the RB_BC2ES2_472x sequence (extended RB flank isolated from the advanced progeny of 4588_652) is as follows:
- the OB-4451 sequence (extended left border flank in 4588_652 is as follows:
- T1 progeny from original “T0” transgenic maize plants were grown, and individual ears were either self-pollinated or pollinated with pollen from wild-type maize plants. Mature seed from the resulting ears was then assayed for feed glucanase activity via the colorimetric assay.
- FIG. 12 illustrates that glucanase activity was observed in T1 events. In this figure, the numbers along the abscissa correspond to the event identifiers of the original T0 plants from which the progeny were derived. The highest activity was observed for seeds of T1 plant derived from the 4597_69 event.
- Progeny from original “T0” transgenic maize plants were grown and backcrossed (pollinated with pollen from the wild type maize parents or pollinated onto the wild type parents) for 4 generations (in maize inbred line E (BC4E), or in maize inbred line G (BC4G)). At each generation, some individual ears were self-pollinated. PCR method was applied to select homozygous plants as described in Example 8. Hybrid ears were made by cross-pollinating transgenic line G plants with transgenic line E plants, or vice versa.
- FIG. 13 illustrates that glucanase activity in the hemizygous, homozygous and hybrid ears of event 4588.259.
- the homozygous and hybrid ears contained average activity of 190 units/g, which was approximately double of ears from hemizygous plants.
- Maize glucanase events 4588.259, 4588.652, and 4588.757 carry transgenes that result in seed-specific expression of glucanase enzyme.
- Event 4588.259 originally carried two T-DNA insertions at independently segregating loci, but subsequently a single genetic locus was selected for propagation and development.
- Events 4588.652 and 4588.757 carry two or more T-DNAs at a single genetic locus.
- Molecular identification and tracking of these transgenes can be done using standard PCR analysis (visually scoring an endpoint in a gel-based electrophoresis and staining of the PCR products) or real-time PCR.
- some of these PCR assays can also determine whether a plant is hemizygous (carrying one copy of the insertion) or homozygous (carrying two copies of the insertion).
- FIG. 24 illustrates general real-time PCR assay design used to determine T-DNA locus presence (standard and real-time PCR) and zygosity (real-time PCR only).
- the standard and real-time PCR assays include, for each T-DNA locus, one primer (Primer A) that binds to a maize genomic region that is adjacent to where the T-DNA insert is located and one primer (Primer B) that binds to a region in the T-DNA that is close to Primer A.
- a second reference gene (GWD, glucan water dikinase) is amplified (X and Y primers) along with the locus primers.
- the standard multiplex PCR assay includes Primer A and B, as described above, but also another primer (Primer C) that binds to a maize genomic region on the other side of the T-DNA, opposite Primer A, and would be close to Primer A if the T-DNA insertion was not present, as in a wild type (WT) locus.
- FIG. 15 illustrates general standard PCR assay design used to determine T-DNA locus presence and zygosity. When the T-DNA insertion is present, the distance between Primer A and Primer C would be too large to amplify a product under our PCR amplification conditions and therefore absence of this amplification product is used to determine zygosity.
- PCR amplification of products from Primer A+B and Primer A+C indicates that the T-DNA locus is present and is hemizygous (one-copy).
- PCR amplification of product from Primer A+B, but not Primer A+C indicates that the T-DNA locus is present and is homozygous (two-copy).
- PCR amplification of product from Primer A+C only indicates that no T-DNA is present and the plant is WT at this locus. Primers and probes for all of these assays are listed in Tables 3 and 4.
- PCR assay using primers X (371) and Y(525) identifies the ZmGWDref locus (SEQ ID NO: 56).
- a standard DNA extraction method (10X TE+Sarkosyl) that was used in this example is as follows: leaf tissue (standard 1 cm hole punch) is sampled into a 96 deep-well block, metal beads are added, and the block is frozen at ⁇ 80° C. for at least 30 min. The block is then ground for 45 sec in a Kleco Pulverizer, centrifuged at 4,000 RPM for 3 min, the lid is removed, 300 ⁇ l of 10XTE+Sarkosyl is added, the block is resealed, and the block is mixed at room temperature for 10-20 min.
- the block is centrifuged at 4,000 RPM for 5 min, 165 ⁇ l of upper aqueous phase is removed and added to a 96-well PCR block, the PCR block is sealed, and the block is incubated at 90° C. for 30 min. After incubation, 20 ⁇ l of extract is added to 180 ⁇ l of sterile water in a 96-well plate (1:10 dilution) to create the final DNA sample for PCR.
- Standard PCR is performed with 2 ⁇ l of DNA extract and GoTaq (Promega) or Kapa 3G (Kapa Biosystems) PCR Mix in 30 ⁇ l reaction volumes with the following components and conditions for each event:
- Components were as follows: PCR Mix with buffer, MgCl 2 , nucleotides, and enzyme (1 ⁇ ); primer 509 (400 nM) and primer 516 (400 nM). Conditions were as follows: 95° C., 3 min; 33 cycles (95° C., 30 sec; 55° C., 30 sec; 72° C., 30 sec); 72° C., 8 min.
- Components were as follows: PCR Mix with buffer, MgCl 2 , nucleotides, and enzyme (1 ⁇ ), primer 749 (400 nM), primer 750 (400 nM), and primer 751 (400 nM). Conditions were as follows: 95° C., 3 min; 33 cycles (95° C., 30 sec; 55° C., 30 sec; 72° C., 30 sec); 72° C., 8 min.
- Components were as follows: PCR Mix with buffer, MgCl 2 , nucleotides, and enzyme (1 ⁇ ), primer 513 (400 nM), primer 608 (400 nM), and primer 609 (400 nM). Conditions were as follows: 95° C., 3 min; 33 cycles (95° C., 30 sec; 55° C., 30 sec; 72° C., 30 sec); 72° C., 8 min.
- Standard PCR was analyzed by running approximately 15 ⁇ l of PCR product on a 3% agarose gel at 95V for 30 min.
- An example of results from a standard PCR analysis of the 4588.652 selfed segregating plants is shown in FIG. 16 . Referring to this figure, ten PCR reactions from 10 independent plants were separated on a 3% agarose gel stained with ethidium bromide. Expected locus and zygosity band sizes are indicated on the right side of the image.
- Locus presence and zygosity is scored by visualizing specific bands in each lane.
- Components were as follow: PCR Mix with buffer, MgCl 2 , nucleotides, and enzyme (1 ⁇ ), primer 509 (400 nM, primer 516 (400 nM), primer 371 (400 nM), primer 525 (400 nM), probe PB5 (200 nM) and probe PB2 (200 nM). Conditions were as follows: 95° C., 4 min; 40 cycles (95° C., 5 sec; 60° C., 45 sec)
- Components were as follows: PCR Mix with buffer, MgCl 2 , nucleotides, and enzyme (1 ⁇ ), primer 750 (400 nM), primer 751 (400 nM), primer 371 (400 nM), primer 525 (400 nM), probe PB17 (200 nM) and probe PB2 (200 nM). Conditions were as follows: 95° C., 4 min; 40 cycles (95° C., 5 sec; 60° C., 45 sec)
- Event 4588. 259 Real-Time PCR.
- Real-Time PCR can be analyzed by any real-time PCR machine and software capable of four-channel fluorescence detection.
- a Bio-Rad CFX96 real-time PCR machine and CFX Manager Software were used to run an example of the 4588.259 real-time PCR assay on a selfed segregating population of 4588.259 plants.
- FIG. 17 illustrates an example of real-time PCR data for 4588.259 to determine locus presence and zygosity.
- “RFU” refers to relative fluorescence units
- ntc refers no target control. Presence of the 4588.259 locus and zygosity was scored by the clustering of data points on the graph.
- the germination rate in T1 and/or T2 for events 4597_54, 4597_56, 4588_161, 4588_252, 4588_259, 4597_101, and/or 4597_104 was observed to be 100%.
- Milled grain from transgenic plants expressing the feed glucanase was mixed with starter and grower corn-soy diets that were formulated for broiler chickens.
- the basal corn-soy diet for starter broilers was composed as follows: 54.89% corn 08-2012, 32.81% soybean oilcake, 5.00% distillers dry grains plus soluble solids, 2.00% vermiculite, 1.99% dicalcium phosphate, 1.00% poultry fat, 0.81% limestone fine, 0.50% plain salt (NaCl), 0.20% DL-methionine, 0.20% choline chloride 60, 0.20% mineral premix, 0.13% L-lysine, 0.12% L-threonine, 0.05% vitamin premix, 0.05% coban, and 0.05% selenium premix.
- the basal corn-soy diet for grower broilers was composed as follows: 58.53% corn, 26.63% soybean oilcake, 8.00% distillers dry grains plus soluble solids, 2.00% vermiculite, 1.69% dicalcium phosphate, 1.00% poultry fat, 0.76% limestone fine, 0.50% plain salt (NaCl), 0.20% mineral premix, 0.20% choline chloride 60, 0.13% DL-methionine, 0.13% L-lysine, 0.08% L-threonine, 0.05% vitamin premix, 0.05% coban, and 0.05% selenium premix.
- Fine corn was ground using the hammermill screens: no. 4/4 for the starter diet and no. 6/6 for the grower and finisher diets.
- Coarse corn (5% of total corn) was ground with the roller mill with 0/100 gap openings.
- Diet A was a basal diet
- Diet D was the basal diet mixed with a control enzyme
- Diet E was the basal diet mixed with the milled transgenic corn grain containing a high level of glucanase
- Diet F was the basal diet mixed with the milled transgenic corn grain containing a low level of glucanase.
- Milled grain from transgenic plants expressing the feed glucanase was mixed with the basal diets at a ratio of approximately 1 lb transgenic grain per 2000 lbs basal diet mixture.
- transgenic grain was first mixed with non-transgenic grain at a weight ratio of 1:4 (1 gram of transgenic grain per 4 grams non-transgenic grain) to dilute the enzyme concentration prior to adding this ingredient to the basal diets.
- FIGS. 18A and 18B illustrate glucanase activity before and after pelleting in the Grower Diet ( FIG. 18A ) and the Starter Diet ( FIG. 18B ).
- samples from the resulting mixture were then removed before and after pelleting of the feed. These samples were then tested via the colorimetric glucanase assay to determine whether the enzyme survived the pelleting process.
- 18A and 18B were as follows: A, basal control diet (no external enzyme); D, positive control diet (commercially available enzyme added); F, low-dose diet (including milled grain from plants that express the feed glucanase); E, high-dose diet (including milled grain from plants that express the feed glucanase). It was observed that glucanase activity was high in the high-dose diet for both the Starter Diet and the Grower Diet and survived pelleting.
- Feed glucanase was prepared via microbial expression and purification, and suspended in SEC buffer (100 mM MES, 300 mM NaCl, pH6.3). Five microliters of this preparation was mixed with 20 mg milled grain from wild-type maize. In parallel, 5 ⁇ l of SEC buffer was mixed with 20 mg milled grain from transgenic plants that express feed glucanase. Replicates from each of these two sets of samples were incubated at 94° C. or ⁇ 130° C. for various periods of time, then allowed to cool to room temperature. Subsequently, residual glucanase activity was measured via the colorimetric assay.
- FIGS. 19 A and 19 B illustrate glucanase activity after heat treatment.
- FIG. 19 A and 19 B illustrate glucanase activity after heat treatment.
- FIG. 19A illustrates glucanase activity after treatment at 130° C.
- FIG. 19B illustrates glucanase activity after treatment at 94° C.
- expression and accumulation of the enzyme in grain effectively provides the enzyme with additional thermal stability relative to the same enzyme that is produced microbially.
- both the grain-expressed and the microbially-expressed enzymes have the same primary amino acid sequence. Therefore, the enhanced thermal stability that was observed in the flour from transgenic grain is a function of the expression host.
- AGR2314 activity was measured at several pH values between 3 and 8.5.
- Each assay 500 ⁇ L contained Britton-Robinson polybuffer (40 mM sodium phosphate, 40 mM sodium borate, and 40 mM sodium acetate), 0.01% (v/v) Tween 20, one Beta-glucazyme substrate tablet (Megazyme, Wicklow, Ireland), and 20 nM of AGR2314 in a 2 mL Eppendorf tube. Samples were incubated for 1 hour at 37° C. or 80° C. Reactions were terminated by the addition of 1 mL of 2% (w/v) tris base.
- FIGS. 20 and 21 illustrate the optimum pH for measuring AGR2314 activity at 37° C. ( FIG. 20 ) and 80° C. ( FIG. 21 ).
- the optimum pH was determined to be 7-7.5 at 37° C.
- FIG. 21 illustrates that the optimum was determined to be 6 at 80° C.
- FIG. 22 shows an example of pH optimum of the feed glucanase that is produced in transgenic flour.
- the 96-well plate was centrifuged at 3000 ⁇ g for 10 minutes in a clinical centrifuge, then 100 ⁇ L of the supernatant from each of the samples was transferred to wells in a flat-bottom microplate, and the absorbance at 590 nm was determined on a microplate spectrophotometer.
- the seed-produced enzyme has a pH optimum between pH6 and pH7, but still retains a large fraction of its activity at a pH as high as 10.
- Beta-glucosidase assays the substrate was 1 mM pNP-D-glucopyranoside (Sigma Chemical Co. catalog # N:7006) and the positive control enzyme was Rhizobium etli beta-glucosidase (Prozomix, catalog No. PRO-E0110; 315.9 Unit/mL). Reaction volumes were 500 ⁇ L; reactions were terminated by the addition of 500 L of 2% (w/v) tris base. After centrifugation at 3000 ⁇ g for 10 minutes, 100 ⁇ L of supernatant was transferred to a microplate and the absorbance at 405 nm was recorded.
- each assay contained one tablet of Cellazyme C substrate (Megazyme, catalog No, T-CCZ) in 500 ⁇ L buffer. Reactions were terminated by the addition of 1 mL of 2% tris base. Samples were centrifuged for 10 minutes at 15,000 ⁇ g, 100 ⁇ L of supernatant was transferred to a microplate, and the absorbance at 590 nm was recorded.
- Cellazyme C substrate Megazyme, catalog No, T-CCZ
- Exocellulase (cellobiohydrolase) assays the substrate was 1 mM pNP-D-cellobioside (Sigma catalog No. N5759) and the positive control enzyme was CBHI from Trichoderma longibrachiatum (Megazyme catalog No. E-CBHI; 0.5 Units/ ⁇ L). Reaction conditions were as described above for the beta-glucosidase assays.
- the substrate was Red Starch (Megazyme catalog No. S-RTAR; prepared as directed by the manufacturer) and the positive control enzyme was ⁇ -amylase from Bacillus licheniformis (Megazyme catalog No. E-BLAAM: 3000 Units/mL).
- 245 ⁇ L buffer, 5 ⁇ L of enzyme, and 125 ⁇ L of Red Starch reagent were mixed and incubated as described above. Reactions were terminated by the addition of 625 ⁇ L ethanol. After incubating at room temperature for 10 minutes, samples were centrifuged for 10 minutes at 3000 ⁇ g, and 100 ⁇ L of supernatant was transferred to a microplate; absorbance at 510 nm was recorded.
- each assay contained one tablet of Xylazyme AX substrate (legazyme catalog No, No. XAX-1000) and the positive control enzyme was 100 mg/mL of Thermomyces lanuginosis xylanase (Sigma catalog #X2753) in assay buffer. Reactions were carried out as described above for the endocellulase assays.
- Pectinase assays the substrate was 25 mg/mL pectin (Sigma catalog No. P7536) in assay buffer and the positive control enzyme was pectinase from Aspergillus niger (Sigma catalog No. 17389) at 100 mg/mL in assay buffer. Five p L of enzyme was added to 35 PL of pectin solution and incubated as described above. Reactions were terminated by the addition of 60 ⁇ L of DNS stop/reagent solution (Wicher et al. [2001], Appl. Microbiol. Biotechnol. 55, p. 578) followed by heating at 950° C. for 15 minutes. Samples were centrifuged at 3000 ⁇ g for 10 minutes, 20 ⁇ L supernatant was mixed with 100 ⁇ L water in a microplate, and the absorbance at 550 nm was recorded.
- 1,3-beta-glucosidase assays each assay contained one tablet of 1,3-beta-glucazyme HS substrate (Megazyme catalog No. ET-CUR200) and the positive control enzyme was Trichoderma sp. 1,3- ⁇ -D-glucanase (Megazyme catalog No. E-LAMSE; 50 Units/mL). Reactions were carried out as described above for the endocellulase assays.
- 1,4-beta-glucosidase assays each assay contained one tablet of Beta-glucazyme substrate (Megazyme catalog No. TBGZ-1000T). Reactions were carried out as described above for the endocellulase assays, except that 5 ⁇ L of supernatant was mixed with 100 PL of water in a microplate for recording of absorbance.
- FIGS. 23A and 23B illustrate the glucanase activity for hydrolyzing starch, cellobiose (pNP-D-cellobioside), xylan (Xylazyme AX), HE-cellulose (Cellazyme C), barley-B-glucan (Beta-glucazyme), pectin and PNP-D-gluopyranoside at 37° C. ( FIG. 23A ) and 80° C. ( FIG. 23B ).
- AGR2314 and AGR2414 enzymes were highly active in hydrolyzing cellobiose and HE-cellulose at 37° C. and 80° C.
- FIGS. 24A and 24B illustrate release of monomeric sugars after enzymatic hydrolysis of the seed fiber.
- FIG. 24A shows glucose yield and FIG. 24B shows xylose yield.
- Pre-acid hydrolysis (light gray bars) and total (dark gray bars) sugars were separated and quantified via HPLC using a Bio-Rad Aminex HPX-87-P ion-exclusion column.
- AGR2314 does not release monomeric glucose or xylose from untreated seed fiber.
- this enzyme was able to solubilize untreated seed fiber into oligosaccharides which account for approximately 80% of the total sugars released by a commercially-available cellulase-enzyme cocktail.
- Glucose release from dilute acid-pretreated seed fiber 20 mg seed fiber was pretreated at 80 C in 0.5% H 2 SO 4 for 16 hours, then neutralized to pH 5.0.
- the pretreated seed fiber was digested at pH 5.0 with 2 ⁇ M AGR2314 and a suite of glucanase, cellobiohydrolase, endoglucanase, and beta-glucosidase (all at 2 ⁇ M loading) for 72 hours at 55° C.
- a commercial enzyme cocktail (Accellerase XY, Genencor) was used at full loading (FCT) as a positive control. After enzymatic hydrolysis, the soluble sugars in reaction supernatant were hydrolyzed into monomers via acid hydrolysis at 121° C.
- FIG. 25A and 25B illustrate release of monomeric sugars after enzymatic hydrolysis of the seed fiber.
- FIG. 25A shows glucose yield and
- FIG. 25B shows xylose yield.
- Pre-acid hydrolysis (light gray bars) and total (dark gray bars) sugars were separated and quantified via HPLC using a Bio-Rad Aminex HPX-87-P ion-exclusion column.
- AGR2314 did not release sugars from pretreated seed fiber at greater levels than the pretreatment itself. When combined with other cell-wall degrading enzymes, approximately 90% of total sugars were released as compared to a commercially-available cellulase-enzyme cocktail.
- the chemical energy contained within an animal's diet, and its availability to the animal eating the diet, are critical characteristics influencing the nutritional value of any diet. Diets rich in energy, provide adequate nutrition and promote rapid growth to higher levels than diets that are deficient in energy. Therefore, determining the energy within a diet, and altering energy availability by using glucanase enzymes, provides an important set of tools to improve animal nutrition and therefore animal performance.
- glucanase enzymes were fed with alternative feed ingredients (wheat, barley and low-fat DDGS) with or without supplemental glucanase. Broiler body weight gain, feed consumption and feed conversion rate were determined and feed glucanase enzyme was evaluated.
- Day-old male broiler were obtained from a commercial hatchery and randomly allocated to 64 battery cages in groups of 10. Experimental diets were fed from 0 to 28 d of ages. Initial group weights were obtained and equalized amongst the treatments. Feed disappearance and body weight were measured weekly (7, 14, 21, and 28 d of age) to calculate live performance parameters (feed consumption, body weight gain, and feed conversion ratio). In addition, excreta were collected twice to determine apparent metabolizable energy (AME) of the diets at 14 and 29 d of age.
- AME apparent metabolizable energy
- Dietary treatments were fed in a 4 ⁇ 2 factorial design and further delineated below.
- Four different diets corn/soybean meal based, corn/wheat based, corn/barley based, and corn/LF-DDGS based diets
- Diets were formulated to be isocaloric and all nutrients, with the exception of energy, were formulated to meet or exceed the nutrient requirements.
- the enzyme treatments had the enzyme added on top of the diet.
- titanium dioxide was added to the diets as an indigestible marker to determine AME and nutrient digestibility. Table 6 describes dietary treatments.
- Battery cages 92° F. from placement to 4 d, 90° F. from 5 to 9 d, 84° F. from 10 to 15 d, 80° F. from 16 to 24 d, 78° F. from 25 to 29 d,
- a 23 light:1 dark with a lighting intensity of 3.0 ft 2 was implemented from placement until 7 d of age.
- a 23 light: 1 dark lighting schedule was implemented from 8-21d with a lighting intensity of 1.0 ft candles.
- a 23 light: 1 dark lighting schedule was implemented from 22-28 d of age with a lighting intensity of 0.3 ft candles.
- Wire bottoms were placed into all battery cages prior to the start ofthe experiment or day-old chicks will fall through the floors. Wire bottoms were removed at d 7. In addition, cage doors were modified to accommodate smaller birds from 0 to 7 d of age.
- FIG. 26 illustrates the body weight gain (BWG) during the 28-day poultry feeding trial.
- BWG body weight gain
- FIG. 27 illustrates the changes in poultry BWG per time interval during 28 day feeding trial.
- initial group weights were obtained and equalized amongst the treatments.
- BWG was measured weekly (7, 14, 21, and 28 d of age) for broilers feed using the corn/LF-DDGS diet with (+) or without ( ⁇ ) a glucanase. Still referring to FIG. 27 , it was observed across all treatments that body wait gain in chickens fed with the glucanase including diets was higher than in chickens fed with diets without glucanase.
- FIG. 28 illustrates feed consumption during the 28-day poultry feeding trial using two different diets (corn/barley based and corn/LF-DDGS based) with (+) or without ( ⁇ ) a glucanase. Referring to FIG. 28 , it was found that feed consumption was higher for the diets that included a glucanase.
- FIG. 29 illustrates the feed conversion rate (FCR) during the 28-day poultry feeding trial with two different diets (corn/barley based and corn/LF-DDGS based diets) with (+) or without ( ⁇ ) a glucanase.
- the feed conversion rate refers to the feed consumption required for gaining the body weight for a tested animal.
- the FCR is calculated by dividing the value of feed consumption by the value of body weight gain. Referring to FIG. 29 , it was observed that the FCR was lower for the diets that included a glucanase. These data indicates that diets that included a glucanase facilitated digestion and feed consumption in the tested animals.
- the glucanase inclusion in treatments 5 (Trt_5), 6 (Trt_6), and 9 (Trt_9) produced intermediate results.
- references cited throughout this application are incorporated for all purposes apparent herein and in the references themselves as if each reference was fully set forth. For the sake of presentation, specific ones of these references are cited at particular locations herein. A citation of a reference at a particular location indicates a manner(s) in which the teachings of the reference are incorporated. However, a citation of a reference at a particular location does not limit the manner in which all of the teachings of the cited reference are incorporated for all purposes.
Abstract
Methods and compositions are described for producing a glucanase in transgenic plants and then incorporating parts of the transgenic plants in animal feed. The feed glucanase enzyme displays activity across a broad pH range, and tolerance to temperatures that are often encountered during the process of preparing animal feeds. Producing the enzyme in the transgenic plant enhances the thermal stability of the enzyme.
Description
- This application is a continuation of U.S. patent application Ser. No. 16/599,543, which was filed on Oct. 11, 2019. U.S. patent application Ser. No. 16/599,543 is a continuation of U.S. patent application Ser. No. 15/569,592, which was filed on Oct. 26, 2017 as 35 U.S.C. § 371 national phase application of PCT/US2016/032418, which was filed May 13, 2016, and claimed the benefit of U.S. Provisional Patent Application No. 62/161,482 filed May 14, 2015, all of which are incorporated herein by reference as if fully set forth.
- The sequence listing electronically filed with this application titled “Sequence Listing,” which was created on Jun. 23, 2021 and has a size of 146,050 bytes, is incorporated by reference herein as if fully set forth.
- This disclosure relates to transgenic plants expressing glucanases with improved thermal stability, nucleic acids encoding the same, as well as methods of processing transgenic plants and tissues, and producing and utilizing animal feed. This disclosure also relates to feed additives and grain and fiber processing additives that include glucanases.
- The abundance of non-starch polysaccharides (NSPs) in the diets of monogastric and ruminant animals can adversely affect the nutritional value of feed, and also present an opportunity to improve nutritional content if they can be degraded in the diet or converted into beneficial nutritional components. NSPs are among the primary structural components of plant cell wall (cellulose, hemicellulose, xyloglucans, arabionxylans, galactans, arabinogalactans, etc.) and can also serve as carbohydrate storage reserves in some plants. Additionally, pectins and gums are considered non-cell wall NSP. Because of their various structural and biological roles, NSPs often bind or encase the starch, proteins, fats and other nutrients that are present in plant-based feed ingredients (such as cereals, legumes, silage etc.) and other ingredients, inhibiting the animal's ability to digest nutrients efficiently. Increased levels of NSPs in the diet may increase viscosity of intestinal contents, which can interfere with digestive enzymes and reduce the digestibility of nutrients, thereby increasing feed conversion (mass of feed divided by the mass of meat produced) and reducing body weight gain (Iji, P. A. 1999. The impacts of cereal non-starch polysaccharides on intestinal development and function in the broiler chickens. Worlds Poult. Sci. J. 55:375-387, which is incorporated herein by reference as if fully set forth). For example, feeding increasing levels of guar meal germ (0, 5, or 7.5%) or guar meal hulls (0, 2.5, or 5%) to broilers resulted in increasing digesta viscosity (Lee, J. T., C. A. Bailey, and A. L. Cartwright. 2003. β-Mannanase ameliorates viscosity-associated depression of growth in broiler chickens fed guar germ and hull fractions. Poult. Sci. 82:1925-1931, which is incorporated herein by reference as if fully set forth). In addition to increasing the viscosity, body weight gain and feed conversion was also worse with increasing guar meal hull, demonstrating the negative effects of high viscosity on animal performance.
- NSPs have also been known to inadvertently trigger immune responses in the gut, which may further detract from efficiency of feed utilization and have implications for animal health.
- In addition to the cereal components, diets now also routinely contain DDGS (dried distillers grains and solubles) that is also not easily digested. Multiple studies have shown that enzyme supplementation can increase diet metabolizable energy (ME), and, or, decrease the viscosity of diets containing high levels of wheat, barley, DDGSs, or other fibrous components. The addition of carbohydrases to corn-soybean meal-based broiler diets, when formulated to have a 3% reduction in dietary ME, has been accomplished without compromising the feed conversions of broilers reared under either hot or cool seasons. It has been determined that the hydrolyzed β-d-glucan is responsible for improved growth.
- In an aspect, the invention relates to a method of identifying maize event 4588.259, 4588.757 or 4588.652 in a sample. The method comprises contacting a sample with a first primer and a second primer. The method comprises amplifying a nucleic acid in the sample to obtain an amplified product. The method also comprises detecting the amplified product specific to a target sequence in maize event 4588.259, 4588.757 or 4588.652.
- In an aspect, the invention relates to an animal feedstock comprising a transgenic plant or part thereof. The transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase. The glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- In an aspect, the invention relates to a method of producing an animal feedstock. The method includes mixing a transgenic plant or part thereof with plant material to form a mixture. The transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase. The glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- In an aspect, the invention relates to a method of increasing metabolizable energy of a diet. The method includes mixing a transgenic plant or part thereof with a feed ingredient. The transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase comprising an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
- In an aspect, the invention relates to a method of enhancing production of fermentable sugars from grains. The method includes mixing grains derived from any one of the transgenic plants described herein with grains derived from a different plant to form mixed grains. The method also includes processing mixed grains into fermentable sugars. The fermentable sugars are subsequently converted into ethanol or a similar fermentation product, which may include butanol, lactic acid, citric acid, acetic acid, or other fuels or chemicals.
- In an aspect, the invention relates to a transgenic plant, transgenic grain, or transgenic biomass comprising a synthetic nucleic acid encoding a glucanase. The glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6. The glucanase is capable of degrading one or more polysaccharides.
- In an aspect the invention relates to a synthetic polypeptide or a fragment thereof. The synthetic polypeptide or a fragment thereof comprises an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6. The glucanase is capable of degrading one or more polysaccharides.
- The following detailed description of preferred embodiments of the present invention will be better understood when read in conjunction with the appended drawings. For the purpose of illustrating the invention, there are shown in the drawings particular embodiments. It is understood, however, that the invention is not limited to the precise arrangements and instrumentalities shown. In the drawings:
-
FIG. 1 illustrates the expression vector pAG4258 carrying a single feed glucanase expression unit. -
FIG. 2 illustrates the expression vector pAG4588 carrying a single feed glucanase expression unit. -
FIG. 3 illustrates the expression vector pAG4597 carrying a single feed glucanase expression unit. -
FIG. 4 illustrates the expression vector pAG4708 carrying a single feed glucanase expression unit. -
FIG. 5 illustrates the expression vector pAG4766 carrying two feed glucanase expression units. -
FIG. 6 illustrated the expression vector pAG4767 carrying two feed glucanase expression units. -
FIG. 7 illustrates the expression vector pAG4770 carrying three feed glucanase expression units. -
FIG. 8 illustrates the expression vector pAG4771 carrying three feed glucanase expression units. -
FIG. 9 is a chart illustrating the range of glucanase activity recovered from ears of the maize plants that carried pAG4588 construct. -
FIG. 10 is a chart illustrating the range of glucanase activity recovered from ears of the maize plants that carried pAG4597 construct. -
FIG. 11 is a diagram showing the T-DNA integration site inchromosome 7 of maize event 4588.652. -
FIG. 12 is a chart illustrating glucanase activity observed in T1 plants. -
FIG. 13 is a chart illustrating the glucanase activity in the seeds of hemizygous, homozygous, and hybrid plants. -
FIG. 14 illustrates general design of the real-time PCR assay used to determine presence of the T-DNA locus (standard and real-time PCR) and zygosity (real-time PCR only) in transgenic events. Letters A, B, X and Y with arrows indicate primer binding sites. Rectangular boxes A+B and X+Y represent PCR products amplified from respective primer pairs. -
FIG. 15 illustrates general design of the standard PCR assay used to determine presence of the T-DNA locus and zygosity in transgenic events. Letters A, B, and C with arrows indicate primer binding sites. Rectangular boxes A+B and A+C represent PCR products amplified from respective primer pairs. -
FIG. 16 illustrates the standard multiplex PCR analysis of the selfed segregating 4588.652 plants. -
FIG. 17 is a graph illustrating real-time PCR data to determine presence of the T-DNA locus and zygosity for maize event 4588.259 (FG259). -
FIGS. 18A and 18B are charts illustrating glucanase activity in the Grower Diet (FIG. 18A ) and the Starter Diet (FIG. 18B ) before and after pelleting. -
FIGS. 19A and 19B are charts illustrating glucanase activity in wild type (WT) flour mixed with microbial glucanase and transgenic flour producing glucanase after heat treatment at temperatures of 130° C. (FIG. 19A ) and 94° C. (FIG. 19B ). -
FIGS. 20 and 21 are graphs illustrating the optimum pH for measuring AGR2314 activity in an assay at 37° C. (FIG. 20 ) and 80° C. (FIG. 21 ). -
FIG. 22 is a graph illustrating an example of the optimum pH of the feed glucanase that is produced in transgenic flour. -
FIGS. 23A and 23B are charts illustrating glucanase activity on multiple substrates at 37° C. (FIG. 23A ) and 80° C. (FIG. 23B ). -
FIGS. 24A and 24B are charts illustrating enzymatic hydrolysis of untreated seeds fiber of transgenic maize plants expressing AGR2314.FIG. 24A shows glucose yield andFIG. 24B shows xylose yield. -
FIGS. 25A and 25B are charts illustrating enzymatic hydrolysis of seed fiber of transgenic maize plants expressing AGR2314 pretreated with the dilute acid.FIG. 25A shows glucose yield andFIG. 25B shows xylose yield. -
FIG. 26 is a chart illustrating the body weight gain (BWG) during the 28-day poultry feeding trial. -
FIG. 27 is a chart illustrating the changes in poultry BWG per time interval during 28 day feeding trial. -
FIG. 28 is a chart illustrating feed consumption during the 28-day poultry feeding trial using two different diets (corn/barley based and corn/LF-DDGS based) with (+) or without (−) a glucanase. -
FIG. 29 is a chart illustrating feed conversion rate (FCR) during the 28-day poultry feeding trial with two different diets (corn/barley based and corn/LF-DDGS based diets) with (+) or without (−) a glucanase. -
FIG. 30 is a chart illustrating the effect of glucanase on poultry BWF in experimental treatment. - Certain terminology is used in the following description for convenience only and is not limiting.
- “Synthetic nucleic acid sequence,” “synthetic polynucleotide,” “synthetic oligonucleotide,” “synthetic DNA,” or “synthetic RNA” as used herein refers to a nucleic acid sequence, a polynucleotide, an oligonucleotide, DNA, or RNA that differs from one found in nature by having a different sequence than one found in nature or a chemical modification not found in nature. This can include, but is not limited to, a DNA sequence created using biotechnology tools. Such tools include but are not limited to recombinant DNA technology, polymerase chain reaction (PCR), biotechnology mutagenesis techniques using PCR or recombination techniques including digestion and ligation of DNA, chemical mutagenesis techniques, chemical synthesis, or directed use of nucleases (so called “genome editing” or “gene optimizing” technologies).
- “Synthetic protein,” “synthetic polypeptide,” “synthetic oligopeptide,” or “synthetic peptide” as used herein refers to a protein, polypeptide, oligopeptide or peptide that was made through a synthetic process. The synthetic process can include, but is not limited, to chemical synthesis or recombinant technology. The synthetic process may include production of a protein, polypeptide, oligopeptide or peptide by expression of a synthetic nucleic acid sequence in a living cell or by in vitro expression using a cell-free extract.
- As used herein, “variant” refers to a molecule that retains a biological activity that is the same or substantially similar to that of the original sequence. The variant may be from the same or different species or be a synthetic sequence based on a natural or prior molecule.
- As used herein, “alignment” refers to a plurality of nucleic acid or amino acid sequences aligned lengthwise for visual identification of commonly shared nucleotides or amino acids. The percentage of commonly shared nucleotides or amino acid is related to homology or identity between sequences. An alignment may be determined by or used to identify conserved domains and relatedness between the sequences. An alignment may be determined by computer programs such as CLUSTAL 0 (1.2.1) (Sievers et al. (2011) Molecular Systems Biology 7: 539 doi: 10. 1038/msb.2011.75).
- The words “a” and “one,” as used in the claims and in the corresponding portions of the specification, are defined as including one or more of the referenced item unless specifically stated otherwise.
- In an embodiment, a synthetic nucleic acid encoding a glucanase is provided. The synthetic nucleic acid may include a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 1 [AGR2314], SEQ ID NO: 2 [AGR2414], and SEQ ID NO: 3 [AGR2514]. The encoded glucanase may be capable of degrading one or more polysaccharides.
- An embodiment includes a glucanase that includes a synthetic polypeptide having a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414], and SEQ ID NO: 6 [AGR2514]. The glucanase may be capable of degrading one or more polysaccharides. The glucanase may be modified for improved thermal stability.
- A glucanase modified for thermal stability can be produced by standard molecular biological techniques and then screened. The glucanase can be subjected to mutation and then screened for thermal stability. Screening systems that can be utilized include lambda phage, yeast, or other expression systems that allow production of the protein and/or testing of its physical and/or functional characteristics. From a population of modified proteins, candidates can be isolated and analyzed further. Further analysis may include DNA sequencing, functional assays, structural assays, enzyme activity assays, and monitoring changes in thermal stability, or structure in response to elevated temperature conditions.
- In an embodiment, a glucanase may be produced in a plant or plant tissue. The glucanase may be isolated from the plant or plant tissue.
- An embodiment includes a composition comprising, consisting essentially of, or consisting of one or more glucanases. The composition may be, but is not limited, to a transgenic plant including the one or more glucanases, an animal feedstock or animal feed additive including the one or more glucanases or an enzyme mixture including the one or more glucanases. A glucanase in the composition may be encoded by any one of the synthetic nucleic acids described herein. As used herein, the term “glucanase” refers to an enzyme capable of catalyzing the degradation or depolymerization of complex carbohydrates.
- A glucanase in the composition may be capable of degrading one or more of disaccharides, trisaccharides, and oligosaccharides into lower molecular weight saccharides. A glucanase in the composition may be capable of degrading one or more of cellooligosaccharide, lignocellulose, cellulose, hemicellulose, and pectin. A glucanase of the composition may act upon cellulose or mixed linkage beta glucans Some glucanases may have broader substrate specificities and may act on a wide range of carbohydrate polymers. A glucanase of the composition may have enzymatic activity on a range of carbohydrate polymers. Such enzymatic activit may be, but is not limited to, endoglucanase, exoglucanase, β-glucosidase, cellobiohydrolase, endo-1,4-β-xylanase, β-xylosidase, α-glucuronidase, α-L-arabinofuranosidase, acetylesterase, acetylxylanesterase, α-amylase, β-amylase, glucoamylase, pullulanase, β-glucanase, hemicellulase, arabinosidase, mannanase, pectin hydrolase, or pectate lyase activities. The glucanase of the composition may be capable of degrading one or more of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan. Assays for determining activity of a glucanase for degrading various substrates are known in the art. The beta-glucosidase assay, endocellulase assay, exocellulase (cellobiohydrolase) assay, amylase assay, endoxylanase assay, pectinase assay, 1,3-beta-glucosidase assay, 1,4-beta-glucosidase assay are described herein in Example 13.
- A glucanase of the composition may comprise, consist essentially of, or consist of an amino acid sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414] and SEQ ID NO: 6 [AGR2514].
- An embodiment includes a composition comprising, consisting essentially of, or consisting of an individual glucanase or a combination of two or more glucanases herein.
- In an embodiment, a glucanase of the composition may be a variant. Variants may include conservative amino acid substitutions; i.e., substitutions with amino acids having similar properties. Conservative substitutions may be a polar for polar amino acid (Glycine (G, Gly), Serine (S, Ser), Threonine (T, Thr), Tyrosine (Y, Tyr), Cysteine (C, Cys), Asparagine (N, Asn) and Glutamine (Q, Gln)); a non-polar for non-polar amino acid (Alanine (A, Ala), Valine (V, Val), Thyptophan (W, Trp), Leucine (L, Leu), Proline (P, Pro), Methionine (M, Met), Phenilalanine (F, Phe)); acidic for acidic amino acid (Aspartic acid (D, Asp), Glutamic acid (E, Glu)); basic for basic amino acid (Arginine (R, Arg), Histidine (H, His), Lysine (K, Lys)); charged for charged amino acids (Aspartic acid (D, Asp), Glutamic acid (E, Glu), Histidine (H, His), Lysine (K, Lys) and Arginine (R, Arg)); and a hydrophobic for hydrophobic amino acid (Alanine (A, Ala), Leucine (L, Leu), Isoleucine (I, Ile), Valine (V, Val), Proline (P, Pro), Phenylalanine (F, Phe), Tryptophan (W, Trp) and Methionine (M, Met)). Conservative nucleotide substitutions may be made in a nucleic acid sequence by substituting a codon for an amino acid with a different codon for the same amino acid. Variants may include non-conservative substitutions. A variant may have 40% glucanase activity in comparison to the unchanged glucanase. A variant may have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% activity, or an integer between any of the two values herein, in comparison to the unchanged glucanase.
- In an embodiment, the one or more proteins having less than 100% identity to its corresponding amino acid sequence of SEQ ID NOS: 4-6 is a variant of the referenced protein or amino acid. In an embodiment, an isolated protein, polypeptide, oligopeptide, or peptide having a sequence with at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a protein having the sequence of any one of SEQ ID NOS: 4-6 may be a less than full length protein having the sequence with at least 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity any one of SEQ ID NO: 4-6 along 6, 10 to 50, 10 to 100, 10 to 150, 10 to 300, 10 to 400, 10 to 500, 10 to 600, 10 to 700, 10 to 800, 10 to 900, or 10 to all amino acids of a protein. This list of sequence lengths encompasses every full length protein in SEQ ID NOS: 4-6 and every smaller length within the list, even for proteins that do not include over 400 amino acids. For example, the lengths of 6, 10 to 50, 10 to 100, 10 to 150, 10 to 300, 10 to 400, and 10 to all amino acids would apply to a sequence with 322 amino acids. A range of amino acid sequence lengths recited herein includes every length of amino acid sequence within the range, endpoints inclusive. The recited length of amino acids may start at any single position within a reference sequence where enough amino acids follow the single position to accommodate the recited length. The range of sequence lengths can be extended by increments of 10 to 100N amino acids, where N=an integer of ten or greater, for sequences of 1000 amino acids or larger. The fragment of the glucanase may be a subsequence of the polypeptides herein that retain at least 40% activity of the glucanase. The fragment may have 316, 317, or 322 amino acids. The fragments may include 20, 30, 40, 50, 100, 150, 200, or 300 contiguous amino acids. Embodiments also include nucleic acids encoding said amino acid sequences, and antibodies recognizing epitopes on said amino acid sequences.
- A less than full length amino acid sequence may be selected from any portion of one of the sequences of SEQ ID NOS: 4-6 corresponding to the recited length of amino acids. A less than full length amino acid sequence may be selected from a portion of any one of SEQ ID NOS: 4-6 having a catalytic domain. The fragment may include a catalytic domain of a glucanase. For example, the catalytic domain of the glucanase of SEQ ID NO: 4 [AGR2314] includes the following sequence:
-
(SEQ ID NO: 21) 10 20 30 40 -GVDPFERNKILGRGINIG ALEAPNEGDWGVVIKDEFFD 50 60 70 80 IIKEAGFSHVRIPIRWSTHAAFPPYKIEPSFFKRVDEVIN 90 100 110 120 GALKRGLAVVINI YEELMNDPEEHKERFLALWKQIADR 130 140 150 160 YKDYPETLFFEIL PHGNLTPEKWNELLEEALKVIRSID 170 180 190 200 KKHTVIIGTAEWGGISALEKLRVPKWEKNAIVTIHY NPF 210 220 230 240 EFT QGAE W VPGSEKWLGRKWGSPDDQKHLIEEFNFIEEW 250 260 270 280 SKKNKRPIYIG FGAYRKADLESRIKWTSFVVREAEKRGW 290 300 310 SWAY EFCSGFGVYDPLRK WNKDLLEALIGGDSIE - In the sequence of SEQ ID NO: 21, catalytic residues in active site are shown by enlarged characters in bold. Other active site residues that interact with the substrate are italicized, bold and underlined.
- For example, positions 136 and 253 in SEQ ID NO: 21 are catalytic residues in the active site, and a less than full length amino acid sequence selected from SEQ ID NO: 21 may include residues 134 and 135 at any two respective, consecutive positions within the recited length. A less than full length amino acid sequence may be selected from a portion of any one of SEQ ID NO: 21 may have other active site residues that interact with the substrate. For example, positions 20, 35, 36, 135, 198, 205, 210 and 286 of SEQ ID NO: 21 are the active site residues that interact with the substrate, and a less than full length amino acid sequence selected from SEQ ID NO: 21 may include
residues - A less than full length amino acid sequence may be selected from a portion of any one of SEQ ID NO: 21 may include amino acids 136-253. A less than full length amino acid sequence may possess the glucanase activity. A less than full length amino acid sequence may be capable of degrading polysaccharides. A less than full length amino acid sequence may contain those amino acids would contain the active site residues.
- A catalytic domain may be a conserved domain. A “conserved domain” herein refers to a region in a heterologous polynucleotide or polypeptide sequences where there is a relatively high degree of sequence identity between the distinct sequences. With respect to polynucleotides encoding a conserved domain is preferably at least 10 base pairs (bp) in length.
- A conserved domain of any one of polypeptides described herein refers to a domain within a glucanase that exhibits a higher degree of sequence identity High degree of sequence identity may be at least 50% identity, at least 55% identity, at least 60% identity, at least 65%, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or at least 100% identity to consecutive amino acid residues of a polypeptide described herein. Conserved domains may be identified as domains of identity to a specific consensus sequence. Conserved domains may be identified by using alignment methods. Conserved domain may be identified with multiple sequence alignments of related proteins. These alignments reveal sequence regions containing the same, or similar, patterns of amino acids. Multiple sequence alignments, three-dimensional structure and three-dimensional structure superposition of conserved domains can be used to infer sequence, structure, and functional relationships. Since the presence of a particular conserved domain within a polypeptide is highly correlated with an evolutionarily conserved function, a conserved domain database may be used to identify the amino acids in a protein sequence that are putatively involved in functions such as degrading polysaccharides, as mapped from conserved domain annotations to the query sequence. For example, the presence in a protein of a sequence of SEQ ID NO: 21 that is structurally and phylogenetically similar to one or more domains in the polypeptides of the accompanying Sequence Listing is a strong indicator of a related function in plants. Sequences herein referred to as functionally-related and/or closely-related to the sequences or domains of polypeptides having sequences of SEQ ID NOS: 4-6 may have conserved domains that share at least at least ten amino acids in length and at least 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95% or 96%, 97%, 98%, or at least 99%, or about 100% amino acid identity to the sequences of AGR2314, AGR2414 and AGR2514, and have similar functions that the polypeptides of the instant description.
- In an example, sequences of AGR2314, AGR2414, and AGR2514 may be aligned as shown below.
- AGR2414 sequence is a sequence of Thermotoga maritima Cel5A (3AMC in Protein Data Bank and in PubMed protein sequence database). Residues that interact with the substrate are underlined and are shown in enlarged bold characters: N20, H95, H96, N135, E136 (catalytic residue), Y198, H205, W210, E253 (catalytic residue), W286. (T. Wu et al. (2011), Biochim. Biophys. Acta 1814, 1.832-1840, which is incorporated herein by reference as if fully set forth). The numbering of these residues in AGR2514 is one higher because of the presence of one additional residue at the N-terminus in this sequence.
- In an example, the sequences of AGR2314 and AGR2414 have 305 residues conserved out of 317 residues and have 96% identity.
-
CLUSTAL O(1.2.1) multiple sequence alignment AGR2414 MGVDPFERNKILGRGINIG N ALEAPNEGDWGVVIKDEFFDIIKEAGFSHVRIPIRWSTHA AGR2314 MGVDPFERNKILGRGINIG N ALEAPNEGDWGVVIKDEFFDIIKEAGFSHVRIPIRWSTHA ************************************************************ AGR2414 YAFPPYKIMDRFFKRVDEVINGALKRGLAVVINI HH YEELMNDPEEHKERFLALWKQIAD AGR2314 QAFPPYKIEPSFFKRVDEVINGALKRGLAVVINI HH YEELMNDPEEHKERFLALWKQIAD ******* ************************************************* AGR2414 RYKDYPETLFFEIL NE PHGNLTPEKWNELLEEALKVIRSIDKKHTIIIGTAEWGGISALE AGR2314 RYKDYPETLFFEIL NE PHGNLTPEKWNELLEEALKVIRSIDKKHTVIIGTAEWGGISALE ********************************************:*************** AGR2414 KLSVPKWEKNSIVTIHY Y NPFEFT H QGAE W VEGSEKWLGRKWGSPDDQKHLIEEFNFIEE AGR2314 KLRVPKWEKNAIVTIHY Y NPFEFT H QGAEWVPGSEKWLGRKWGSPDDQKHLIEEFNFIEE ** *******:******************* ***************************** AGR2414 WSKKNKRPIYIG E FGAYRKADLESRIKWTSFVVREMEKRRWSWAY W EFCSGFGVYDTLRK AGR2314 WSKKNKRPIYIG E FGAYRKADLESRIKWTSFVVREAEKRGWSWAY W EFCSGFGVYDPLRK *********************************** *** *************** *** AGR2414 TWNKDLLEALIGGDSIE (SEQ ID NO: 5) AGR2314 QWNKDLLEALIGGDSIE (SEQ ID NO: 4) **************** - In an example, the sequences of AGR2414 and AGR2514 below have 310 residues conserved out of 318 residues and have 97% identity.
-
CLUSTAL O(1.2.1) multiple sequence alignment AGR2414 -MGVDPFERNKILGRGINIG N ALEAPNEGDWGVVIKDEFFDIIKEAGFSHVRIPIRWSTH AGR2514 MSGVDPFERNKILGRGINIG N ALEAPNEGDWGVVIKDEYFDIIKEAGFSHVRIPIRWSTH ************************************:********************* AGR2414 AYAFPPYKIMDRFFKRVDEVINGALKRGLAVVINIHHYEELMNDPEEHKERFLALWKQIA AGR2514 AQAFPPYKIEDRFFKRVDEVINGALKRGLAVVINQ HH YEELMNDPEEHKERFLALWKQIA * ****** ************************ ************************* AGR2414 DRYKDYPETLFFEIL NE PHGNLTPEKWNELLEEALKVIRSIDKKHTIIIGTAEWGGISAL AGR2514 DRYKDYPETLFFEIL NE PHGNLTPEKWNELLEEALKVIRSIDKKHTIIIGTAEWGGISAL ************************************************************ AGR2414 EKLSVPKWEKNSIVTIHY Y NPFEFT H QGAE W VEGSEKWLGRKWGSPDDQKHLIEEFNFIE AGR2514 EKLRVPKWEKNAIVTIHY Y NPFEFT H QGAE W VEGSEKWLGRKWGSPDDQKHLIEEFNFIE *** *******:*********************************************** AGR2414 EWSKKNKRPIYIG E FGAYRKADLESRIKWTSFVVREMEKRRWSWAY W EFCSGFGVYDTLR AGR2514 EWSKKNKRPIYIG E FGAYRKADLESRIKWTSFVVREAEKRRWSWAY W EFCSGFGVYDTLR ************************************ *********************** AGR2414 KTWNKDLLEALIGGDSIW (SEQ ID NO: 5) AGR2514 KTWNKDLLEALIGGDSIE (SEQ ID NO: 6) ****************** - In an example, the sequences of AGR2314 and AGR2514 have 308 residues conserved out of 318 residues and have 97% identity.
-
CLUSTAL O(1.2.1) multiple sequence alignment AGR2314 -MGVDPFERNKILGRGINIG N ALEAPNEGDWGVVIKDEFFDIIKEAGFSHVRIPIRWSTH AGR2514 MSGVDPFERNKILGRGINIG N ALEAPNEGDWGVVIKDEYFDIIKEAGFSHVRIPIRWSTH ************************************:********************* AGR2314 AQAFPPYKEIPSFFKRVDEVINGALKRGLAVVINI HH YEELMNDPEEHKERFLALWKQIA AGR2514 AQAFPPYKIEDRFFKRVDEVINGALKRGLAVVINQ HH YEELMNDPEEHKERFLALWKQIA ********** ********************** ************************ AGR2314 DRYKDYPETLFFEIL NE PHGNLTPEKWNELLEEALKVIRSIDKKHTVIIGTAEWGGISAL AGR2514 DRYKDYPETLFFEIL NE PHGNLTPEKWNELLEEALKVIRSIDKKHTIIIGTAEWGGISAL *********************************************:************* AGR2314 EKLRVPKWEKNAIVTIHY Y NPFEFT H QGAE W VPGSEKWLGRKWGSPDDQKHLIEEFNFIE AGR2514 EKLRVPKWEKNAIVTIHY Y NPFEFT H QGAE W VEGSEKWLGRKWGSPDDQKHLIEEFNFIE ******************************* *************************** AGR2314 EWSKKNKRPIYIG E FGAYRKADLESRIKWTSFVVREAEKRGWSWAY W EFCSGFGVYDPLR AGR2514 EWSKKNKRPIYIG E FGAYRKADLESRIKWTSFVVREAEKRRWSWAY W EFCSGFGVYDTLR **************************************** *************** ** AGR2314 KQWNKDLLEALIGGDSIE (SEQ ID NO: 4) AGR2514 KTWNKDLLEALIGGDSIE (SEQ ID NO: 6) * **************** - Sequences that possess or encode for conserved domains that meet these criteria of percentage identity, and that have comparable biological and regulatory activity to the present polypeptide sequences, thus being glucanases, described herein. Sequences having lesser degrees of identity, but comparable biological activity, are considered to be equivalents.
- The functionality of a glucanase, variants, or fragments thereof, may be determined using any methods. The functionality of a glucanase may be measured by any one of the assays described in Example 3.
- Any one or more glucanases herein may be expressed in a plant upon introduction into the plant genome of any one more of synthetic nucleic acids described herein. The methods of introduction of synthetic nucleic acids into the plants are known in the art. The method may be transformation of the plant with a vector that includes synthetic nucleic acids.
- In an embodiment, a synthetic polynucleotide having a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of SEQ ID NO: 7 [pAG4258], SEQ ID NO: 8 [pAG4588], SEQ ID NO: 9 [pAG4597], SEQ ID NO: 10 [pAG4708], SEQ ID NO: 11 [pAG4766], SEQ ID NO: 12 [pAG4767], SEQ ID NO: 13 [pAG4770], SEQ ID NO: 14 [pAG4771], SEQ ID NO: 15 [pAG4257], SEQ ID NO: 16 [pAG4692], SEQ ID NO: 17 [pAG4693], SEQ ID NO: 18 [pAG4705] and SEQ ID NO: 19 [pAG4706] is provided. The synthetic polynucleotide may include any one of the synthetic nucleic acids described herein that encode glucanase and that are capable of degrading a polysaccharide.
- In an embodiment, a vector is provided. The vector may include any one of the synthetic polynucleotides or nucleic acids described herein.
- In an embodiment, synthetic nucleic acids are provided having a sequence as set forth in any one of the nucleic acids listed herein or the complement thereof. In an embodiment, isolated nucleic acids having a sequence that hybridizes to a nucleic acid having the sequence of any nucleic acid listed herein or the complement thereof are provided. In an embodiment, the hybridization conditions are low stringency conditions. In an embodiment, the hybridization conditions are moderate stringency conditions. In an embodiment, the hybridization conditions are high stringency conditions. The hybridization may be along the length of the synthetic nucleic acid. Examples of hybridization protocols and methods for optimization of hybridization protocols are described in the following publications: Molecular Cloning, T. Maniatis, E. F. Fritsch, and J. Sambrook, Cold Spring Harbor Laboratory, 1982; and, Current Protocols in Molecular Biology, F. M. Ausubel, R. Brent, R. E. Kingston, D. D. Moore, J. G. Seidman, J. A. Smith, K. Struhl,
Volume 1, John Wiley & Sons, 2000 (standard protocol) and Amersham Gene Images AlkPhos Direct Labeling and Detection System (GE Healthcare UK, Ltd), which are incorporated by reference in their entirety as if fully set forth. - In an AlkPhos Direct Labeling and Detection System, moderate conditions may be as follows: membranes loaded with DNA samples are prehybridized for at least 15 minutes at 55° C. in the hybridization buffer (12% (w/v) urea, 0.5M NaCl, 4% (w/v) blocking reagent). The labeled probe is added to the same solution and hybridization is carried overnight at 55° C. The membranes are washed for 10 minutes at 55° C. in the primary wash solution (2M urea, 0.1% (W/v) SDS, 50 mM of 0.5M Na phosphate pH 7.0, 150 mM NaCl, 1 mM of 1.0 M Mg Cl2 and 0.2% (w/v) of blocking reagent). The washing procedure is repeated. The membranes are placed in a clean container and washed for 5 minutes in a secondary buffer (1M Tris base, and 2M NaCl). The washing in the secondary solution is performed two more time. Chemoluminescence was detected using CDP-STAR® substrate for alkaline phosphatase. Low stringency refers to hybridization conditions at low temperatures, for example, between 37° C. and 60° C. High stringency refers to hybridization conditions at high temperatures, for example, over 68° C.
- In the standard protocol, moderate conditions may be as follows: filters loaded with DNA samples are pretreated for 2-4 hours at 68° C. in a solution containing 6×citrate buffered saline (SSC; Amresco, Inc., Solon, Ohio), 0.5% sodium dodecyl sulfate (SDS; Amresco, Inc., Solon, Ohio), 5×Denhardt's solution (Amresco, Inc., Solon, Ohio), and denatured salmon sperm (Invitrogen Life Technologies, Inc. Carlsbad, Calif.). Hybridization is carried in the same solution with the following modifications: 0.01 M EDTA (Amresco, Inc., Solon, Ohio), 100 μg/ml salmon sperm DNA, and 5-20×106 cpm 32P-labeled or fluorescently labeled probes. Filters are incubated in hybridization mixture for 16-20 hours and then washed for 15 minutes in a solution containing 2×SSC and 0.1% SDS. The wash solution is replaced for a second wash with a solution containing 0.1×SSC and 0.5% SDS and incubated an additional 2 hours at 20° C. to 29° C. below Tm (melting temperature in ° C.). Tm=81.5+16.61 Log10[Na+]/(1.0+0.7[Na+]))+0.41(%[G+C])−(500/n)−P-F. [Na+]=Molar concentration of sodium ions. %[G+C]=percent of G+C bases in DNA sequence. N=length of DNA sequence in bases. P=a temperature correction for % mismatched base pairs (1° C. per 1% mismatch). F=correction for formamide concentration (=0.63° C. per 1% formamide). Filters are exposed for development in an imager or by autoradiography. Low stringency conditions refers to hybridization conditions at low temperatures, for example, between 37° C. and 60° C., and the second wash with higher [Na+] (up to 0.825M) and at a
temperature 40° C. to 48° C. below Tm. High stringency refers to hybridization conditions at high temperatures, for example, over 68° C., and the second wash with [Na+]=0.0165 to 0.0330M at atemperature 5° C. to 10° C. below Tm. In an embodiment, synthetic nucleic acids having a sequence that has at least 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identity along its length to a contiguous portion of a nucleic acid having any one of the sequences set forth herein or the complements thereof are provided. The contiguous portion may be the entire length of a sequence set forth herein or the complement thereof. - In an embodiment a synthetic nucleic acid may encode the fragment of a glucanase that have 316, 317, or 322 amino acids. The synthetic nucleic acids may encode the fragments that include 20, 30, 40, 50, 100, 150, 200, or 300 contiguous amino acids and retain at least 40% activity of the glucanase. The functionality of a glucanase, variants, or fragments thereof, may be determined using any methods. The functionality of a glucanase may be measured by any one of the assays described in Example 3.
- Determining percent identity of two amino acid sequences or two nucleic acid sequences may include aligning and comparing the amino acid residues or nucleotides at corresponding positions in the two sequences. If all positions in two sequences are occupied by identical amino acid residues or nucleotides then the sequences are said to be 100% identical. Percent identity can be measured by the Smith Waterman algorithm (Smith T F, Waterman M S 1981 “Identification of Common Molecular Subsequences,” Journal of Molecular Biology 147: 195-197, which is incorporated by reference in its entirety as if fully set forth).
- In an embodiment, synthetic nucleic acids, polynucleotides, or oligonucleotides are provided having a portion of the sequence as set forth in any one of the nucleic acids listed herein or the complement thereof. These isolated nucleic acids, polynucleotides, or oligonucleotides are not limited to but may have a length in the range from 10 to full length, 10 to 800, 10 to 10 to 600, 10 to 500, 10 to 400, 10 to 300, 10 to 200, 10 to 100, 10 to 90, 10 to 80, 10 to 70, 10 to 60, 10 to 50, 10 to 40, 10 to 35, 10 to 30, 10 to 25, 10 to 20, 10 to 15, or 20 to 30 nucleotides or 10, 15, 20 or 25 nucleotides. A synthetic nucleic acid, polynucleotide, or oligonucleotide having a length within one of the above ranges may have any specific length within the range recited, endpoints inclusive. In an embodiment, a hybridization probe or primer is 85 to 100%, 90 to 100%, 91 to 100%, 92 to 100%, 93 to 100%, 94 to 100%, 95 to 100%, 96 to 100%, 97 to 100%, 98 to 100%, 99 to 100%, or 100% complementary to a nucleic acid with the same length as the probe or primer and having a sequence chosen from a length of nucleotides corresponding to the probe or primer length within a portion of a sequence as set forth in any one of the nucleic acids listed herein. In an embodiment, a hybridization probe or primer hybridizes along its length to a corresponding length of a nucleic acid having the sequence as set forth in any one of the nucleic acids listed herein. In an embodiment, the hybridization conditions are low stringency. In an embodiment, the hybridization conditions are moderate stringency. In an embodiment, the hybridization conditions are high stringency.
- In an embodiment, a transgenic plant comprising a synthetic nucleic acid encoding any one or more of the glucanases described herein is provided. The one or more glucanases expressed in the transgenic plant herein may have activity at a pH ranging from 2.0 to 10.00. The pH may be 2.0, 3.0, 4.0, 5.0, 5.5, 6.0, 7.0, 7.5, 8.0, 9.0, 9.5, or 10, or a pH within a range between any two of the foregoing pH values (endpoints inclusive). The one or more glucanases expressed in a transgenic plant herein may have activity when exposed to a temperature in the range of 25° C. to 130° C., endpoints inclusive. The temperature may be 25° C., 30° C., 35° C., 40° C., 45° C., 50° C., 55° C., 65° C., 70° C., 75° C., 80° C., 85° C., 90° C., 95° C., 100° C., 105° C., 110° C., 115° C., 120° C., 125° C., 130° C., 25° C., to 30° C., 25° C. to 35° C., 25° C. to 40° C., 25° C. to 45° C., 25° C. to 50° C., 25° C. to 55° C., 25° C. to 60° C., 25° C. to 65° C., 25° C. to 70° C., 25° C. to 75° C., 25° C. to 80° C., 25° C. to 85° C., 25° C. to 90° C., 25° C. to 95° C., 25° C. to 100° C., 25° C. to 105° C., 25° C. to 110° C., 25° C. to 115° C., 25° C. to 120° C., 25° C. to 125° C., or less than 130° C. The glucanase expressed in the transgenic plant may have the improved activity compared to the glucanase having an identical amino acid sequence but expressed in a bacterial cell. The glucanase may have improved thermal stability compared to the activity of the glucanase expressed in the bacterial cell.
- The one or more glucanase may be produced in any transgenic plant. The transgenic plant may be but is not limited to wheat, maize, soybean, barley, and sorghum.
- In an embodiment, a method of making a transgenic plant that includes a glucanase is provided. The method may include contacting a plant cell with any one of the synthetic nucleic acids herein. The synthetic nucleic acids may be part of any one of the vectors described herein. The vector may include a synthetic nucleic acid encoding a glucanase. The glucanase may comprise, consist essentially of, or consist of an amino acid sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414] and SEQ ID NO: 6 [AGR2514]. The method may also include regenerating a transgenic plant from the transgenic plant cell. The method may include selecting the transgenic plant expressing a glucanase.
- The transgenic plant herein is also referred to as an “event.” An event is characterized by presence of the transgene comprising a synthetic nucleic acid encoding a glucanase. The term “event” also refers to the genomic region of the transformed parent comprising the inserted synthetic nucleic acid sequence and the parent genomic sequences flanking the insertion. The term “event” also refers to progeny produced by crossing of the transgenic plant and a non-transgenic plant of the same genetic background. The term “line” also refers to progeny produced by crossing of the transgenic plant and a non-transgenic plant with any genetic background. After repeated crosses, the transgene and the flanking sequences of the originally transformed parent may be present in a progeny plant in the same location in the genome or on the same chromosome as in the transformed parent.
- The transgenic plant may be homozygous for the transgene comprising a synthetic nucleic acid encoding a glucanase.
- The transgenic plant may be hemizygous for the transgene comprising a synthetic nucleic acid encoding a glucanase. To produce homozygous plants expressing a glucanase, a hemizygous transgenic plant may be self-crossed. Progeny may be obtained from such crosses. The progeny may include homozygous, hemizygous and wild type plants. A hemizygous plant may be phenotypically indistinguishable from the wild type plants. The method may include analyzing the progeny for the presence of the transgene and selecting a progeny plant that includes the transgene. A method of identifying the homozygous event by PCR is described herein in Example 8.
- In an embodiment, the method may further include crossing a hemizygous transgenic plant to another transgenic plant hemizygous for the same transgene. The method may include selecting a first progeny plant that is homozygous for the transgene. The method may further include crossing the transgenic plant to a wild type plant of the same, or different, genetic background. Progeny may be obtained from such crosses. The progeny may include hemizygous and wild type plants. The method may include selecting a first progeny plant that is hemizygous for the transgene. The method may further include selfing the first hemizygous progeny plant and selecting a second progeny plant that is homozygous for the transgene comprising a synthetic nucleic acid sequence encoding a glucanase.
- The glucanase may have activity and improved thermal stability when exposed to high temperatures as here described.
- It has been unexpectedly discovered that expression and accumulation of an enzyme in a plant provides the enzyme with additional thermal stability relative to the same enzyme that is produced microbially.
- In an embodiment, the method of making a transgenic plant includes transformation. For transformation, the nucleic acid may be introduced into a vector. Suitable vectors may be cloning vectors, transformation vectors, expression vectors, or virus-based vectors. The expression cassette portion of a vector may further include a regulatory element operably linked to a nucleic acid encoding a glucanase. In this context, operably linked means that the regulatory element imparts its function on the nucleic acid. For example, a regulatory element may be a promoter, and the operably linked promoter would control expression of the nucleic acid.
- The expression of a nucleic acid encoding a glucanase from the expression cassette may be under the control of a promoter which provides for transcription of the nucleic acid in a plant. The promoter may be a constitutive promoter or, tissue specific, or an inducible promoter. A constitutive promoter may provide transcription of the nucleic acid throughout most cells and tissues of the plant and during many stages of development but not necessarily all stages. An inducible promoter may initiate transcription of the nucleic acid sequence only when exposed to a particular chemical or environmental stimulus. A tissue specific promoter may be capable of initiating transcription in a particular plant tissue. Plant tissue may be, but is not limited to, a stem, leaves, trichomes, anthers, cob, seed, endosperm, or embryo. The constitutive promoter may be, but is not limited to the maize ubiquitin promoter (ZmUbil), Cauliflower Mosaic Virus (CAMV) 35S promoter, the Cestrum Yellow Leaf Curling Virus promoter (CMP), the actin promoter, or the Rubisco small subunit promoter. The tissue specific promoter may be the maize globulin promoter (ZmGlb1), the rice glutelin promoter (prGTL), the maize zein promoter (ZmZ27), or the maize oleosin promoter (ZmOle). The promoter may provide transcription of a synthetic polynucleotide having a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of SEQ ID NO: 7 [pAG4258], SEQ ID NO: 8 [pAG4588], SEQ ID NO: 9 [pAG4597], SEQ ID NO: 10 [pAG4708], SEQ ID NO: 11 [pAG4766], SEQ ID NO: 12 [pAG4767], SEQ ID NO: 13 [pAG4770], SEQ ID NO: 14 [pAG4771], SEQ ID NO: 15 [pAG4257], SEQ ID NO: 16 [pAG4692], SEQ ID NO: 17 [pAG4693], SEQ ID NO: 18 [pAG4705] and SEQ ID NO: 19 [pAG4706] and expression of glucanase that is capable of degrading a polysaccharide.
- In an embodiment, the transformation in the method of making a transgenic plant may be stable transformation, wherein the nucleic acid encoding the glucanase integrates into the genome of the transformed plant. The transformation may be Agrobacterium-mediated transformation using a vector suitable for stable transformation described herein. The method of making a transgenic plant may include any other methods for transforming plants, for example, particle bombardment, or protoplast transformation via direct DNA uptake. The transgenic plant may include any synthetic nucleic acid, amino acid sequence, or vector herein.
- In an embodiment, the method of making a transgenic plant may include transient transformation to transiently express the recombinant protein. The term “transient expression” refers to the expression of an exogenous nucleic acid molecule delivered into a cell: e.g., a plant cell, and not integrated in the plant's cell chromosome. Expression from extra-chromosomal exogenous nucleic acid molecules can be detected after a period of time following a DNA-delivery. Virus-based vectors may be used to carry and express exogenous nucleic acid molecules. Virus-based vectors may replicate and spread systemically within the plant. Use of virus based vectors may lead to very high levels of glucanase accumulation in transgenic plants.
- Methods of making a transgenic plant, methods of increasing utilization of non-starch polysaccharides in an animal, methods for enhancing production of fermentable sugars from grains, methods for increasing metabolizable energy of a diet, methods preparing and animal feedstock and methods for producing genetically engineered plants homozygous for a synthetic nucleic acid that encodes a glucanase may comprise a method of detection herein as part of making transgenic plants and/or identifying plants, plant biomass or animal feed that comprise a synthetic nucleic acid herein.
- An embodiment comprises a kit for identifying maize event 4588.259, 4588.757 or 4588.652 in a sample. The kit may comprise a first primer and a second primer.
- The first primer and the second primer may be capable of amplifying a target sequence specific to an event. The target sequence may include a nucleic acid with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from SEQ ID NOS: 51-55. The target sequence may be a sequence included in a junction between a genomic sequence of a transformed plant and a sequence of the T-DNA insertion. The target sequence may be included in a sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from SEQ ID NOS: 22-31.
- The kit may comprise the first primer comprising a nucleic acid sequence selected from SEQ ID NOS: a nucleic acid sequence selected from SEQ ID NOS: 38, 41, and 47. The kit may comprise the second primer comprising a nucleic acid sequence selected from SEQ ID NOS: 39, 42, 43, 45, and 46. The kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 38 and the second primer comprising the nucleic sequence of SEQ ID NO: 39. The kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 41 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 42. The kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 41 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 43. The kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 47 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 45. The kit may comprise the first primer comprising the nucleic acid sequence of SEQ ID NO: 47 and the second primer comprising the nucleic acid sequence of SEQ ID NO: 46. The first primer and the second primer may be capable of amplifying the target sequence to produce an amplified product. The amplified product or the target sequence may be capable of hybridizing to the sequence of the nucleic acid comprising a sequence of SEQ ID NO: 40, or SEQ ID NO: 44 under conditions of high stringency. The target sequence may be used as a probe for diagnosing any one of the events described herein.
- A sample may include any sample in which nucleic acids from plant matter are present. A sample may be a protein sample. A protein sample may include any sample in which proteins from plant matter are present. The sample or protein sample may include any plant matter. The plant matter may derive from a plant or part thereof. The plant material may derive from an animal feed or food.
- In an embodiment, a method of identifying maize event 4588.259, 4588.757 or 4588.652 in a sample is provided. The method may include contacting a sample with a first primer and a second primer. The method may include amplifying a synthetic polynucleotide comprising a target sequence specific to the maize event. The target sequence may be any target sequence described herein. The first primer and the second primer may be capable of amplifying the target sequence to produce an amplified product. The amplified product may be used to determine whether a plant resulted from a sexual crossing or selfing contains one or more of the target sequences and diagnose specific events. The length of the amplified product from the sample of the maize event may differ from the length of the amplified product from the sample of wild type plant of the same genetic background. The amplified product from the event sample may be further used as probe that hybridizes to a synthetic polynucleotide comprising a specific region encoding a glucanase under conditions of high stringency. The method may include further detecting hybridization of the at least one probe to the specific region of the target sequence.
- In an embodiment, an animal feedstock comprising any one or more of the transgenic plants described herein or parts of the transgenic plants is provided. The term “animal feedstock” refers to any food, feed, feed composition, diet, preparation, additive, supplement, or mixture suitable and intended for intake by animals for their nourishment, maintenance, or growth. The glucanases included in the transgenic plants and in the animal feedstock may be active in the gastrointestinal or rumen environment of animals. The animal may be a monogastric animal. The animal may be a ruminant animal. The monogastric animal may be but is not limited to a chicken, a turkey, a duck, a swine, a fish, a cat, or a dog. The ruminant animal may be but is not limited to cattle, a cow, a steer, a sheep, or a goat. The glucanases may be active after preparation of the animal feed. The temperatures which feeds are exposed to during ensiling may be within range of 20° C. to 70° C. The temperatures which feeds are exposed to during pelleting may be within range of 70° C. to 130° C. The glucanases may have improved thermal stability and may retain activity after being exposed to high temperatures during feed pelleting. The glucanase with improved thermal stability may comprise, consist essentially of, or consist of an amino acid sequence with at least 70, 72, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to a reference sequence selected from the group consisting of: SEQ ID NO: 4 [AGR2314], SEQ ID NO: 5 [AGR2414] and SEQ ID NO: 6 [AGR2514].
- In an embodiment, a glucanase may be isolated from the transgenic plant prior to being included into the animal feedstock. The glucanase may be any one of the glucanases described herein.
- In an embodiment, the animal feedstock may further include a feed supplement. The feed supplement may be any plant material. The plant material may be a non-transgenic plant or a part thereof. The plant material may include an engineered plant or a mutant plant. The feed supplement may be a mineral. The mineral may be a trace mineral. The mineral may be a macro mineral. The feed supplement may be at least one vitamin. The at least one vitamin may be a fat-soluble vitamin. The feed supplement may include one or more exogenous enzymes. The one or more exogenous enzymes may include a hydrolytic enzyme. The hydrolytic enzyme. The hydrolytic enzyme may be an enzyme classified under EC3.4 as hydrolase. The hydrolytic enzymes may be but are not limited to xylanases, mannanases, carbohydrases, proteases, peptidases, phytases, cellulases, lipases, phospholipases, pectinases, galactosidases, laccases, amylases, hemicellulases, or cellobiohydrolases. The hydrolytic enzymes may be expressed in the engineered plants or parts thereof included in the feed supplement. The feed supplement may include purified hydrolytic enzymes. The feed supplements may be but are not limited to growth improving additives, coloring agents, flavorings, stabilizers, limestone, stearine, starch, saccharides, fatty acids, or a gum. The coloring agents may be carotenoids. The carotenoids may be but are not limited to cantaxanthin, beta-carotene, astaxanthin, or lutein. The fatty acids may be polyunsaturated fatty acids. The polyunsaturated fatty acids may include but are not limited to arachidonic acid, docosohexaenoic acid (DHA), eicosapentaenoic acid (EPA) or gamma-linoleic acid. The feed supplement may be a non-transgenic plant or a part thereof. The non-transgenic plant or part thereof may include at least one component selected from the group consisting of: barley, wheat, rye, oat, corn, rice, triticale beet, sugar beet, spinach, cabbage, quinoa, corn meal, corn pellets, corn oil, distillers grains, forage, wheat meal, wheat pellets, wheat grain, barley grain, barley pellets, soybean meal, soybean oilcake, lupin meal, rapeseed meal, sorghum grain, sorghum pellets, rapeseed, sunflower seed, and cotton seed.
- The feed supplement may include at least one component selected from the group consisting of: soluble solids, fat, vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, monensin sodium COBAN® PREMIX, vitamin premix, inorganic feed phosphates, monocalcium phosphate, dicalcium phosphate, tricalcium phosphate, monodicalcium phosphate, rock phosphate, selenium premix, choline chloride, sodium chloride, and mineral premix.
- The feed supplement may include fish meal, fish oil, bone meal, feather meal and animal fat. The feed supplement may include yeast or yeast extract.
- In an embodiment, a method of producing an animal feedstock is provided. The method may comprise including a transgenic plant that includes any one or more glucanase described herein in the animal feedstock. The animal feedstock may comprise, consist essentially of or consist of the transgenic plant. The method may further include combining the transgenic plant with a feed supplement. The feed supplement may be a non-transgenic plant or a part thereof. The transgenic plant may be produced by any one of the methods described herein. The feed supplement may be a mineral. The supplement may include one or more exogenous enzymes. The exogenous enzymes may be but are not limited to xylanases, mannanases, carbohydrases, proteases, peptidases, phytases, cellulases, lipases, phospholipases, pectinases, galactosidases, laccases, amylases, hemicellulases, or cellobiohydrolases.
- In an embodiment, a method of meat production is provided. The method may include feeding an animal feedstock or one produced by any of the methods described herein to the animal. The method may include preparing an animal feedstock that includes a transgenic plant expressing a glucanase.
- In an embodiment, a method of feeding an animal is provided. The method may include feeding an animal feedstock or one produced by any of the methods described herein to the animal. The method may include preparing an animal feedstock that includes a transgenic plant expressing a glucanase.
- In an embodiment, a method of increasing utilization of non-starch polysaccharides in an animal is provided. The method may include feeding an animal with an animal feedstock that includes any one or more of the transgenic plants described herein. The method may include preparing the animal feedstock.
- In an embodiment, a method of decreasing gastrointestinal viscosity in an animal is provided. The method may include feeding an animal with an animal feedstock that includes any one or more of the transgenic plants described herein. The method may include preparing the animal feedstock.
- Addition of exogenous enzymes collectively known as carbohydrases may ameliorate the effects of non-starch polysaccharides (NSPs) in the diet of an animal. An animal feedstock that includes any one or more of glucanases described herein may increase utilization of NSPs by the animal that ingested the feedstock, or may decrease the anti-nutritional effects of the NSP on the animal that ingested the feedstock, and improve growth of the animal. Preparing the animal feedstock may include combining one or more transgenic plant herein with any other feed supplement. The glucanase may be isolated, purified and added to the animal feedstock as a pure glucanase. The glucanase may be added to the animal feedstock in admixture with other feed supplements. The transgenic plant including the glucanase or the purified glucanase may be combined with other feed supplements to form premixes.
- An animal feedstock may be produced as mash feed. The animal feedstock may be produced as pellets. The milled feed stuffs may be mixed with the premix that includes any one of the transgenic plants that include a glucanase. The milled feed stuffs may include the plant material and the feed supplements described herein. The feed supplements may include one or more exogenous enzymes described herein. Enzymes may be added as liquid or solid formulations. For mash feed, a solid or liquid enzyme formulation may be added before or during the mixing step. For pelleted feed, the enzyme preparation may be added before or after the pelleting step. The glucanase may be included in a premix. The premix may also include vitamins and trace minerals. Macro minerals may be added separately to animal feedstock.
- In an embodiment, a method of increasing metabolizable energy of a diet is provided. Metabolizable energy (ME) refers to the net energy of a diet or feed that is available to an animal after the utilization of some energy in the processes of digestion and absorption and the loss of some of the material as being undigested or indigestible. Metabolizable energy may be apparent metabolizable energy (AME) measured as the difference between the calories of the feed consumed by an animal and excrements collected after feed consumption. Metabolizable energy may be true metabolizable energy (TME), which is similar to AME except that it also takes into account endogenous energy. Energy contents in a diet or feed ingredients may be determined using one of several methodologies (NRC. 1994. Nutrient Requirements of Poultry. 9th rev. ed. Natl. Acad. Press, Washington, D.C., which is incorporated herein by reference as if fully set forth). Gross energy (GE) is direct measurement using an adiabatic bomb calorimeter, which measures the heat of combustion of a sample within a high oxygen atmosphere. Apparent digestible energy (DE) is GE of a feed or feedstuff minus GE of feces only. Apparent metabolizable energy (AME) is GE of a feed or feedstuff minus GE of feces, urine, and gaseous products from digestion. For poultry, the gaseous release is very low, and typically neglected due to its very small value, and the urine and feces are excreted together and are not collected separately in most cases. True metabolizable energy (TME) accounts for only the GE from excreta that is from the feed or feedstuff origin, by subtracting the endogenous energy loss from non-feed origin (i.e. sloughing of intestinal tract cells). Another energy measurement used for feedstuffs in animals is net energy (NE) which adjusts for heat increment. Since heat increment is dependent on level of productivity, which fluctuates in poultry because of short lifespan, this variable is not frequently used in poultry.
- The TME rooster assay may be used to account for endogenous (non-feed) losses of GE by including a fasted rooster and collecting excreta to correct the GE from the fed (feed/feedstuff) rooster. See Sibbald, 1976, Poultry Science 55: 303-308, which is incorporated herein by reference as if fully set forth. This assay has commonly been used for determining TME of individual feedstuffs rather than complete feed, and requires cecetomized roosters (ceca surgically removed) to always be on hand. The assay involves force-feeding (into the crop) a known quantity of an ingredient (in birds that were previously fasted 24-48 hr) and then collect feces for a 24-48 hour period. The equation used to calculate TME is given as TME={(GEf×FI)−[(GEe×EO)+−(GEe×EO)−]}/FI, where Gross Energy (GE) is determined by bomb calorimetry in kcal/kg; FI is feed intake (kg); EO is excreta output fed birds (kg); GEe is the Gross Energy of the excreta content; GEf is the Gross Energy of the feed; “k” signifies the quantity is from the fed birds energy output; and “−” signifies that the quantity is from the fasted birds energy output. The roosters (or turkeys) used in TME assays are adult birds with a fully developed digestive tract. Research has shown that there are differences in ME determinations using roosters (layer breeds), turkeys and broilers when analyzing same feed ingredients (Cozannet et al, 2010 J. Anim, Sci., 88(7):2382-2392, which is incorporated herein by reference as if fully set forth). So determining TME or AME using rooster model may not be equivalent to what is observed in a young broiler, but is a commonly used proxy in research and industry.
- For broilers, the AME assay may be used for determining complete feed and some energy supplying feedstuffs, as well as the effect from adding feed ingredients that aid in digestion. There are two common methods for determining ME: 1) doing a total excreta collection and weighing and record feed consumption during the time period (
Equation 1 below) or 2) using an indigestible marker in feed (chromic oxide, titanium oxide or acid insoluble ash) and taking a subsample of feces with no weighing required (Equation 2 below). The marker method of AME determination may be used, in which no weighing of feed consumption or total fecal collection and no need to separate feed spilled from feces pan are required. With the marker method, birds are fed the marker for at least two days (but preferably five or more days). Feces are collected over several days (e.g., three days) with daily collection composited into one sample. - AME using the total collection method (Equation 1) is calculated as follows:
-
AME=[(GE f ×FI)−(GE e ×EO)]/FI, - where Gross Energy (GE) is measured in bomb calorimetry (kcal/kg); FI is feed intake (kg); EO is excreta output (kg); e refers to excreta content; and f refers to the feed content. AME using the marker method is calculated as AME=[(GEe/Me)−(GEf/Mf)]/(GEe/Me), where Gross Energy is GE (kcal/kg); M is the marker (ppm or %); “e”=excreta content; “f”=feed content.
- Another method that may be used to determine AME of feed when investigating feed additives that aid in digestion is Ileal digestible energy (IDE). This method uses the AME marker method (described above), but the birds are euthanized and a section of ileum excised and contents removed, dried and analyzed for GE and the marker. The IDE method may be used effectively for testing and comparing feed additives used to improve digestion/absorption of feed energy. The benefit of IDE, is no cages with collection pans are required and can collect during a floor-pen study. With the marker method, birds are fed the marker for at least two days (and preferably five or more days).
- AME using the IDE marker method (Equation 2) is calculated as follows:
-
AME=GE f−(GE d ×M f /M d), - where GE (kcal/kg); M represents the marker; “d” represents the digesta content; and “f” signifies the feed content.
- AME and TME may be corrected for nitrogen retention (AMEn and TMEn). To adjust, the grams of N are multiplied by 8.22 kcal/g (GE of uric acid; primary excretory product of protein tissue oxidized for energy), which also is subtracted off of the GE consumed. See Hill, F. W., and D. L. Anderson, 1958, “Comparison of metabolizable energy and productive energy determinations with growing chicks.” J. Nutr. 64:587-603, which is incorporated herein by reference as if fully set forth. Calculations for total collection of marker method for AMEn are shown in
Equation 3 andEquation 4 below, respectively. Equation 3: AMEn, total collection: -
AMEn={(GE f ×FI)−(GE e ×EO)−[8.22×(N f −N e)]}/FI, - where GE=kcal/kg; FI=feed intake (kg); EO=excreta output (kg); N=nitrogen (g); e=excreta content; f=feed content.
- Equation 4: IDEn, marker method:
-
AMEn=GE f−(GE d ×M f /M d)−{8.22×[N f−(Nd×M f /M d)]}, - where GE=kcal/kg; M=marker; N=nitrogen (g/kg) “d”=digesta content; “f”=feed content.
- While the TME method may be used for determining ME of individual ingredients, the AME (IDE) method may be used with broilers to measure ME in individual ingredients or total diet and testing effects improving ME by use of enzymes or other feed additives.
- A diet or feed may include any feed ingredient or mixture of ingredients including water. The diet may be any food, feed, feed composition, diet, preparation, additive, supplement, or mixture included in an animal feedstock described herein. The diets are known in the art and described at least in the following publications: Nutrient Requirements of Poultry, 1994, National Research Council, National Academy Press, Washington, D.C.; Broiler Performance and Nutrition Supplement, Cobb-500™, L-2114-07EN, July, 2015; Broiler Performance and Nutrition Supplement, Cobb-700™, L-21124-13EN, Dec. 21, 2012; Broiler Performance and Nutrition Supplement, CobbAvian™ L-2144-04EN, April, 2012; Broiler Performance and Nutrition Supplement, CobbSasso™, L-2154-01, May 7, 2008; Ross 308 Broiler: Nutrition Specifications, 2014 Aviagen, 0814-AVNR-035; Ross Nutrition Supplement 2009, Aviagen; Ross 708 Broiler: Nutrition Specification, 2014 Aviagen, 0814-AVNR-036; Ross PM3 Brioler Nutrition Specification, 2014 Aviagen, 0814-AVNR-037; Arbor Acres Plus Broiler Nutrition Specifications, 2014 Aviagen, 1014-AVNAA-043; Arbor Acres Broiler Nutrition Supplement, 2009 Aviagen; and Association of American Feed Control Officials (AAFCO) 2015 Official Publication, Nutrient Requirements for Poultry, all of which are incorporated herein by reference as if fully set forth.
- In an embodiment, the diet may be a diet for broilers. The diet for broilers may be composed of one or more of the following ingredients: 51.49% (w/w)-61.86% (w/w) corn, 25.45% (w/w)-35.03% (w/w) soybean meal, 5.00% (w/w) corn distillers dry grains plus soluble solids, 2.00% (w/w) vermiculite, 0.30% (w/w)-1.99% (w/w) dicalcium phosphate, 1.00% (w/w) poultry fat, 0.81% (w/w)-4.01% (w/w) limestone, 0.24% (w/w)-0.50% (w/w) salt (NaCl), 0.13% (w/w)-0.45% (w/w) DL-methionine, 0.20% (w/w) choline chloride 60, 0.20% (w/w) mineral premix, 0.05% (w/w) vitamin premix, 0.13% (w/w)-0.23% (w/w) L-lysine, 0.08% (w/w)-0.14% (w/w) L-threonine, 0.05% (w/w) coban, 0.05% (w/w) selenium premix, 0.15% (w/w) sodium bicarbonate and 0.10% (w/w) sand. Digestible lysine in the diet may be 1.00% (w/w) to 1.20% (w/w). Digestible methionine in the diet may be 0.47% (w/w) to 0.54% (w/w). Digestible methionine and cysteine in the diet may be 0.98% (w/w) to 1.10% (w/w). Digestible threonine in the diet may be 0.68% (w/w) to 0.84% (w/w). Digestible tryptophan in the diet may be 0.17% (w/w) to 0.22% (w/w). Calcium in the diet may be 0.71% (w/w) to 0.96% (w/w). Available phosphorus in the diet may be 0.17% (w/w) to 0.46% (w/w). Sodium in the diet may be 0.17% (w/w) to 0.19% (w/w). The concentration of each ingredient within any one of the ranges herein may be any value between any two of the concentration points included in the range. In an embodiment, the diet may be the diet for broilers composed of one or more of the following ingredients: 30.00% (w/w)-75.00% (w/w) corn, 5.00% (w/w)-75.00% (w/w) wheat; 5.00% (w/w)-65.00% (w/w) barley; 5.00% (w/w)-30.00% (w/w) sorghum, 5.00% (w/w)-50.00% (w/w) millet, 10.00% (w/w)-45.00% (w/w) soybean meal, 5.00% (w/w)-20.00% (w/w) Canola (Rapeseed) meal, 2.00% (w/w)-15.00% (w/w) corn gluten meal, 5.00% (w/w)-15.00% (w/w) sunflower meal, 5.00% (w/w)-30.00% (w/w) corn distillers dry grains plus soluble solids, 1.00% (w/w)-8.00% (w/w) poultry/porcine/bovine meat and bone meal, 1.00% (w/w)-8.00% (w/w) fish meal, 0.10% (w/w)-2.1% (w/w) dicalcium or monocalcium or defluorinated phosphate, 0.50% (w/w)-6.00% (w/w) soy oil or vegetable oil or animal fat or grease or combination, 0.81% (w/w)-2.00% (w/w) limestone, 0.50% (w/w)-7.00% soy hulls, 0.24% (w/w)-0.50% (w/w) salt (NaCl), 0.13% (w/w)-0.50% (w/w) DL-methionine, 0.01% (w/w)-0.20% (w/w) choline chloride 60, 0.10% (w/w)-0.20% (w/w) mineral premix, 0.05% (w/w)-0.25% (w/w) vitamin premix, 0.05% (w/w)-0.30% (w/w) L-lysine, 0.10% (w/w)-0.30% (w/w) DL-Methionine or methionine analog (MHA), 0.05% (w/w)-0.20% (w/w) L-threonine, 0.05% (w/w) coban, 0.05% (w/w) selenium premix, 0.05% (w/w)-0.15% (w/w) sodium bicarbonate and 250 FTU/kg-2000 FTU/kg Phytase. Metabolizable energy of the diet may be 1225 (kcal/lb)-1491 (kcal/lb). Crude protein (CP) in the diet may be 15% (w/w) to 25% (w/w). Digestible lysine in the diet may be 0.85% (w/w) to 1.30% (w/w). Digestible methionine in the diet may be 0.45% (w/w) to 0.70% (w/w). Digestible methionine and cystine in the diet may be 0.65% (w/w) to 1.10% (w/w). Digestible threonine in the diet may be 0.60% (w/w) to 0.84% (w/w). Digestible tryptophan in the diet may be 0.10% (w/w) to 0.25% (w/w). Calcium in the diet may be 0.68% (w/w) to 1.10% (w/w). Available phosphorus in the diet may be 0.17% (w/w) to 0.50% (w/w). Sodium in the diet may be 0.17% (w/w) to 0.19% (w/w). Phytase in the diet may be 500 FTU/kg (w/w) to 8,000 FTU/kg (w/w). The concentration of each ingredient within any one of the ranges herein may be any value between any two of the concentration points included in the range. Variations in the concentrations of these ingredients may also be used in a diet.
- The method may include mixing a transgenic plant or part thereof with a feed ingredient to obtain a mixture. The feed ingredient may be one or more ingredients included in the diet described herein. The transgenic plant or part thereof may be any transgenic plant or part thereof described herein. The method may include feeding an animal with the mixture. The body weight gain (BWG) in an animal fed with the mixture comprising a glucanase may be higher than the BWG in a control animal fed with identical feed ingredients not mixed with a transgenic plant including a glucanase. In an embodiment, the BWG in an animal fed with the mixture comprising a glucanase may be similar to the BWG in a control animal fed with a high energy diet or a diet that includes more or higher concentrations of the ingredients compared to the mixture including a glucanase. In an embodiment, the feed conversion ratio (FCR) in an animal fed with the mixture comprising a glucanase may be lower than the FCR in a control animal fed with identical feed ingredients not mixed with a transgenic plant including a glucanase. The FCR is defined as the mass of the feed eaten by the animal divided by the animal's mass. In an embodiment, the FCR in an animal fed with the mixture comprising a glucanase may be similar to the FCR in a control animal fed with a high energy diet or a diet that includes more or higher concentrations of the ingredients compared to the mixture including a glucanase.
- In an embodiment, a method of enhancing thermal stability of a glucanase is provided. The method may include producing a transgenic plant that includes a synthetic nucleic acid encoding the glucanase. The synthetic nucleic acid may include any one the sequences described herein. The glucanase may be thermally stable upon exposure to temperatures in the range of 70° C. to 130° C., endpoints inclusive.
- The glucanase may be thermally stable upon exposure to temperatures in the range of 25° C. to 130° C., endpoints inclusive. The glucanase may be thermally stable upon exposure to temperatures in the range from 25° C., 30° C., 35° C., 40° C., 45° C., 50° C., 55° C., 65° C., 70° C., 75° C., 80° C., 85° C., 90° C., 95° C., 100° C., 105° C., 110° C., 115° C., 120° C., 125° C., 130° C., 25° C., to 30° C., 25° C. to 35° C., 25° C. to 40° C., 25° C. to 45° C., 25° C. to 50° C., 25° C. to 55° C., 25° C. to 60° C., 25° C. to 65° C., 25° C. to 70° C., 25° C. to 75° C., 25° C. to 80° C., 25° C. to 85° C., 25° C. to 90° C., 25° C. to 95° C., 25° C. to 100° C., 25° C. to 105° C., 25° C. to 110° C., 25° C. to 115° C., 25° C. to 120° C., 25° C. to 125° C., or less than 130° C. The glucanase may be thermally stable upon exposure to temperatures in the range of 70° C. to 130° C., endpoints inclusive. The glucanase may be thermally stable upon exposure to temperatures in the range from 70° C. to 75° C., 70° C. to 80° C., 70° C. to 85° C., 70° C. to 90° C., 70° C. to 95° C., 70° C. to 100° C., 70° C. to 105° C., 70° C. to 110° C., 70° C. to 115° C., 70° C. to 120° C., or 70° C. to 130° C., endpoints inclusive.
- The above mentioned synthetic nucleic acids may be provided in embodiments herein alone, as part of another nucleic acid, as part of a vector or as stated above as part of a transgenic plant.
- In an embodiment, the transgenic plant may be derived from one of corn, rye, switchgrass, miscanthus, sugarcane or sorghum. The transgenic plant may be made by Agrobacterium mediated transformation using a vector having a nucleic sequence as set forth above.
- In an embodiment, a method for enhancing production of fermentable sugars from grains is provided. The method may include mixing grains derived from any one of the transgenic plants described herein with grains from a different plant to form mixed grains. The different plant may be a non-transgenic plant. The different plant may be an engineered plant that includes a synthetic nucleic acid encoding at least one hydrolytic enzyme. The hydrolytic enzyme may be but is not limited to xylanase, an amylase, an endoglucanase, an exoglucanase, a feruloyl esterase, a glucoamylase, an intein-modified amylase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, a protease, an intein-modified protease, a phytase, or an intein-modified phytase. The method may include processing the mixed grains. The processing may include one or more operations selected from the group consisting of harvesting, baling, grinding, milling, chopping, size reduction, crushing, pellitizing, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, ensiling, mixing with silage or other biomass and ensiling, fermentation, chemical conversion, and chemical catalysis. The biomass may be but is not limited to hay, straw, stover, silage, compressed and pelleted feeds, soybeans, sprouted grains, legumes, feed grains, maize, rice, barley or wheat grains. The biomass may be any biomass derived from agricultural waste. The method may include converting fermentable sugars into a biochemical product. The biochemical product may be but is not limited to ethanol, butanol, lactic acid, citric acid, and acetic acid.
- In an embodiment, a method for reducing the viscosity of a grain mixture is provided. The method may include mixing grains derived from any one of the transgenic plants described herein with grains from a different plant to form mixed grains. Water may be added to the mixed grains to form the grain mixture. The viscosity of the grain mixture may be lower when it includes any one of the glucanases described herein. The viscosity may be intestinal viscosity, which is typically measured from an intestinal sample removed from a bird or pig after euthanization. In this method, the digesta sample is centrifuged and the viscosity of supernatant is analyzed using a viscometer. For example, as describe by Lee et al., ileal digesta was centrifuged for 10 min at 3,500× gravity and 0.5 ml of supernatant was put in a Brookfield Cone and Plate Viscometer1 with a CPE-40 spindle. See Lee, J. T., C. A. Bailey, and A. L. Cartwright. 2003. β-Mannanase ameliorates viscosity-associated depression of growth in broiler chickens fed guar germ and hull fractions. Poult. Sci. 82:1925-1931, which is incorporated herein by reference as if fully set forth. Samples are analyzed for 30 sec at 40° C. and 5 rpm, to determine centipoise (cP units) readings. The higher the cP, the higher the viscosity of the sample.
- The different plant may be a non-transgenic plant. The different plant may be an engineered plant that includes a synthetic nucleic acid encoding at least one hydrolytic enzyme. The hydrolytic enzyme may be but is not limited to xylanase, an amylase, an endoglucanase, an exoglucanase, a feruloyl esterase, a glucoamylase, an intein-modified amylase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, a protease, an intein-modified protease, a phytase, or an intein-modified phytase. The method may include processing the grain mixture. The processing may include one or more operations selected from the group consisting of harvesting, grinding, milling, size reduction, crushing, heating, gelotinzing, liquefaction, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, saccharifying, fermentation, chemical conversion, and chemical catalysis.
- In an embodiment, a method for enhancing ethanol production from grains is provided. The method includes performing any one of the methods for enhancing production of fermentable sugars described herein.
- The following list includes particular embodiments of the present invention. But the list is not limiting and does not exclude alternate embodiments, as would be appreciated by one of ordinary skill in the art.
- 1. A transgenic plant comprising a synthetic nucleic acid encoding a glucanase, wherein the glucanase includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and is capable of degrading one or more polysaccharides.
2. The transgenic plant ofembodiment 1, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
3. The transgenic plant of any one or both of the preceding embodiments, wherein the glucanase is active upon expression in the plant and exposure to a pH in the range from 4.0 to 10.0.
4. The transgenic plant of any one or more of the preceding embodiments, wherein the glucanase is active upon expression in the plant and exposure to a temperature in the range from 25° C. to 130° C.
5. The transgenic plant of any one or more of the preceding embodiments, wherein the glucanase activity has improved stability upon expression in the plant compared to the activity of a glucanase having an identical amino acid sequence and expressed in a bacterial cell.
6. The transgenic plant of any one or more of the preceding embodiments, wherein a plant is selected from the group consisting of: wheat, maize, barley, rice, and sorghum.
7. A transgenic plant comprising a synthetic nucleic acid including a sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3, wherein the glucanase is capable of degrading one or more polysaccharides.
8. The transgenic plant ofembodiment 7, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
9. The transgenic plant of any one or more of embodiments 7-8, wherein the glucanase is active upon expression in the plant and exposure to a pH in the range from 4.0 to 10.0.
10. The transgenic plant of any one or more of embodiments 7-9, wherein the glucanase is active upon expression in the plant and exposure to a temperature in the range from 25° C. to 130° C.
11. The transgenic plant of any one or more of embodiments 7-10, wherein the glucanase activity has improved stability upon expression in the plant compared to the activity of a glucanase having an identical amino acid sequence and expressed in a bacterial cell.
12. The transgenic plant of any one or more of embodiments 7-11, wherein the transgenic plant is a plant is selected from the group consisting of: wheat, maize, barley, rice, and sorghum.
13. The transgenic plant of any one or more of embodiments 7-12, which comprises the nucleic acid sequence of SEQ ID NO: 1 and produces an amplicon for diagnosing event 4588.259, 4588.757, or 4588.652.
14. A synthetic nucleic acid comprising a sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3, wherein the glucanase is capable of degrading one or more polysaccharides.
15. The synthetic nucleic acid ofembodiment 14, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
16. A synthetic polynucleotide comprising a sequence with at least 70% identity to a reference sequence selected from the group consisting of SEQ ID NO: 7-19, wherein the synthetic polynucleotide comprises a synthetic nucleic acid encoding a glucanase that is capable of degrading one or more polysaccharides.
17. The synthetic polynucleotide ofembodiment 16, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
18. A vector comprising a synthetic polynucleotide, or a fragment of a synthetic polynucleotide, of embodiment 17.
19. A method of making a transgenic plant that includes a glucanase comprising: - contacting a plant cell with a synthetic nucleic acid encoding an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3, wherein the glucanase is capable of degrading one or more polysaccharides;
-
- regenerating a transgenic plant from the transgenic plant cell; and
- selecting the transgenic plant expressing a glucanase, wherein the glucanase is active and thermally stable upon exposure to a temperature in the range from 25° C. to 130° C.
- 20. The method of embodiment 19, wherein the one or more polysaccharide is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
21. The method of any one or both of embodiments 19-20, wherein the synthetic nucleic acid is part of a vector of embodiment 13.
22. An animal feedstock comprising a transgenic plant or part thereof of any one or more of embodiments 1-13, the product of any one or more of embodiments, 19-21, or a synthetic polypeptide of any one or more of embodiments 51-54.
23. The animal feedstock of embodiment 22 further comprising a feed supplement or feed additive.
24. The animal feedstock of any one or both of embodiments 22-23, wherein the feed supplement is plant material.
25. The animal feedstock of any one or more of embodiments 22-24, wherein the plant material is a non-transgenic plant.
26. The animal feedstock of any one or more of embodiments 22-24 wherein the plant material is an engineered plant.
27. The animal feedstock of any one or more of embodiments 22-26, wherein the feed supplement includes one or more exogenous enzymes.
28. The animal feedstock of embodiment 27, wherein the one or more exogenous enzyme includes a hydrolytic enzyme selected from the group consisting of: xylanase, endoglucanase, cellulase, exoglucanase, feruloyl esterase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified cellulase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, mannanase, amylase, an intein-modified amylase, phytase, an intein-modified phytase, protease, and an intein-modified protease.
29. The animal feedstock of any one or more embodiments 22-28, wherein the plant material includes at least one component selected from the group consisting of: forage, biomass, corn meal, corn pellets, wheat meal, wheat pellets, wheat grain, barley grain, barley pellets, soybean meal, soybean oilcake, silage, sorghum grain and sorghum pellets.
30. The animal feedstock of any one or more of embodiments 23-29, wherein the feed supplement includes at least one component selected from the group consisting of: soluble solids, fat and vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, COBAN®, vitamin premix, dicalcium phosphate, selenium premix, choline chloride, sodium chloride, and mineral premix.
31. A method of producing an animal feedstock comprising mixing 1) a transgenic plant or part thereof of any one or more of embodiments 1-13, 2) the product of any one or more of embodiments 19-41, or 3) a synthetic polypeptide of any one or more of embodiments 51-54 with plant material.
32. The method of embodiment 31 further comprising pelletizing the mixture.
33. The method of embodiment 32 further comprising adding a feed supplement to the mixture.
34. The method of embodiment 33, wherein the feed supplement includes at least one exogenous enzyme.
35. The method of embodiment 34, wherein the at least one exogenous enzyme includes a hydrolytic enzyme selected from the group consisting of xylanase, endoglucanase, cellulase, exoglucanase, feruloyl esterase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified cellulase, an intein-modified feruloyl esterase, amylase, an intein-modified amylase, mannanase, phytase, and protease.
36. A method of increasing utilization of non-starch polysaccharides in an animal comprising feeding an animal with an animal feedstock 1) including a transgenic plant of any one or more of embodiments 1-13, 2) of any or more of embodiments 22-30, 3) produced by the method of any one or more of embodiments 31-35, or 4) including a synthetic polypeptide of any one or more of embodiments 51-54.
37. The method of embodiment 36 further comprising preparing the animal feedstock.
38. The method of any or both of embodiments 36-37, wherein the animal is a monogastric animal or a ruminant animal.
39. A method of enhancing thermal stability of a glucanase comprising producing a transgenic plant that includes a synthetic nucleic acid comprising, consisting essentially of, or consisting of an amino acid a sequence having 70% identity to a reference sequence of selected fromthe group consisting of: SEQ ID NOS: 4-6, wherein the sequence encodes a glucanase capable of degrading one or more polysaccharides.
40. The method of embodiment 39, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
41. The method of any or both of embodiments 39-40, wherein expression of the nucleic acid produces the glucanase and the glucanse is thermally stable upon exposure to a temperature in the range of 25° C. to 130° C. - 42. A method for enhancing production of fermentable sugars from grains comprising:
- mixing grains derived from a transgenic plant of any one of any one or more of embodiments 1-13 with grains derived from a different plant to form mixed grains; and
- processing the mixed grains.
- 43. The method of embodiment 42, wherein the different plant is an engineered plant that includes a synthetic nucleic acid encoding at least one hydrolytic enzyme.
44. The method of any or both of embodiments 42-43, wherein the at least one hydrolytic enzyme is selected from the group consisting of: xylanase, an endoglucanase, an exoglucanase, cellulase, a feruloyl esterase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified cellulase, an intein-modified feruloyl esterase, amylase, phytase and protease.
45. The method of any one or more of embodiments 42-43, wherein the processing includes at least one operations selected from the group consisting of harvesting, baling, grinding, milling, chopping, size reduction, crushing, pellitizing, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, ensiling, fermentation, chemical conversion, and chemical catalysis.
46. The method ofembodiment 45 further comprising producing a biochemical product.
47. The method of embodiment 46, wherein the biochemichal product is selected from the group consisting of ethanol, butanol, lactic acid, citric acid, and acetic acid.
48. A method for enhancing ethanol production from grains comprising performing a method of any one or more of embodiments 42-47.
49. A method for enhancing ethanol production from a transgenic plant comprising: - mixing a transgenic plant or part thereof of any one or more of embodiments 1-13 with a different plant or part thereof to form mixed plant material;
- converting the mixed plant material into fermentable sugars; and
- processing the fermentable sugars into ethanol.
- 50. The method of embodiment 49, wherein the plant material includes fiber, grain, or a combination thereof.
51. A synthetic polypeptide that includes an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 4-6, and capable of degrading one or more polysaccharides.
52. The synthetic polypeptide of embodiment 51, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
53. A synthetic polypeptide that includes an amino acid sequence comprising a contiguous amino acid sequence having at least 90% identity to 50 to 100, 50 to 150, 50 to 200, 50 to 250, 50 to 300, 50 to 322, or 50 to all contiguous amino acid residues of a glucanase having the sequence of any of SEQ ID NOS: 4-6, wherein the glucanase is capable of degrading one or more polysaccharides.
54. The synthetic polypeptide of embodiment 51, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
55. A method of increasing metabolizable energy of a diet comprising mixing a transgenic plant or part thereof with a feed ingredient, wherein the transgenic plant or part thereof comprises a synthetic nucleic acid encoding a glucanase comprising an amino acid sequence with at least 70% identity to a reference sequence selected from the group consisting of SEQ ID NOS: 4-6, and and capable of degrading one or more polysaccharides.
56. The synthetic polypeptide of embodiment 55, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
57. The method of any one or both of embodiments 55-56, wherein the synthetic nucleic acid comprises a sequence with at least 70% identity to a reference sequence selected from the group consisting of: SEQ ID NOS: 1-3.
58. The method of any one or more of embodiments 55-57, wherein the glucanase is active upon expression in the plant and exposure to a pH in the range from 5.0 to 10.0.
59. The method of any one or more of embodiments 55-58, wherein the glucanase is active upon expression in the plant and exposure to a temperature in the range from 25° C. to 130° C.
60. The method of any one or more of embodiments 55-59, wherein the feed ingredient includes at least one component selected from the group consisting of: corn meal, corn pellets, wheat meal, wheat pellets, wheat grain, wheat middlings, barley grain, barley pellets, soybean meal, soy hulls, dried distillers grain, soybean oilcake, sorghum grain and sorghum pellets.
61. The method of any one or more of embodiments 55-60, wherein the feed ingredient includes at least one component selected from the group consisting of: soluble solids, fat and vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, COBAN®, vitamin premix, dicalcium phosphate, selenium premix, choline chloride, sodium chloride, mineral premix, and one or more exogenous enzymes.
62. A method for producing an animal feedstock comprising mixing a transgenic plant or part thereof of any one or more of embodiments 1-13 with plant material. The method may also comprise the method for producing a plant that includes a glucanase of any one or more of embodiments 63-68.
63. A method for producing a plant that includes a glucanase comprising crossing a plant with a transgenic plant comprising event 4588.259, 4588.757 or 4588.652, and selecting a first progeny plant comprising event 4588.259, 4588.757 or 4588.652 and capable of degrading one or more polysaccharides.
64. The method of embodiment 63, wherein the one or more polysaccharides is selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
65. The method of any one or more of embodiments 63-64 further comprising selfing the first progeny plant and selecting a second progeny plant comprising event 4588.259, 4588.757 or 4588.652 and capable of degrading one or more polysaccharides.
66. The method of embodiment 65, wherein the second progeny plant is homozygous for event 4588.259, 4588.757 or 4588.652.
67. The method of embodiment 65, wherein the second progeny plant is heterozygous for event 4588.259, 4588.757 or 4588.652.
68. The method of embodiment 67 further comprising selfing the second progeny plant and selecting a third progeny plant homozygous event 4588.259, 4588.757 or 4588.652 and capable of degrading one or more polysaccharides.
69. A kit for identifying maize event 4588.259, 4588.757 or 4588.652 in a sample comprising a first primer and a second primer, wherein the first primer and the second primer are capable of amplifying a target sequence specific to maize event 4588.259, 4588.757 or 4588.652.
70. The kit of any one or more of embodiment 69 wherein, the first primer comprises a nucleic acid sequence selected from SEQ ID NOS: 38, 41, and 47.
71. The kit of any one or more of embodiments 69-70, wherein the second primer comprises a nucleic acid sequence selected from SEQ ID NOS: 39, 42, 43, 45, and 46.
72. The kit of any one or more of embodiments 69-71, wherein the target sequence comprises a sequence selected from the group consisting of SEQ ID NOS: 51-55.
73. The kit of any one or more of embodiments 69-72, wherein the target sequence is capable of hybridizing to the sequence of the nucleic acid comprising a sequence of SEQ ID NOS: 40 or 44 under conditions of high stringency.
74. The kit of any one or more of embodiments 69-73, wherein the sample comprises plant matter derived from a transgenic plant of any one or more of embodiments 1-13.
75. A method of identifying maize event 4588.259, 4588.757 or 4588.652 in a sample comprising: - contacting a sample with a first primer and a second primer of the kit of any one or more of embodiments 69-74;
- amplifying a nucleic acid in the sample to obtain an amplified product; and
- detecting an amplified product specific to a target sequence in maize event 4588.259, 4588.757 or 4588.65.
- 76. The method of embodiment 75, wherein the target sequence comprises a sequence selected from SEQ ID NOS: 51-55. The method of identifying may be added to any one or more of embodiments 63-68.
77. The method of embodiment 75, wherein the target sequence is at least one sequence selected from the group consisting of SEQ ID NOS: 22-31.
78. The method of embodiment 75, wherein the step of detecting comprises hybridizing the amplified product to the nucleic acid comprising a sequence of SEQ ID NOS: 40 under conditions of high stringency, and selecting the amplified product specific to maize event 4588.259.
79. The method of embodiment 75, wherein the step of detecting comprises hybridizing the amplified product to the nucleic acid comprising a sequence of SEQ ID NOS: 44 under conditions of high stringency, and selecting the amplified product specific to maize event 4588.652.
80. A method for reducing the viscosity of a grain mixture comprising combining grains from a transgenic plant of any one or more of embodiments 1-13, a different plant, and liquid to form a grain mixture.
81. The method ofembodiment 80, wherein the different plant is a non-transgenic plant.
82. The method ofembodiment 80, wherein the different plant is a genetically engineered plant.
83. The method ofembodiment 80 and 82, wherein the genetically engineered plant comprises a synthetic nucleic acid encoding at least one hydrolytic enzyme.
84. The method of embodiment 83, wherein the at least one hydrolytic enzyme is selected from the group consisting of: xylanase, an amylase, an endoglucanase, an exoglucanase, a feruloyl esterase, a glucoamylase, an intein-modified amylase, an intein-modified xylanase, an intein-modified endoglucanase, an intein-modified exoglucanase, an intein-modified feruloyl esterase, a protease, an intein-modified protease, a phytase, or an intein-modified phytase.
85. The method of any one or more of embodiments 80-84 further comprising processing the grain mixture.
86. The method of embodiment 85, wherein the step of processing includes one or more operations selected from the group consisting of harvesting, grinding, milling, size reduction, crushing, heating, gelatinizing, liquefaction, extracting a component from the mixed grains, purifying a component or portion of the mixed grains, extracting or purifying starch, hydrolyzing polysaccharides into oligosaccharides or monosaccharides, saccharifying, fermentation, chemical conversion, and chemical catalysis. - Further embodiments herein may be formed by supplementing an embodiment with one or more element from any one or more other embodiment herein, and/or substituting one or more element from one embodiment with one or more element from one or more other embodiment herein.
- The following non-limiting examples are provided to illustrate particular embodiments. The embodiments throughout may be supplemented with one or more detail from one or more example below, and/or one or more element from an embodiment may be substituted with one or more detail from one or more example below.
- A codon optimized nucleotide sequence for expression of the AGR2314 feed glucanase in maize was synthesized. For generating initial plant transformation constructs, single AGR2314 expression cassettes were assembled in vectors pAG4000 (pAG4258) or pAG4500 (pAG4588, pAG4597, and pAG4708). The vector pAG4000 has been created by replacing the
rice ubiquitin 3 promoter with the first intron by themaize ubiquitin 1 promoter containing its own first intron for driving expression of the selectable marker gene encoding E. coli phosphomannose isomerase (PMI). The vector pAG4500 represents further improvement of pAG4000 and contains three modifications such as 1) insertion after the first maize ubiquitin intron of a 9 bp sequence (ATCCAGATC) representing the first three codons of the ubiquitin monomer with ATG converted into ATC; 2) insertion of the maize Kozak element (TAAACC) after the 9 bp sequence ubiquitin monomer; 3) replacement of the old multiple cloning site (MCS) by a new MCS that was synthesized by PCR and that was designed to contain multiple sites for several rare cutting enzymes (NotI, PacI, FseI, SwaI, AscI, AsiSI) to facilitate cloning of up to 4-5 expression cassettes on one T-DNA. - Sequence of the new MCS in pAG4500 (PmeI-KpnI fragment):
-
(SEQ ID NO: 20) GTTTAAACTGAAGGCGGGAAACGACAACCTGATCATGAGCGGAGAATTAA GGGAGTCACGTTATGACCCCCGCCGATGACGCGGGACAAGCCGTTTTACG TTTGGAACTGACAGAACCGCAACGTTGAAGGAGCCACTCAGCCTAAGCGG CCGCATTGGACTTAATTAAGTGAGGCCGGCCAAGCGTCGATTTAAATGTA CCACATGGCGCGCCAACTATCATGCGATCGCTTCATGTCTAACTCGAGTT ACTGGTACGTACCAAATCCATGGAATCAAGGTACC. -
FIGS. 1-4 illustrate the expression vectors pAG4258, pAG4588, pAG4597, and pAG4708, respectively, carrying a single feed glucanase expression unit. The vector pAG4258 (FIG. 1 ; SEQ ID NO 7) has been cloned by assembling an expression cassette that was composed of the maize Glb1 promoter fused to the maize codon optimized AGR2314 sequence in KpnI-AvrII sites of pAG4000. The vectors pAG4588 (FIG. 2 ; SEQ ID NO 8) and pAG4597 (FIG. 3 ; SEQ ID NO 9) were developed by assembling their corresponding AGR2314 expression cassettes in KpnI-EcoRI sites of pAG4500, while the vector pAG4708 (FIG. 4 ; SEQ ID NO 10) was produced by cloning AGR2314 expression cassette into XmaI-AvrII sites of pAG4500.FIGS. 5-6 illustrate the expression vectors pAG4766 and pAG4767, respectively, carrying two feed glucanase expression units.FIGS. 7-8 illustrate the expression vectors pAG4770 and pAG4771, respectively, carrying three feed glucanase expression units. The unique rare cutting restriction sites that are available within the MCS of the pAG4500 were subsequently used in order to develop additional expression constructs containing either double AGR2314 expression units, such as pAG4766 (FIG. 5 ; SEQ ID NO 11) and pAG4767 (FIG. 6 ; SEQ ID NO 12), or triple AGR2314 expression units, such as pAG4770 (FIG. 7 ; SEQ ID NO 13) and pAG4771 (FIG. 8 ; SEQ ID NO 14), on the same T-DNA. The constructed vectors for expression of AGR2314 glucanase in plants are listed in Table 1. E. coli strains carrying the expression vectors were used for conjugation with Agrobacterium and subsequent transformation of maize. -
TABLE 1 Description of Sequences SEQ ID Sequence NO Construct Description Type 1 AGR2314 maize—optimized protein DNA coding sequence (including C-terminal ER-retention signal “SEKDEL” 2 AGR2414 coding sequence DNA 3 AGR2514 coding sequence DNA 4 AGR2314 Mature protein sequence Amino acid (including C-terminal ER-retention signal “SEKDEL”) 5 AGR2414 protein Amino acid 6 AGR2514 protein Amino acid 7 pAG4258 Glb1:mZ27:AGR2314:SEKDEL:NOS DNA 8 pAG4588 Glu1:mZ27:AGR2314:SEKDEL:T35S DNA 9 pAG4597 mZein:mZ27:AGR2314:SEKDEL:T35S DNA 10 pAG4708 Ole:mZ27:AGR2314:SEKDEL:NOS DNA 11 pAG4766 Glu1:mZ27:AGR2314:SEKDEL:NOS, DNA Glb1:mZ27:AGR2314:SEKDEL:NOS 12 pAG4767 mZein:mZ27:AGR2314:SEKDEL, DNA Glb1:mZ27:AGR2314:SEKDEL:NOS 13 pAG4770 mZein:mZ27:AGR2314:SEKDEL:NOS, DNA Glu1:mZ27:AGR2314:SEKDEL:NOS, Glb1:mZ27:AGR2314:SEKDEL:NOS 14 pAG4771 Glu1:mZ27:AGR2314:SEKDEL:NOS, DNA mZein:mZ27:AGR2314:SEKDEL:NOS, Glb1:mZ27:AGR2314:SEKDEL:NOS 15 pAG4257 mZein:mZ27:AGR2514:SEKDEL:NOS DNA 16 pAG4692 Glu1:mZ27:AGR2414:SEKDEL:T35S DNA 17 pAG4693 mZein:mZ27:AGR2414:SEKDEL:T35S DNA 18 pAG4705 Glu1:mZ27:AGR2514:SEKDEL:T35S DNA 19 pAG4706 Ole:mZ27:AGR2514:SEKDEL:NOS DNA - Expression cassettes for related beta glucanases, AGR 2414 and AGR 2514, were prepared using similar strategies, and sequences are provided for these expression cassettes as they are found in the expression vectors pAQ4257 pAQ4692, pAQ4693, pAQ4705, pAQ4706, pAQ4766, pAQ4257, pAQ4692, pAQ4693, pAQ4705, and pAQ4706.
- Flour was prepared from about 20 transgenic seeds by milling in an Udy cyclone mill or knife mill with 0.5 mm or 1 mm screen. About 0.5 ml of protein extraction buffer (100 mM sodium phosphate, pH 6.5, 0.01% Tween 20) was added to 20 mg flour in a 2 ml tube. In some cases, 2 g, 10 g, or 20 g ground samples was mixed with 10 ml, 50 ml or 100 ml of the extraction buffer in 15 ml tubes or 250 ml bottles. Larger masses and volumes can be used by scaling these amounts appropriately. After vortexing, the tubes were placed on a rotating platform in a 60° C. incubator and rotated for 1 hour for protein extraction. After centrifugation at 16,000×g for 10 min in a tabletop centrifuge, the supernatant was diluted 20-fold for enzyme assay by adding 20 μl supernatant to 380 μl protein extraction buffer. In some cases, other dilution factors were used, as necessary.
- Colorimetric Assay. Fifty microliters of the diluted (20-fold to 360-fold) protein extract was mixed with 450 μl of 100 mM sodium phosphate buffer, pH 6.5, 0.01
% Tween - Unit Activity Measurement. The assay involves the quantitation of reducing sugars that are released during a time course digestion of a model substrate (barley-β-glucan) obtained from Megazyme (Wicklow, Ireland).
- Hydrolysis of model substrate.
Test 2 ml tubes were labeled with “+” sign, and 5 mg barley-β-glucan substrate (reaction) was added to each test tube; no substrate was added to control tubes (control). Four hundred fifty microliters of 100 mM sodium phosphate buffer, pH 6.5, was added to each tube (reactions and controls), and tubes were placed into a Thermo-shaker with temperature set at 80° C. and shaking speed set at 1000 rpm. Tubes were shaken at 1000 rpm at 80° C. for 20 min until the substrate was completed dissolved. A tube with 2 ml of diluted grain protein extract, extracted as described above was placed in the Thermo-shaker to be pre-warmed. - Fifty microliters of the pre-warmed sample were added to the control and reaction tubes. Shaking was resumed and a timer was started. After 15 minute of shaking at 80° C., 50 μl of each of the reaction and control samples were removed and mixed with 10 μl of 0.5N HCl in separate microplates. Shaking of the samples was resumed until all samples were removed and mixed with acid.
- BCA quantification of glucose reducing equivalents. Glucose standards were prepared in protein extraction buffer at the following concentrations: 0.05 mM, 0.1 mM, 0.2 mM, 0.4 mM, 0.6 mM, and 0.8 mM. BCA reagent (from Thermo Scientific) was prepared by mixing reagent A with reagent B in a ratio of 50:1. To make a glucose standard curve, 75 μl of buffer were dispensed into the first well of row A (A1) in a microplate and 75 μl of each glucose standard were dispensed into wells A2 through A7. To detect the reducing sugars from the feed glucanase reaction and control samples, 25 μl from each reaction were dispensed into rows of the microplate in the order of their incubation time with barley-β-glucan (e.g., row B1-B2: 15 min-30 min), then added 25 μl of corresponding control to another row of the microplate (e.g., row C1-C2: 15 min-30 min). Subsequently, 50 μl of sodium phosphate buffer were dispensed in each well in these two rows (reaction and control), and 175 μl BCA reagent were added to each well using a multichannel pipette. Mixing was achieved by pipetting up and down. The microplate was sealed and incubated at 80° C. in a heat block. After 10 min incubation, the microplate was chilled on ice for 10 minutes and centrifuged to bring down condensate. Subsequently, the absorbance at 560 nm of each well was measured on a microplate reader.
- Calculating units of feed glucanase activity from A560. The absorbance from the reagent blank was subtracted from the absorbance values for each of the glucose standards, and the resulting values were plotted according to their glucose concentrations. Linear regression was then used to calculate the “best fit” line through the data set. To determine glucose reducing equivalents in glucanase/barley-β-glucan reactions, for each time point, the absorbance value from the control sample was subtracted from the reaction sample, and the resulting value was used to calculate the concentration of reducing sugars by comparison to the glucose standard curve. One unit (U) of glucanase activity is the amount of enzyme required to release 1 μmol glucose reducing equivalents from 1% Barley-β-glucan per minute at 80° C., pH 5.3, using the BCA method of quantitation.
- Unit Activity Measurement (semi-high throughput method). As described herein, the method detects the reducing sugars such as glucose released from the model substrate (barley-β-glucan) by glucanase treatment at 80° C. for 40 minutes or 90 minutes. When protein extract from grain or feed is appropriately diluted, the initial velocity is detected within 40 minutes (grain product) or 90 minutes (feed sample) of the reaction. The reactions were carried out in 96-well block (Costar, Cat #3960) or strip tubes (VWR, Cat #29442-610).
- Substrate preparation: Barley-β-glucan (low viscosity) was weighed based on the number of reactions, e.g., 10 samples, 4 dilutions for each sample needed a total of 40 reactions. Each reaction needed 5 mg substrate, therefore, at least 40×5=200 mg of barley-β-glucan was required. The substrate was completely dissolved with the extraction buffer at 80° C. water bath for 20 minutes, and vortexed at every 5 to 10 minutes.
- The cluster tubes were used for 90 minutes endpoint activity unit assay of feed samples. Protein extract was diluted to 2-, 6-, 10- and 20-fold dilutions.
- Purified protein diluted 100-fold was used as a positive control for assay validation. Purified glucanase protein (200,000 ppb) was stored in 50 mM MES, 150 mM sodium chloride, pH6.3 buffer plus 40% glycerol at −20° C. Ten microliters of protein were mixed with 990 μl of the extraction buffer, and 50 μl were used for activity assay.
- Barley-β-glucan digestion by feed glucanase was carried out at a water bath set at 80° C. In the block of cluster tubes, 450 μl of the substrate were dispensed into tubes of A2 to D12 referring Table 2. These rows served as the reaction.
- Four hundred fifty microliters of the extraction buffer (no substrate) were added to each control tubes from rows E2 to H12, which served as blank to correct protein content detected by BCA method for each reaction as described in Table 2 (A2 to D12).
- Fifty microliters of the diluted sample extract including the negative control and positive control were added first to each blank tube, E2 to H12, and then to each reaction tube, A2 to D12, as described in Table 2.
-
TABLE 2 Example of enzyme hydrolysis of feed samples in cluster tubes 1 2 Columns 1 to 1112 A Neg. Ctr, Sample_X, 2x dilution Pos. Ctr Reaction 2x B Neg. Ctr, Sample_X, 6x dilution Pos. Ctr 6x C Neg. Ctr, Sample_X, 10x dilution Pos. Ctr 10x D Neg. Ctr, Sample_X, 20x dilution Pos. Ctr 20x E Neg. Ctr, Sample_X, 2x dilution Pos. Ctr Blank 2x F Neg. Ctr, Sample_X, 6x dilution Pos. Ctr 6x G Neg. Ctr, Sample_X, 10x dilution Pos. Ctr 10x H Neg. Ctr, Sample_X, 20x dilution Pos. Ctr 20x - The tubes were covered with Corning™ Storage Mat III, the Corning Storage Mat Applicator was used to seal the tubes. The plate was shaken at a low speed. The block was placed in the water bath at 80° C. for the 90 minutes incubation period. The reaction was terminated by adding 100 μl of 0.5 N HCl to each well and cooling the block on ice.
- BCA quantification of glucose reducing equivalents. Glucose standards were prepared in 100 mM sodium phosphate buffer, pH6, at the following concentrations: 0.05 mM, 0.1 mM, 0.2 mM, 0.4 mM, 0.6 mM, and 0.8 mM. BCA reagent (from Thermo Scientific) was prepared by mixing reagent A with reagent B in a ratio of 50:1. To make a glucose standard curve in
column 1 on a microplate, 75 μl of buffer was dispensed into the first well of row A (A1) and 75 μl of each glucose standard were dispensed into wells A2 through A7. To detect the reducing sugars from the feed glucanase reaction and control samples, 25 μl from each reaction were dispensed into rows of the microplate according to the order displayed on Table 2. Subsequently, 50 μl of the extraction buffer was dispensed in each sample well (reaction and blank) referring to Table 2 from A2 to H12 to make a total volume 75 μl. One hundred seventy five microliters of the BCA reagent were added to each well and mixed. The microplate was sealed and incubated at 80° C. on a heat block. After 10 min incubation, the microplate was chilled on ice for 10 min and centrifuged to bring down condensate. Subsequently, the absorbance at 560 nm of each well was measured on a microplate reader. - Calculating units of feed glucanase activity from A560. The absorbance value for the reagent blank was subtracted from the absorbance values for each of the glucose standards, and the resulting values were plotted according to their glucose concentrations. Linear regression was then used to calculate the “best fit” line for the data set. To determine glucose reducing equivalents in the glucanase/barley-β-glucan reactions, the absorbance value from the control sample was subtracted from absorbance value of the corresponding reaction sample, and the resulting value was used to calculate the concentration of reducing sugars by comparison to the glucose standard curve. One unit (U) of glucanase activity equals 1 μmol glucose reducing equivalents released from 1% barley-β-glucan per minute at 80° C., using the BCA method of quantitation.
- Calculating units of positive controls from A560 to validate the assay. The value of absorbance for blank samples (E12, F12, G12, H12) was subtracted from the value of absorbance for each reaction sample (A12, B12, C12, D12). The regression equation for the glucose standard was used to calculate the glucose content (μmol). To determine the amount of reducing units produced per minute (A), the value for the amount of glucose (μmol) released from barley-β-glucan in the reaction was divided by the reaction time, for example 90, if the reaction time was 90 minutes. The unit value of positive controls equals the dilution x (A)/mg of protein in the assay. The dilution factor in the assay described herein equals 24. The dilution factor of 24 was determined by comparing the ratio of the total reaction volume to the portion of the reaction that was used in the BCA assay. In the assay, the total reaction volume was 600 μl including 500 μl reaction and 100 μl of HCl used to stop the reaction. The portion of the reaction that was used in the BCA assay was 25 μl. Therefore, the dilution factor of 24 was calculated by dividing 600 μl by 25 μl.
- The amount of protein in the assay was calculated as follows. The concentration of the positive control was 2000 ng/ml, 50 μl was the aliquot of the positive control used in the test (or 50/1000 if calculated in mL). The amount of protein calculated in nanograms was 2000×(50/1000), or 2000×(50/1000)/1000000 if calculated in milligrams.
- Silks on untransformed (wild type) maize plants were pollinated with pollen from individual transgenic maize plants that carried the pAG4588 construct. Mature, dried seeds were harvested from the resulting ears and assayed for activity via the colorimetric assay.
FIG. 9 illustrates the range of activities recovered from 42 independent ears. In this figure, the numbers along the abscissa correspond to individual event identifiers. The highest activity was observed in theevent 259. In the T0 transgenic maize plants 757 that also carried the pAG4588 construct, the activity was about 25 A590/mg. The average activity of the homozygous seeds derived from the first generation of the selfed plants was approximately 116f 15 A590/mg. The activity of heterozygous seeds from this population was about 59f 18 A590/mg. - Silks on untransformed (wild type) maize plants were pollinated with pollen from individual transgenic maize plants that carried the pAG4597 construct. Mature, dried seed were harvested from the resulting ears and assayed for activity via the colorimetric assay.
FIG. 10 illustrates the range of activities recovered from 15 independent ears. In this figure, the numbers along the abscissa correspond to individual event identifiers. The highest activity was observed in theevent 460. - Event 4588.259: The event 4588.259 carries two independent T-DNA integration sites that are located on the
maize chromosomes - In the flanks OB-2880, OB-2832 and OB-3252, which are provided below, the maize genomic DNA is shown in the uppercase letters, while the pAG4588 vector sequences are indicated in the lowercase letters and are underlined.
- Integration Site on the Maize Chromosome 4:
- The T-DNA integration site on the
maize chromosome 4 is characterized by the 795 bp right T-DNA border flanking sequence OB-2880, which contains 677 bp of maize genomic. The isolated 677 bp maize genomic DNA flank has 99.3% sequence identity to the sequence derived from the antisense DNA strand of the maize chromosome 4 (nucleotide coordinates 56612593-56612026). -
>OB-2880 (SEQ ID NO: 22) CTTAGATTAGAGAATGAAAATTTGATTGCTAAGGCCCAAGATTTTGATGT TTGCAAAGATACAATTACCGATCTTAGAGATAAGAATGATATACTTCGTG CTAAGATTGTTGAACTTACACCACAACCTTCTATGCCTTCTGTGACATTA ACATTACGTCACAAACAATAGTATTTTTGTCATACCTTACATGTTGGTGA CGTGATTGTGACGAAAATCACATCGTCACAGAAGGTGCGTGTTAAATGGT GTACTATGACGAATAACAAAAAAACGTCATAATAGTTTATGACGCAAACT ACAAACGTCACTAATCTATGACACTCGAATTCGTCACTAATTATGTCTAA ATACGTCACAATTCATGTAGTCGTGCCTTGCCACGTGGCTGATTACGTGG CGAGATGACATGGCAGTTGACGTGGCAGGTGATGTGGCGAAAATGTTGTG ACGAGTTCATTCGTCACAGATGTTATGACGTGGCATGCCACATGGCAGAT GATGTGGCAAAATTATGTGACAAAAATATTTGTCATAAATATCAATGAGG TGGCAATATATGTGTGACGAAATTTTTCATCACAAAGTACGATGACGTTG CAATATATTTATGACGAATTGTTCATCATAAGGCGTGATGAATTCATAGC GTCATGGAATATTATGAAATCACATGCtcaaacactgatagtttaaactg aaggcgggaaacgacaacctgatcatgagcggagaattaagggagtcacg ttatgacccccgccgatgacgcgggacaagccgttttacgtttgg - Integration site on the maize chromosome 8:
- The T-DNA insertion site on the
chromosome 8 is characterized by the sequences OB-2832 and OB-3252 that represent, accordingly, left and right flanks for the T-DNA integrated into this locus. - The 1211 bp OB-2832 sequence contains 864 bp of maize genomic DNA. The isolated 864 bp maize genomic DNA flank has 99.65% sequence identity to the sequence derived from the
maize chromosome 8 with nucleotide coordinates 100613054-100613915. -
>OB-2832 (SEQ ID NO: 23) tcgttcaaacatttggcaataaagtttcttaagattgaatcctgttgccg gtcttgcgatgattatcatataatttctgttgaattacgttaagcatgta ataattaacatgtaatgcatgacgttatttatgagatgggtttttatgat tagagtcccgcaattatacatttaatacgcgatagaaaacaaaatatagc gcgcaaactaggataaattatcgcgcgcggtgtcatctatgttactagat cgggaattggcgagctcgaattaattcagtacattaaaaacgtccgcaat gtgttattaagttgtctaagcgtcaatttgtttacaccacaatatatACT AAAAAAACTCAAGGATCTGTCTCCAGAAAGGCCTTGCAGGGTTTGGCCAC GCCCACGGACATTCCATCTCAGAGCCATGATTAGAACGAAAAACACATGA GAGCCGTCGTTGCTAGGAGTCGGTTTCATATGTTCGCTAAAACAAGAGAT TTGTTTTTTTTCTCTCTCGTACATACACGAGTCAGCCCTTTTAATCTCAG GTTGACGTGCAATGTCGCTCGTCTAAGCAGAACATTTTGAGAACAAATGT GTTGTACATGAGAGTTTTGTGTACATGGTACGTACATTAAAACATCATCA TTTATCTTAGATCTAACATCTCTACTTGCTTGTTATATATTTTTTTTGTA AAATAACATCTTTCACCACTTTATATGGTGTTGTTTGCAAAATATACAGA GCAATTAGAGACGTTAGATTTGAGATGGACGGTGATAATTTAATACATGC ATAATGTACAAGAAAATCCTAACTGCACTAGATATGTTGTCAAACATTTT ACCTTTGTTACAAAAAGAAATGAATAGATGTTGAACGGTTGTCTTTCAAG CCTGTTCGCTGCGGCTTTAATTCACCAACTGCAATGAACAACCTGAAAGG TGATCGTTGCCGAACACATGCTGTTTGGCAAAGCTAGTAGTACCTTTTTT GTCTGTCACCTGGAATGATGAGAAAGGAGACAAGAGGAGAGGGCTGGCCA TTGTTTATATATATACGTATTTCCATTGCTTTGTGGCATGCAACAGTTCA AGGGTCCAAACTGGCAGGTTTTCAGCCCCGACAAATATAATAAAAAAACT ACAAAAAAAAAAGGTCCGTTTACATTCCTTTTTTGACAACGCTAGTCCGT GCGGAGCGAGC - The 696 bp OB-3252 sequence contains 95 bp of maize genomic DNA. The OB-3252 does not contain left T-DNA border sequence. The isolated 95 bp flank has 100% sequence identity to the sequence derived from the antisense DNA strand of the
maize chromosome 8 with nucleotide coordinates 100613034-100612940. -
>OB-3252 (SEQ ID NO: 24) Ggtgaaacaaggtgcagaactggacttcccgattccagtggatgattttg ccttctcgctgcatgaccttagtgataaagaaaccaccattagccagcag agtgccgccattttgttctgcgtcgaaggcgatgcaacgttgtggaaagg ttctcagcagttacagcttaaaccgggtgaatcagcgtttattgccgcca acgaatcaccggtgactgtcaaaggccacggccgtttagcgcgtgtttac aacaagctgtaagagcttactgaaaaaattaacatctcttgctaagctgg gagctctagatccccgaatttccccgatcgttcaaacatttggcaataaa gtttcttaagattgaatcctgttgccggtcttgcgatgattatcatataa tttctgttgaattacgttaagcatgtaataattaacatgtaatgcatgac gttatttatgagatgggtttttatgattagagtcccgcaattatacattt aatacgcgatagaaaacaaaatatagcgcgcaaactaggataaattatcg cgcgcggtgtcatctatgttactagatcgggaattggcgagctcgaatta aTTCAAGTGTCTTCGTACAAACTGGGGGATGGGGCAGACCGCCAGGTTCA AACCGTTTGACTAGATGCGGCTGGCAGGCTACTTTGCAGTGCATGC - The maize genomic DNA flanks in sequences OB-2832 and OB-3252 are separated by 20 nucleotides on the
maize chromosome 8, which indicates that during T-DNA integration 20 bp of the original maize genomic DNA sequence were replaced by the inserted T-DNA sequences. - There is also an OB-2861 sequence and an OB-2868 sequence within the 259 event. The 970 bp OB-2861 sequence consists of the re-arranged pAG4588 sequences including a partial 223 bp Nos terminator sequence (uppercase letters, nucleotides 3290-3512 in pAG4588); the 73 bp sequence near the left T-DNA border with the first 3 bp of the processed left T-DNA border sequence (italicized lowercase letters, nucleotides 3513-3585); the 299 bp sequence near the right T-DNA border with 5 bp of the processed right T-DNA border sequence and polylinker sequence with multiple cloning sites (lowercase letters, nucleotides 9647-9945); the 359
bp 5′ sequence of the rice glutelin promoter prGTL-03 (uppercase letters, nucleotides 9946-10304). The underlined are 18 bp of a duplicated sequence that has been created during T-DNA integration process. The OB-2861 sequence is as follows: -
(SEQ ID NO: 25) GAATCCTGTTGCCGGTCTTGCGATGATTATCATATAATTTCTGTTGAATT ACGTTAAGCATGTAATAATTAACATGTAATGCATGACGTTATTTATGAGA TGGGTTTTTATGATTAGAGTCCCGCAATTATACATTTAATACGCGATAGA AAACAAAATATAGCGCGCAAACTAGGATAAATTATCGCGCGCGGTGTCAT CTATGTTACTAGATCGGGAATTGgcgagctcgaattaattcagtacatta aaaacgtccgcaatgtgttatt aagttgtctaagcgtcaa tttgttatca agttgtctaagcgtcaaacactgatagtttaaactgaaggcgggaaacga caacctgatcatgagcggagaattaagggagtcacgttatgacccccgcc gatgacgcgggacaagccgttttacgtttggaactgacagaaccgcaacg ttgaaggagccactcagcctaagcggccgcattggacttaattaagtgag gccggccaagcgtcgatttaaatgtaccacatggcgcgccaactatcatg cgatcgcttcatgtctaactcgagttactggtacgtaccaaatccatgga atcaaggtaccTCCATGCTGTCCTACTACTTGCTTCATCCCCTTCTACAT TTTGTTCTGGTTTTTGGCCTGCATTTCGGATCATGATGTATGTGATTTCC AATCTGCTGCAATATaAATGGAGACTCTGTGCTAACCATCAACAACATGA AATGCTTATGAGGCCTTTGCTGAGCAGCCAATCTTGCCTGTGTTTATGTC TTCACAGGCCGAATTCCTCTGTTTTGTTTTTCACCCTCAATATTTGGAAA CATTTATCTAGGTTGTTTGTGTCCAGGCCTATAAATCATACATGATGTTG TCGTATTGGATGTGAATGTGGTGGCGTGTTCAGTGCCTTGGaTTTGAGTT TGATGAGAGTTGCTTCTGGG - The 1127 bp OB-2868 sequence consists of re-arranged pAG4588 sequences including the 595
bp 3′ sequence of the PMI marker gene (uppercase letters, nucleotides 2594-3188 in pAG4588); the 48 bp sequence between PMI and Nos terminator (lowercase letters, nucleotides 3189-3236); the 276 bp Nos terminator sequence (uppercase letters, nucleotides 3237-3512); the 73 bp sequence near the left T-DNA border with the first 3 bp of the processed left T-DNA border sequence (italicized lowercase letters, nucleotides 3513-3585); the 119 bp sequence near the right T-DNA border with 5 bp of the processed right T-DNA border and a partial polylinker sequence (lowercase letters, nucleotides 9647-9765). The underlined are 18 bp of a duplicated sequence that has been created during T-DNA integration process. The OB-2868 sequence is as follows: -
(SEQ ID NO: 26) AAAATCCCGCGCGCTGGCGATTTTAAAATCGGCCCTCGATAGCCAGCAGG GTGAACCGTGGCAAACGATTCGTTTAATTTCTGAATTTTACCCGGAAGAC AGCGGTCTGTTCTCCCCGCTATTGCTGAATGTGGTGAAATTGAACCCTGG CGAAGCGATGTTCCTGTTCGCTGAAACACCGCACGCTTACCTGCAAGGCG TGGCGCTGGAAGTGATGGCAAACTCCGATAACGTGCTGCGTGCGGGTCTG ACGCCTAAATACATTGATATTCCGGAACTGGTTGCCAATGTGAAATTCGA AGCCAAACCGGCTAACCAGTTGTTGACCCAGCCGGTGAAACAAGGTGCAG AACTGGACTTCCCGATTCCAGTGGATGATTTTGCCTTCTCGCTGCATGAC CTTAGTGATAAAGAAACCACCATTAGCCAGCAGAGTGCCGCCATTTTGTT CTGCGTCGAAGGCGATGCAACGTTGTGGAAAGGTTCTCAGCAGTTACAGC TCAAACCGGGTGAATCAGCGTTTATTGCCGCCAACGAATCACCGGTGACT GTCAAAGGCCACGGCCGTTTAGCGCGTGTTTACAACAAGCTGTAAgagct tactgaaaaaattaacatctcttgctaagctgggagctctagaTCCCCGA ATTTCCCCGATCGTTCAAACATTTGGCAATAAAGTTTCTTAAGATTGAAT CCTGTTGCCGGTCTTGCGATGATTATCATATAATTTCTGTTGAATTACGT TAAGCATGTAATAATTAACATGTAATGCATGACGTTATTTATGAGATGGG TTTTTATGATTAGAGTCCCGCAATTATACATTTAATACGCGATAGAAAAC AAAATATAGCGCGCAAACTAGGATAAATTATCGCGCGCGGTGTCATCTAT GTTACTAGATCGGGAATTGgcgagctcgaattaattcagtacattaaaaa cgtccgcaatgtgttatt aagttgtctaagcgtcaa tttgttatcaagtt gtctaagcgtcaaacactgatagtttaaactgaaggcgggaaacgacaac ctgatcatgagcggagaattaagggagtcacgttatgacccccgccgatg acgcgggacaagccgttttacgtttgg - Event 4588.757: The event 4588.757 carries one T-DNA integration site that is located on the
maize chromosome 8. - The chromosomal location of the T-DNA integration site was determined through BLASTN searches, in which the maize genomic DNA sequences that are contained in OB-3170 and OB-3237 sequences isolated accordingly from T-DNA insertion sites at the right or left T-DNA borders, were used as the queries for screening publicly available maize B73 genome sequence databases, such as http://www.maizegdb.org/. See also Andorf, C M et al. (2015) Nucleic Acids Research doi: 0.10.1093/nar/gkv1007; Lawrence, C J et al, (2005) Plant Physiolgy 138:55-58; Lawrence, C J et al., (2004) Nucleic Acids Research 32:D393-D397, all of which incorporated herein by reference as if fully set forth.
- In the flanks OB-3170 and OB-3237, which are provided below, the maize genomic DNA is shown in the uppercase letters, while the pAG4588 vector is indicated in the lowercase underlined letters.
- The 1303 bp OB-3170 right T-DNA border flanking sequence consists of the 975 bp maize genomic DNA attached to the 328 bp of the pAG4588 vector borderless sequence proximal to the right T-DNA border site. The isolated 975 bp maize genomic DNA flank has 99.38% sequence identity to the sequence derived from the
maize chromosome 8 with nucleotide coordinates 62661042-62662016. - The OB-3170 sequence is as follows:
-
(SEQ ID NO: 27) TTGGGGTTCCTTATCCTGTTGTCGGAGTTGTGCCATTATCCTTTCCATGG TTGACCTGAGCTTTAGCCTGTACACTGTAGACTCTACTAGAGGTTTACCT GAGGCTGAATTCCCGCTGCTAAGATGTGATGTTCCCGGCCATAAGCAAAG ATGCAGGTTGTCTTTGCTTTGTAAAGATGAAGGTTGTCTTTGTTTTGTAA TCGAAAAAAAAACCCTCCGACTTCGATAGCAATCCATTTCTTGAAACGAT ATAGCTATAAGCTGCAGCCACACCTTGCGTTGATGATGCCAAAGCTTTCT TTCGAGTGCGATGCATGCACTGGCCTGTTGAGATCTTATCAATATGGCAA ACAGTAACCTAACGTATATGACTACATGGTCTTCATGCTTTTGAGAGGTG CCTCATAGGAAACAGTCAGGCCAATGATTTTAGGGAATACAATATATTTT TGCTGTTTTTTTTTTGCAAATTGTCCATATTATTACAAAAAAAACTAAAC ATGCCCAAAGGCAATAGCTTTCTAAATAAAAATGAATAACGGTCCACTTA TATATGTTGGCCAGTAATCAATTCTGAGGCCTGACAAACCATGCATATAT TAACAGTAGGTTAATGGCCGTGCGTGAAAAAATTTCAATACAACAAGAGA TTGAAAAAAAAGAGTGTCTTACCAATATGTTATTTTATAAGTACCAAATG TGTAGGAAACTTGCATTCATTTTTTCCCTGAGAATGGAAAAAAACAAGAC ATACTCATTTTCAAGTTGAATTGTCATAGCAACACACATGTTGTATCTGC CGGTTCATGCAATTGTGCCAACCAAAATATCTAAATGAGATATTCAAGAC TCAACAGAATTAAAGTATGGAATAGGGTGTATATACACTCAACCATTATT AAATGGTATAATCATCTATCTATATCACTATAAAATCTACCAGTTTAAAC TTCACAAAACTCATCTAGCTAATGGaggcgggaaacgacaacctgatcat gagcggagaattaagggagtcacgttatgacccccgccgatgacgcggga caagccgttttacgtttggaactgacagaaccgcaacgttgaaggagcca ctcagcctaagcggccgcattggacttaattaagtgaggccggccaagcg tcgatttaaatgtaccacatggcgcgccaactatcatgcgatcgcttcat gtctaactcgagttactggtacgtaccaaatccatggaatcaaggtacct ccatgctgtcctactacttgcttcatccccttctacattttgttctggtt ttg - The 960 bp OB-3237 left T-DNA border flanking sequence consists of the 620 bp of the maize genomic DNA attached to the 340 bp pAG4588 vector sequence (nucleotides 3260-3599 in pAG4588), which includes 253 bp Nos terminator sequence and 70 bp sequence upstream of the 17 bp processed left T-DNA border sequence. The isolated 620 bp maize genomic DNA flank has 100% sequence identity to the sequence derived from the
maize chromosome 8 with nucleotide coordinates 62662037-62662642. - The OB-3237 sequence is as follows:
-
(SEQ ID NO: 28) Aaacatttggcaataaagtttcttaagattgaatcctgttgccggtcttg cgatgattatcatataatttctgttgaattacgttaagcatgtaataatt aacatgtaatgcatgacgttatttatgagatgggtttttatgattagagt cccgcaattatacatttaatacgcgatagaaaacaaaatatagcgcgcaa actaggataaattatcgcgcgcggtgtcatctatgttactagatcgggaa ttggcgagctcgaattaattcagtacattaaaaacgtccgcaatgtgtta ttaagttgtctaagcgtcaatttgtttacaccacaatataAAATCTACCT GTTCGCTGATAAGCCGTTAGGTTGACTATGTGACTGTTGGGCGGCAAAAT GACCACGCGGACGGTCTAGCCCCAAAGCCGGACGGTCCGCGGTCCAGACA GTCTGCACTGGTGGTGTCGGCGTTTCGACCCCGGGGGGTCCCTGGACCGA CGAGTAAATTGTCGCTGCGTGTCCCAGCCCAGATGGGTCCGCGCGAGACG GAACGCGAAGATGGGAAAACAGCAAAGGGGAACCCGCGGCCTTCGTGTTG TCCTGCGCCCAGGTCGGGTGCGCTTGCAGTAGGGGGTTACAACCGTTCGC GTGGGAGAGACAGAGAGAGAGCGAGAGCCTTATGCGTCGGCCCGTTCTCC CGCGCGGCCAACCCTCTCGTACGAGAGCCCTGGACCTTCCTTTTATAGAC GTAAGGAGAGGGCCCAGGTGTACAATGGGGGGTGTAGCAGAGTGCTAACG TGTCTAGCAGAGAGGAGCCGGAGCCCTAAGTACATGTCGTCGTGGCTGTC GGAGAGGTTTTGGCGCCCTGTTCATGTGATGTCGTGGCCGTCGGAGGAGC GCTTGAGCCCCGTGGAAGTACAGCTGTCGGGGCTGTCGGATCCTTGCTGA CGTCTCCTTG - The maize genomic DNA flanks in sequences OB-3170 and OB-3237 are separated by 21 nucleotides on the
maize chromosome 8, which indicates that during T-DNA integration 21 bp of the original maize genomic DNA sequence were replaced by the inserted T-DNA sequences. - Event 4588.652:
FIG. 11 illustrates a diagram showing positions of the characterized flanking sequences in 4588.652. - Sequences isolated at the T-DNA insertion site in 4588.652. T-DNA in the event 4588.652 has integrated into
chromosome 7 of the maize genome in BxA genotype, which was used for maize transformation with the pAG4588 construct. The T-DNA insertion occurred between nucleotides 141683320-141683357 of the publicly available reference B73 maize genome. The T-DNA integration displaced 38 bp of the native maize genomic sequence at this site. This 38 bp DNA is underlined and the sequences of pAG4588 are underlined and shown in bold characters in the sequences of the T-DNA insertions shown below. The diagram illustrated inFIG. 11 depicts locations of the sequences in the locus in 4588.652. The right and the left border T-DNA flanking sequences, OB-4448 and OB-4451 respectively, were isolated from multiple 4588.652 progeny using a PCR-based genome walking approach. The entire genomic regions between the right and the left border flanks were isolated and sequence characterized from WT genotypes BxA, 19545 (E), 15009 (G) as well as the nulls BC2ES2_512x and BC1GS2_518x. The following wild type maize genomic DNA sequences were used for reference: the WT_BxA (OB-4541; SEQ ID NO: 32), the WT_E sequence (OB-4545, OB-4546; SEQ ID NO: 33), the WT_G sequence (OB-4547, OB-4548; SEQ ID NO: 34), the Null_BC2ES2_512x sequence (OB-4578 to OB-4580; SEQ ID NO: 35), the Null_BC1GS2_518x sequence (OB-4582 to OB-4584; SEQ ID NO: 36), and the WT_B73Chr7_141681606-141685147 reference sequence (SEQ ID NO: 37). Furthermore, the right and the left border flanks were additionally isolated and entirely sequenced from the more advanced 4588_652 transgenic progeny BC2ES2_472x. The entire 4044 bp BxA genomic sequence containing the right and the left border flanking sequences have high BLASTN identity hits to two nucleotide positions 141681606-141682538 and 141682550-141685147 on thechromosome 7 in the maize B73 genome. - Analysis of Nucleotide Sequences in the Left T-DNA Border Flank
- The left T-DNA border flank OB-4451 has 98.66% BLASTN sequence identity to nucleotides 141683358-141685147 on the
maize chromosome 7 in B73 genome. Multiple sequence alignment of the left border specific sequences from the wild type genotypes B73, BxA, 19545 (E), 15009 (G), nulls BC2ES2_512x and BC1GS2_518x as well as 4588_652 transgenic progenies 116_F1G and BC2ES2_472x and the reference public sequence of B73 genome revealed that these 1.8 kb sequences are nearly 100% identical between all genotypes. - Analysis of Nucleotide Sequences in the Right T-DNA Border Flank
- The 2218 bp right border flank OB-4448 has high BLASTN sequence identity to two nucleotide positions 141681606-141682538 and 141682550-141683319 on the
maize chromosome 7 in B73 genome. Multiple sequence alignment of the right border specific sequences from 4588_652 transgenic progenies 116_F1G and BC2ES2_472x with the WT sequence of BxA revealed that these three 2.2 kb sequences are nearly 100% identical. - A 521 bp “unique” sequence that is specific to the right T-DNA border flank has originated from genotype BxA, which was used for transformation with the pAG4588 construct. No BLASTN sequence identity hits to this sequence were identified at the T-DNA integration site within the reference B73 genome. On the other hand, the 521 bp sequence has multiple BLASTN identity hits on different chromosomes in maize B73 genome indicating that this sequence is highly repetitive. The 521 bp sequence is shown in italicized lowercase letters.
- Sequences characterized at 4588_652 T-DNA integration site. The OB-4448 sequence (extended right border flank in 4588_652 isolated from F1G of 4588_652 is as follows:
-
(SEQ ID NO: 29) CACCCTCGCTGTTGGTAAACGTGCGCCTTGGGTATGTCCTCACCTGCATG ATACGACATGTTGAAAAAGGTACATGGCTGGGCGGATTTAAACAGTAGAA TGAAAAGGTGCCACAAGAAAACTCGTCAAAGAATTGACTACGCGTCAATG TTCCATAGTTAAAAAGACTTGAACTCTGGATCAGGGACTTTCAAACAAGG ATAGCTGCCTGGTCACCAGTCATTAACTGTAATGTAATGGCCATAGATGA TGCATGAGTACAATAATAAAAAAACACCATCCAGCCAAATATATACTCCC TGTCACAAATGAAAATTCGTTTTAGATAATTAGTGGATTCATACAATATT TGTTGTATGTGTTTTATGTGTCTAGATTCATCATCCTCTATTTGAATATA GACAGAAAAATCATAACTAAAACGAATACTATTTGGGAACGGAGGGAGTA CTACTTTGGCAGAATGCCCCCAGGAAAGTACCAGTTTCAGGGGTAGTTTG GAAGGCTAAACCTAGGGAGGGAAAACCCCCCACATGTAACTAAATATCTT ATTCAAATGTTACCCCTAGGGATTACTCACCCTGGGAAATGAGAAGGGTC CCAAGGGGATTTCGGTTTCTATTATTTTTTCTGCAAACCATTTCAGAGCA ATGATATGAAACCAAGCTAACTACTTATAACATTTCTTAAGAATATCAGA CATAGGAAAGTGATGGCCTGGAACCAAAGTAAGACTGGTAGATAAATAGA TCACTAGAATAAACCCTGACAGTTCATAGCCTTCATAGAAGCAAAAGGAA ACACTACGGGAGCAATTGGTTGCTTGCACTAGCAATTCACTGCATTGGGT CTAATGCAGGATAGACTAAGCCAGCATAAGTGTGCGCAATGTGTTTGTGT TTGGTTGCCATGTTATAAGTAAGTTGCATTTGCTAATATctttctcctga ctctaatgagtccacttttgctgactggtgggcgaaagtaagtaagcaag tgcacaaatccaaaagaagaggctttaacagtatcatcatcttgggggct tggtgtttatggcttcatcgtaataaggtggtttttgatggtgtcagtcc ttcaattattggcataaaggcaatttttttggatgaagttgaattctgga ggcttgccggtgctaggcatcttgaggctttggttcctggtgctggaatt tttaggtcaagggttcttttgggtgattagtgaagagcaggtgtgtgtgg tctgctcgcactttttgttgttcgttctcctattgcgtgctgttgtttcc aggcgcatttatggaggctgcagttttgtgcgcagcagaagttggtggtt ttgtgttttgtgttttgcctattttggcattgtactttggtccattttgg actgttttcttctcttaatttaatgatgtgcagctctcctgcgcgtttaa gaaaaaaaaaAGTTGGCTGTTTTGTATTTCTTGTGATCACCCATGCTTGT TGTGGTCAGATTAAACTCTCACGTTTAATGCTACAGAAGCATCCATGAGA CAATGAAACACCGCTCAAAAGCCACGTAGTAGCATACCCTGACTTATGAA TAAAGCAACTCGATCTGATTTATTTGAGAAAACAGGAAACTGACAAGTTA TTTTTAACACAAAATTTCATTAAAAACGAATGGTAGACAATTACCAATCT GTAGGTCCCTGGCTTGCAAGTCCTCCCAATGTCTAAGAAATCAAATAGGA ACTGCAGGCAAGCCAGCAAGAAAGTATTAATCACTGGATATAAAATATAA AGAAAAAAGAAGGAAAGACGGCTACTCGGCTAGCATATGTTTTTGTTAGG GGTGAAAATGGATACTTATTCAGAAATCATTTTTGATCTTTTTTCTTTAA TTAGGAATAAATAGGATATAGAATATGCTAAGCAAATTCATATTCTTGTT CTTAGCATTGGGCTTGTAAAGATTCATAAAAGGTAAATCTCAAATTTATC ATATATCTTAAATGGTAGATATAAAATTCAGATACAAATATTTTTCAACT TTTTTGTTGTAGGGAACAAATTATATTAAAAAAAATTATGCACAATTCTA TTCTTATTTGTAATAATGTGCTTGATAACATAATAAAAGATTACCATCAA ATTTCACACACACCCACCCACCCACCCACCCCTGCACGCACGCGCGCGCA CACACACTATATGTGTGTtcaaacactgatagtttaaactgaaggcggga aacgacaacctgatcatgagcggagaattaagggagtcacgttatgaccc ccgccgatgacgcgggacaagccgttttacgtttggaactgacagaaccg caacgttgaaggagccactcagcctaagcggccgcattggacttaattaa gtgaggccggccaagcgtcgatttaaatgtaccacatggcgcgccaacta tcatgcgatcgcttcatgtctaactcgagttactggtacgtaccaaatcc atggaatcaaggtacctccatgctgtcctactacttgcttcatccccttc tacattttgttctggtttttggcctgcatttcggatcatgatgtatgtga tttccaatctgctgcaatatgaatggagactctgtgctaaccatcaacaa catgaaatgcttatgaggcctttgctgagcagccaatcttgcctgtgttt atgtcttcacaggccgaattcctctgttttgtttttcaccctcaatattt ggaaacatttatctaggttgttttgtgtccaggcctataaatcataaatg atgttgtcgtattggatgtgaatgtggtggcgtgttcagtgccttggatt tgagt - The RB_BC2ES2_472x sequence (extended RB flank isolated from the advanced progeny of 4588_652) is as follows:
-
(SEQ ID NO: 30) CACCCTCGCTGTTGGTAAACGTGCGCCTTGGGTATGTCCTCACCTGCATG ATACGACATGTTGAAAAAGGTACAAGGCTGGGCGGATTTAAACAGTAGAA TGAAAAGGTGCCACAAGAAAACTCGTCAAAGAATTGACTACGCGTCAATG TTCCATAGTTAAAAAGACTTGAACTCTGGATCAGGGACTTTCAAACAAGG ATAGCTGCCTGGTCACCAGTCATTAACTGTAATGTAATGGCCATAGATGA TGCATGAGTACAATAATAAAAAAACACCATCCAGCCAAATATATACTCCC TGTCACAAATGAAAATTCGTTTTAGATAATTAGTGGATTCATACAATATT TGTTGTATGTGTTTTATGTGTCTAGATTCATCATCCTCTATTTGAATATA GACAGAAAAATCATAACTAAAACGAATACTATTTGGGAACGGAGGGAGTA CTACTTTGGCAGAATGCCCCCAGGAAAGTACCAGTTTCAGGGGTAGTTTG GAAGGCTAAACCTAGGGAGGGAAAACCCCCCACATGTAACTAAATATCTT ATTCAAATGTTACCCCTAGGGATTACTCACCCTGGGAAATGAGAAGGGTC CCAAGGGGATTTCGGTTTCTATTATTTTTTCTGCAAACCATTTCAGAGCA ATGATATGAAACCAAGCTAACTACTTATAACATTTCTTAAGAATATCAGA CATAGGAAAGTGATGGCCTGGAACCAAAGTAAGACTGGTAGATAAATAGA TCACTAGAATAAACCCTGACAGTTCATAGCCTTCATAGAAGCAAAAGGAA ACACTACGGGAGCAATTGGTTGCTTGCACTAGCAATTCACTGCATTGGGT CTAATGCAGGATAGACTAAGCCAGCATAAGTGTGCGCAATGTGTTTGTGT TTGGTTGCCATGTTATAAGTAAGTTGCATTTGCTAATATctttctcctga ctctaatgagtccacttttgctgactggtgggcgaaagtaagtaagcaag tgcacaaatccaaaagaagaggctttaacagtatcatcatcttgggggct tggtgtttatggcttcatcgtaataaggtggtttttgatggtgtcagtcc ttcaattattggcataaaggcaatttttttggatgaagttgaattctgga ggcttgccggtgctaggcatcttgaggctttggttcctggtgctggaatt tttaggtcaagggttcttttgggtgattagtgaagagcaggtgtgtgtgg tctgctcgcactttttgttgttcgttctcctattgcgtgctgttgtttcc aggcgcatttatggaggctgcagttttgtgcgcagcagaagttggtggtt ttgtgttttgtgttttgcctattttggcattgtactttggtccattttgg actgttttcttctcttaatttaatgatgtgcagctctcctgcgcgtttaa gaaaaaaaaaAGTTGGCTGTTTTGTATTTCTTGTGATCACCCATGCTTGT TGTGGTCAGATTAAACTCTCACGTTTAATGCTACAGAAGCATCCATGAGA CAATGAAACACCGCTCAAAAGCCACGTAGTAGCATACCCTGACTTATGAA TAAAGCAACTCGATCTGATTTATTTGAGAAAACAGGAAACTGACAAGTTA TTTTTAACACAAAATTTCATTAAAAACGAATGGTAGACAATTACCAATCT GTAGGTCCCTGGCTTGCAAGTCCTCCCAATGTCTAAGAAATCAAATAGGA ACTGCAGGCAAGCCAGCAAGAAAGTATTAATCACTGGATATAAAATATAA AGAAAAAAGAAGGAAAGACGGCTACTCGGCTAGCATATGTTTTTGTTAGG GGTGAAAATGGATACTTATTCAGAAATCATTTTTGATCTTTTTTCTTTAA TTAGGAATAAATAGGATATAGAATATGCTAAGCAAATTCATATTCTTGTT CTTAGCATTGGGCTTGTAAAGATTCATAAAAGGTAAATCTCGAATTTATC ATATATCTTAAATGGTAGATATAAAATTCAGATACAAATATTTTTCAACT TTTTTGTTGTAGGGAACAAATTATATTAAAAAAAATTATGCACAATTCTA TTCTTATTTGTAATAATGTGCTTGATAACATAATAAAAGATTACCATCAA ATTTCACACACACCCACCCACCCACCCACCCCTGCACGCACGCGCGCGCA CACACACTATATGTGTGTtcaaacactgatagtttaaactgaaggcggga aacgacaacctgatcatgagcggagaattaagggagtcacgttatgaccc ccgccgatgacgcgggacaagccgttttacgtttgg - The OB-4451 sequence (extended left border flank in 4588_652 is as follows:
-
(SEQ ID NO: 31) gggcccggtagttctacttctgttcatgtttgtgttagatccgtgtttgt gttagatccgtgctgctagcgttcgtacacggatgcgacctgtacgtcag acacgttctgattgctaacttgccagtgtttctctttggggaatcctggg atggctctagccgttccgcagacgggatcgatttcatgattttttttgtt tcgttgcatagggtttggtttgcccttttcctttatttcaatatatgccg tgcacttgtttgtcgggtcatcttttcatgcttttttttgtcttggttgt gatgatgtggtctggttgggcggtcgttctagatcggagtagaattctgt TACCCACTTTCATCCCTAGTTTTTGTTCTGGATTCAAGCATCTCAAAATT GTTTACCTGAAGTTTATCAGTTTTGAGAAAGCGGCGCCCCTGTCGACTAC CATCAGGCATTCGGACTACAACTGTCACAGCACCCTCTGCGTCTGGAGAC GGTTCCGGTGGTAATGATGCTTGCTTCGAAGTGAGACTGGACTCTAGCTC CTATTTAATCAAAACATCAGGGACAACATGACAAATAGTAGTCAAATATC CAGGCAAGAAAAAAAAACCATAAACAATGAAAATACTGATCAAAAGTCCT GTTTGGATCTCCTAAGAAAAATGAGAATGAGATCCAAACAATTGGATTCT AGAATCCAGCTATCTATCCCAAACCCATTATTTGGCGAGATTTTCACTAT GCAGAGGCAATGATCACTATAAGAATAAGATTCAAACACCCACTTATTAT TTTTTTAATCCAGAAACCAGATTCTACATTCACTATAGAATCCAGAACTT CAATATGGGAATGAGATCCAAATAGACCCTAAGCCAAAATGAAATTGGTG AGATGAAGTGGCTAGTTGTCATAACCTCCTGTAAAGAAGACAGCGGTTTA CAGTCCCAACACCCAAATAAACATGACATTAATATAATGACTACAACTCA CAACCTAAACCTAAACCAATATACATCCAAACATAAGACAAAAGGAGAAC TGAGTTTTATATGATCACACTGATGAACTGATGCTGTAGTCTAGCATTCA AGTGTTTAAGATAGTTGACTATAAACCCTTCACCTTGCAGATTACATGTG ACAGAAAGATACCTCTTCCTCAAGTTGTTTTTTACGCCTTTCCTCCTCCT CTTGCTTCTGTTTCTCAAGAACAGCTTCTCTCGCAGCTGTTTCTTCAAGG CGACGGAGCTCAGCCTCCTGTAGGGCCTTTAACTCCTTTTCTTGATCAGC TTGTAGCGATGCAAGGTACTCATCGTCCTACAAATTTAAAATTTATAAAA GTGCTCACCCATAGTGGCAATTATGAACAATGGATAAATCTTAGACCTCA AACCTGCTGCTCTCGTAATAACCGCTGTTCAGTTAATGCTGGTGATGGAG AATGAGATATTGGGGGATAATAAGTAGAGGTTCTGTGAGAAGGCATAGAG AAAGGATATGTTGGTCCACCAAACATTGCAGCCTCAAGCATAACAGCTTC ATCATGTTCCTCAGAAGAAATGCCACCCCACTTTATTGTAAAAAAAGACG TCAGAAATTAAACAAATCCATCTAATGTCTTAGCGCACATTGGAACCACA GATTATAATACCTCAGATGGGAAATCATCTCCATTATACTGGTGATTGTT CAGAACAGGGCTAGCACCTGGGTGCACTATTTTTGGTAATTCATTGTCCT CAGAAGGGGCACGCCGAGAACGACGCCTAACTAACGGCTGTTCTTCTACA TCTTCAGCCTCCTCCTGGAAGCTCTCGTCATCTATTGGTTGCCTAGATGT TCCAGCCTTTCCTGAAGCTAGTCCTTGCCTCCAAAAGGAAATTGCATGTA TAAGGAATCAAATGATACTGTAGTAGGGTAGCCTGAGTGAAGAGGTGGGT AGTAAAGTTAACATTCACCTCTCAACTATTCCATTTGCGGTTTCCATGCC TGCTTTATCAGAAGAATGGTCCCTCAAATTCACTTCCTCTTGATGCTGGC CTCCTTGCTCGACTATCTGATGATTATTGAAAAATTAGAGATGACATCAA GATAGGTTCAAGTAAGCATGTTGGGGA - Several “T1” progeny from original “T0” transgenic maize plants were grown, and individual ears were either self-pollinated or pollinated with pollen from wild-type maize plants. Mature seed from the resulting ears was then assayed for feed glucanase activity via the colorimetric assay.
FIG. 12 illustrates that glucanase activity was observed in T1 events. In this figure, the numbers along the abscissa correspond to the event identifiers of the original T0 plants from which the progeny were derived. The highest activity was observed for seeds of T1 plant derived from the 4597_69 event. - Progeny from original “T0” transgenic maize plants were grown and backcrossed (pollinated with pollen from the wild type maize parents or pollinated onto the wild type parents) for 4 generations (in maize inbred line E (BC4E), or in maize inbred line G (BC4G)). At each generation, some individual ears were self-pollinated. PCR method was applied to select homozygous plants as described in Example 8. Hybrid ears were made by cross-pollinating transgenic line G plants with transgenic line E plants, or vice versa.
-
FIG. 13 illustrates that glucanase activity in the hemizygous, homozygous and hybrid ears of event 4588.259. The homozygous and hybrid ears contained average activity of 190 units/g, which was approximately double of ears from hemizygous plants. - Maize glucanase events 4588.259, 4588.652, and 4588.757 carry transgenes that result in seed-specific expression of glucanase enzyme. Event 4588.259 originally carried two T-DNA insertions at independently segregating loci, but subsequently a single genetic locus was selected for propagation and development. Events 4588.652 and 4588.757 carry two or more T-DNAs at a single genetic locus. Molecular identification and tracking of these transgenes can be done using standard PCR analysis (visually scoring an endpoint in a gel-based electrophoresis and staining of the PCR products) or real-time PCR. In addition to determining whether a plant is carrying a transgene, some of these PCR assays can also determine whether a plant is hemizygous (carrying one copy of the insertion) or homozygous (carrying two copies of the insertion).
-
FIG. 24 illustrates general real-time PCR assay design used to determine T-DNA locus presence (standard and real-time PCR) and zygosity (real-time PCR only). - In
FIG. 14 , the standard and real-time PCR assays include, for each T-DNA locus, one primer (Primer A) that binds to a maize genomic region that is adjacent to where the T-DNA insert is located and one primer (Primer B) that binds to a region in the T-DNA that is close to Primer A. To determine zygosity in the real-time PCR assay, a second reference gene (GWD, glucan water dikinase) is amplified (X and Y primers) along with the locus primers. Real-time PCR amplification of product from Primers A+B would indicate that the T-DNA locus is present and its fluorescence relative to the GWD reference (ref) fluorescence from amplification of product from Primers X+Y would determine whether it is hemizygous (one-copy) or homozygous (two-copy). - The standard multiplex PCR assay includes Primer A and B, as described above, but also another primer (Primer C) that binds to a maize genomic region on the other side of the T-DNA, opposite Primer A, and would be close to Primer A if the T-DNA insertion was not present, as in a wild type (WT) locus.
FIG. 15 illustrates general standard PCR assay design used to determine T-DNA locus presence and zygosity. When the T-DNA insertion is present, the distance between Primer A and Primer C would be too large to amplify a product under our PCR amplification conditions and therefore absence of this amplification product is used to determine zygosity. PCR amplification of products from Primer A+B and Primer A+C indicates that the T-DNA locus is present and is hemizygous (one-copy). PCR amplification of product from Primer A+B, but not Primer A+C, indicates that the T-DNA locus is present and is homozygous (two-copy). PCR amplification of product from Primer A+C only, indicates that no T-DNA is present and the plant is WT at this locus. Primers and probes for all of these assays are listed in Tables 3 and 4. -
TABLE 3 Standard and real-time (RT) PCR primers and probes used to determine T-DNA locus presence and ocus presence and zygosity of 4588.259, 4588.652, and 4588.757 events Primer/ PCR Primer Probe Assay Event or Probe ID (type) Primer Sequence Fluor* Quencher Standard/RT 4588.259 Primer 509 (A) GAATTGTTCATCATAAGGCGTGA (SEQ ID NO: 38) Standard/RT 4588.259 Primer 516 (B) AACGTGACTCCCTTAATTCTCC (SEQ ID NO: 39) RT 4588.259 Probe PB5 AAACTGAAGGCGGGAAACGACAAC HEX BHQ1 (SEQ ID NO: 40) Standard/RT 4588.652 Primer 750 (A) GAGATGCTTGAATCCAGAACAAA (SEQ ID NO: 41) Standard/RT 4588.652 Primer 751 (B) TTGTCTTGGTTGTGATGATGTG (SEQ ID NO: 42) Standard 4588.652 Primer 749 (C) GATTACCATCAAATTTCACACACAC (SEQ ID NO: 43) RT 4588.652 Probe PB17 TAGAACGACCGCCCAACCAGAC HEX BHQ1 (SEQ ID NO: 44) Standard 4588.757 Primer 513 (B) AAACGTCCGCAATGTGTTATT (SEQ ID NO: 45) Standard 4588.757 Primer 608 (C) TCATGCAATTGTGCCACC (SEQ ID NO: 46) Standard 4588.757 Primer 609 (A) ACATAGTCAACCTAACGGCTTAT (SEQ ID NO: 47) RT GWDref Primer 371 (X) GGTTATAAGCCCGGTTGAAGTA (SEQ ID NO: 48) RT GWDref Primer 525 (Y) CTATTCCTTGCTCGGACTGAC (SEQ ID NO: 49) RT GWDref Probe PB2 CACCTGATATGCCAGATGTTCTGTCTCA FAM BHQ1 (SEQ ID NO: 50) *Fluor = fluorophore. -
TABLE 4 4588.259, 4588.652, and 4588.757 event-specific PCR primer combinations and PCR product sizes Primer Primer Primer PCR Product Event A B C (bp) Assay Identifies 4588.259 509 516 137 T-DNA locus: OB-2880 (SEQ ID NO: 51) 4588.652 750 751 107 T-DNA locus: OB-4451 (SEQ ID NO: 52) 4588.652 750 749 174 WT locus (SEQ ID NO: 53) 4588.757 609 513 100 T-DNA locus: OB-3237 (SEQ ID NO: 54) 4588.757 609 608 218 WT locus: B73ref (SEQ ID NO: 55) - PCR assay using primers X (371) and Y(525) identifies the ZmGWDref locus (SEQ ID NO: 56).
- DNA Extraction
- These PCR assays will work with any DNA extraction method that yields DNA that can be amplified with PCR. A standard DNA extraction method (10X TE+Sarkosyl) that was used in this example is as follows: leaf tissue (standard 1 cm hole punch) is sampled into a 96 deep-well block, metal beads are added, and the block is frozen at −80° C. for at least 30 min. The block is then ground for 45 sec in a Kleco Pulverizer, centrifuged at 4,000 RPM for 3 min, the lid is removed, 300 μl of 10XTE+Sarkosyl is added, the block is resealed, and the block is mixed at room temperature for 10-20 min. After incubation, the block is centrifuged at 4,000 RPM for 5 min, 165 μl of upper aqueous phase is removed and added to a 96-well PCR block, the PCR block is sealed, and the block is incubated at 90° C. for 30 min. After incubation, 20 μl of extract is added to 180 μl of sterile water in a 96-well plate (1:10 dilution) to create the final DNA sample for PCR.
- PCR
- Events 4588.259, 4588.652, and 4588.757 standard and real-time PCR primers are listed in Table 3 and standard PCR primer combinations with expected PCR product sizes are listed in Table 4.
- Standard PCR is performed with 2 μl of DNA extract and GoTaq (Promega) or Kapa 3G (Kapa Biosystems) PCR Mix in 30 μl reaction volumes with the following components and conditions for each event:
- Event 4588.259 Standard PCR:
- Components (final concentration) were as follows: PCR Mix with buffer, MgCl2, nucleotides, and enzyme (1×); primer 509 (400 nM) and primer 516 (400 nM). Conditions were as follows: 95° C., 3 min; 33 cycles (95° C., 30 sec; 55° C., 30 sec; 72° C., 30 sec); 72° C., 8 min.
- Event 4588.652 Standard PCR:
- Components (final concentration) were as follows: PCR Mix with buffer, MgCl2, nucleotides, and enzyme (1×), primer 749 (400 nM), primer 750 (400 nM), and primer 751 (400 nM). Conditions were as follows: 95° C., 3 min; 33 cycles (95° C., 30 sec; 55° C., 30 sec; 72° C., 30 sec); 72° C., 8 min.
- Event 4588.757 Standard PCR:
- Components (final concentration) were as follows: PCR Mix with buffer, MgCl2, nucleotides, and enzyme (1×), primer 513 (400 nM), primer 608 (400 nM), and primer 609 (400 nM). Conditions were as follows: 95° C., 3 min; 33 cycles (95° C., 30 sec; 55° C., 30 sec; 72° C., 30 sec); 72° C., 8 min.
- Standard PCR was analyzed by running approximately 15 μl of PCR product on a 3% agarose gel at 95V for 30 min. An example of results from a standard PCR analysis of the 4588.652 selfed segregating plants is shown in
FIG. 16 . Referring to this figure, ten PCR reactions from 10 independent plants were separated on a 3% agarose gel stained with ethidium bromide. Expected locus and zygosity band sizes are indicated on the right side of the image. - Locus presence and zygosity is scored by visualizing specific bands in each lane.
- Real-Time PCR was performed with 2 μl of DNA extract in 20 μl reaction volumes with the following components and conditions for each event:
- Event 4588.259 Real-Time PCR:
- Components (final concentration) were as follow: PCR Mix with buffer, MgCl2, nucleotides, and enzyme (1×), primer 509 (400 nM, primer 516 (400 nM), primer 371 (400 nM), primer 525 (400 nM), probe PB5 (200 nM) and probe PB2 (200 nM). Conditions were as follows: 95° C., 4 min; 40 cycles (95° C., 5 sec; 60° C., 45 sec)
- Event 4588. 652 Real-Time PCR:
- Components (final concentration) were as follows: PCR Mix with buffer, MgCl2, nucleotides, and enzyme (1×), primer 750 (400 nM), primer 751 (400 nM), primer 371 (400 nM), primer 525 (400 nM), probe PB17 (200 nM) and probe PB2 (200 nM). Conditions were as follows: 95° C., 4 min; 40 cycles (95° C., 5 sec; 60° C., 45 sec)
- Event 4588. 259 Real-Time PCR. Real-Time PCR can be analyzed by any real-time PCR machine and software capable of four-channel fluorescence detection. A Bio-Rad CFX96 real-time PCR machine and CFX Manager Software were used to run an example of the 4588.259 real-time PCR assay on a selfed segregating population of 4588.259 plants.
FIG. 17 illustrates an example of real-time PCR data for 4588.259 to determine locus presence and zygosity. In this figure, “RFU” refers to relative fluorescence units; “ntc” refers no target control. Presence of the 4588.259 locus and zygosity was scored by the clustering of data points on the graph. - Silks on wild-type plants were pollinated with pollen from individual transgenic plants (WT×Transgenic), or silks on transgenic plants were pollinated with pollen from wild-type plants (Transgenic×WT). Mature, dried seed were collected from the resulting ears and planted into soil. Following 1-2 weeks of incubation, germination rates were calculated. In some cases, this test was repeated following a second generation of growth and pollination (T2). Examples of results from such germination tests are shown in Table 5.
-
TABLE 5 Germination rates among seed expressing beta glucanase Germi- WT × Transgenic × nation Vector Event Transgenic WT Generation Sow % 4588 54 x T1 50 92 4588 17 x T1 50 82 4588 11 x T1 30 80 4588 161 x T1 15 67 4588 162 x T1 11 27 4588 215 x T1 13 62 4588 219 x T1 10 80 4597 18 x T1 30 37 4597 54 x T1 10 100 4597 56 x T1 10 100 4597 69 x T1 14 14 4597 69 x T1 30 73 4588 161 x T1 20 100 4597 101 x T1 33 90 4597 104 x T1 30 70 4588 259 x T2 17 100 4588 251 x T2 17 100 4588 54 x T2 17 47 4597 101 x T2 20 100 4597 104 x T2 20 100 - The germination rate in T1 and/or T2 for events 4597_54, 4597_56, 4588_161, 4588_252, 4588_259, 4597_101, and/or 4597_104 was observed to be 100%.
- Milled grain from transgenic plants expressing the feed glucanase was mixed with starter and grower corn-soy diets that were formulated for broiler chickens. The basal corn-soy diet for starter broilers was composed as follows: 54.89% corn 08-2012, 32.81% soybean oilcake, 5.00% distillers dry grains plus soluble solids, 2.00% vermiculite, 1.99% dicalcium phosphate, 1.00% poultry fat, 0.81% limestone fine, 0.50% plain salt (NaCl), 0.20% DL-methionine, 0.20
% choline chloride 60, 0.20% mineral premix, 0.13% L-lysine, 0.12% L-threonine, 0.05% vitamin premix, 0.05% coban, and 0.05% selenium premix. The basal corn-soy diet for grower broilers was composed as follows: 58.53% corn, 26.63% soybean oilcake, 8.00% distillers dry grains plus soluble solids, 2.00% vermiculite, 1.69% dicalcium phosphate, 1.00% poultry fat, 0.76% limestone fine, 0.50% plain salt (NaCl), 0.20% mineral premix, 0.20% choline chloride 60, 0.13% DL-methionine, 0.13% L-lysine, 0.08% L-threonine, 0.05% vitamin premix, 0.05% coban, and 0.05% selenium premix. - Fine corn was ground using the hammermill screens: no. 4/4 for the starter diet and no. 6/6 for the grower and finisher diets. Coarse corn (5% of total corn) was ground with the roller mill with 0/100 gap openings.
- Four diets were formulated for the pelleting trial as follows: Diet A was a basal diet, Diet D was the basal diet mixed with a control enzyme, Diet E was the basal diet mixed with the milled transgenic corn grain containing a high level of glucanase, and Diet F was the basal diet mixed with the milled transgenic corn grain containing a low level of glucanase.
- Milled grain from transgenic plants expressing the feed glucanase was mixed with the basal diets at a ratio of approximately 1 lb transgenic grain per 2000 lbs basal diet mixture. For the low dose diet, transgenic grain was first mixed with non-transgenic grain at a weight ratio of 1:4 (1 gram of transgenic grain per 4 grams non-transgenic grain) to dilute the enzyme concentration prior to adding this ingredient to the basal diets.
- All feed diets were pelleted at 175-180° F. into 4.4 mm pellets, and the starter diets were crumbled.
-
FIGS. 18A and 18B illustrate glucanase activity before and after pelleting in the Grower Diet (FIG. 18A ) and the Starter Diet (FIG. 18B ). Referring to these figures, samples from the resulting mixture were then removed before and after pelleting of the feed. These samples were then tested via the colorimetric glucanase assay to determine whether the enzyme survived the pelleting process. The identity of the various diets shown inFIGS. 18A and 18B were as follows: A, basal control diet (no external enzyme); D, positive control diet (commercially available enzyme added); F, low-dose diet (including milled grain from plants that express the feed glucanase); E, high-dose diet (including milled grain from plants that express the feed glucanase). It was observed that glucanase activity was high in the high-dose diet for both the Starter Diet and the Grower Diet and survived pelleting. - Feed glucanase was prepared via microbial expression and purification, and suspended in SEC buffer (100 mM MES, 300 mM NaCl, pH6.3). Five microliters of this preparation was mixed with 20 mg milled grain from wild-type maize. In parallel, 5 μl of SEC buffer was mixed with 20 mg milled grain from transgenic plants that express feed glucanase. Replicates from each of these two sets of samples were incubated at 94° C. or −130° C. for various periods of time, then allowed to cool to room temperature. Subsequently, residual glucanase activity was measured via the colorimetric assay.
FIGS. 19 A and 19B illustrate glucanase activity after heat treatment.FIG. 19A illustrates glucanase activity after treatment at 130° C.FIG. 19B illustrates glucanase activity after treatment at 94° C. In these experiments, more activity survived when the feed glucanase was produced in the grain itself than when it was added to the grain exogenously. This finding demonstrates that expression and accumulation of the enzyme in grain effectively provides the enzyme with additional thermal stability relative to the same enzyme that is produced microbially. In this particular instance both the grain-expressed and the microbially-expressed enzymes have the same primary amino acid sequence. Therefore, the enhanced thermal stability that was observed in the flour from transgenic grain is a function of the expression host. - AGR2314 activity was measured at several pH values between 3 and 8.5. Each assay (500 μL) contained Britton-Robinson polybuffer (40 mM sodium phosphate, 40 mM sodium borate, and 40 mM sodium acetate), 0.01% (v/v)
Tween 20, one Beta-glucazyme substrate tablet (Megazyme, Wicklow, Ireland), and 20 nM of AGR2314 in a 2 mL Eppendorf tube. Samples were incubated for 1 hour at 37° C. or 80° C. Reactions were terminated by the addition of 1 mL of 2% (w/v) tris base. Samples were centrifuged at 15,000×g for 10 minutes, and 100 μL of each supernatant (37° C. assays) or 5 μL supernatant plus 100 μL of water (80° C. assays) was transferred to a flat-bottomed 96-well microplate. Absorbances were read at 590 nm. Assays at each pH value were performed in triplicate. Single blank assays (containing no enzyme) were performed at each pH, and these absorbance values were subtracted from the assays containing enzyme. -
FIGS. 20 and 21 illustrate the optimum pH for measuring AGR2314 activity at 37° C. (FIG. 20 ) and 80° C. (FIG. 21 ). Referring toFIG. 20 , the optimum pH was determined to be 7-7.5 at 37° C.FIG. 21 illustrates that the optimum was determined to be 6 at 80° C. -
FIG. 22 shows an example of pH optimum of the feed glucanase that is produced in transgenic flour. - To determine the relationship between the pH of the assay conditions and the activity of the enzyme that was derived from transgenic grain, 5 ml of water containing 0.2% Tween-20 was mixed with 200 mg of flour from transgenic seed on a rotating platform for 1 hour at 60° C. Following centrifugation at 1500×g for 20 minutes in a clinical centrifuge, the supernatant was transferred to a 15 mL Eppendorf tube. This sample was centrifuged at 1500×g for 10 minutes in a tabletop centrifuge. Aliquots of this protein extract were diluted 20-fold in assays to test each pH condition by mixing 50 μl of extract with 950 μl of Britton-Robinson polybuffer (40 mM sodium phosphate, 40 mM sodium borate, and 40 mM sodium acetate) that had been prepared at pH 2-10. The pH of each reaction mixture was checked using a pH strip. Five hundred microliters from each mixture was transferred to a 96 deep-well plate for the assay. One beta-glucazyme tablet was added to each well and mixed by gentle vortexing, the plate was sealed and incubated at 80° C. for 1 hour. The reactions were stopped by adding 1 mL of 2% (w/v) Tris-base to each well. The 96-well plate was centrifuged at 3000×g for 10 minutes in a clinical centrifuge, then 100 μL of the supernatant from each of the samples was transferred to wells in a flat-bottom microplate, and the absorbance at 590 nm was determined on a microplate spectrophotometer. As shown in
FIG. 22 , the seed-produced enzyme has a pH optimum between pH6 and pH7, but still retains a large fraction of its activity at a pH as high as 10. - All reactions used 5 nM of AGR2314, AGR2414, or 5 μL of control enzyme at the indicated concentrations, in 200 mM sodium phosphate, 0.01% (v/v)
Tween 20, pH 6.5. Reactions were carried out for one hour at either 37° C. or 80° C. and terminated as described. - Beta-glucosidase assays: the substrate was 1 mM pNP-D-glucopyranoside (Sigma Chemical Co. catalog # N:7006) and the positive control enzyme was Rhizobium etli beta-glucosidase (Prozomix, catalog No. PRO-E0110; 315.9 Unit/mL). Reaction volumes were 500 μL; reactions were terminated by the addition of 500 L of 2% (w/v) tris base. After centrifugation at 3000×g for 10 minutes, 100 μL of supernatant was transferred to a microplate and the absorbance at 405 nm was recorded.
- Endocellulase assays: each assay contained one tablet of Cellazyme C substrate (Megazyme, catalog No, T-CCZ) in 500 μL buffer. Reactions were terminated by the addition of 1 mL of 2% tris base. Samples were centrifuged for 10 minutes at 15,000×g, 100 μL of supernatant was transferred to a microplate, and the absorbance at 590 nm was recorded.
- Exocellulase (cellobiohydrolase) assays: the substrate was 1 mM pNP-D-cellobioside (Sigma catalog No. N5759) and the positive control enzyme was CBHI from Trichoderma longibrachiatum (Megazyme catalog No. E-CBHI; 0.5 Units/μL). Reaction conditions were as described above for the beta-glucosidase assays.
- Anylase assays: the substrate was Red Starch (Megazyme catalog No. S-RTAR; prepared as directed by the manufacturer) and the positive control enzyme was α-amylase from Bacillus licheniformis (Megazyme catalog No. E-BLAAM: 3000 Units/mL). 245 μL buffer, 5 μL of enzyme, and 125 μL of Red Starch reagent were mixed and incubated as described above. Reactions were terminated by the addition of 625 μL ethanol. After incubating at room temperature for 10 minutes, samples were centrifuged for 10 minutes at 3000×g, and 100 μL of supernatant was transferred to a microplate; absorbance at 510 nm was recorded.
- Endoxylanase assays: each assay contained one tablet of Xylazyme AX substrate (legazyme catalog No, No. XAX-1000) and the positive control enzyme was 100 mg/mL of Thermomyces lanuginosis xylanase (Sigma catalog #X2753) in assay buffer. Reactions were carried out as described above for the endocellulase assays.
- Pectinase assays: the substrate was 25 mg/mL pectin (Sigma catalog No. P7536) in assay buffer and the positive control enzyme was pectinase from Aspergillus niger (Sigma catalog No. 17389) at 100 mg/mL in assay buffer. Five p L of enzyme was added to 35 PL of pectin solution and incubated as described above. Reactions were terminated by the addition of 60 μL of DNS stop/reagent solution (Wicher et al. [2001], Appl. Microbiol. Biotechnol. 55, p. 578) followed by heating at 950° C. for 15 minutes. Samples were centrifuged at 3000×g for 10 minutes, 20 μL supernatant was mixed with 100 μL water in a microplate, and the absorbance at 550 nm was recorded.
- 1,3-beta-glucosidase assays: each assay contained one tablet of 1,3-beta-glucazyme HS substrate (Megazyme catalog No. ET-CUR200) and the positive control enzyme was Trichoderma sp. 1,3-β-D-glucanase (Megazyme catalog No. E-LAMSE; 50 Units/mL). Reactions were carried out as described above for the endocellulase assays.
- 1,4-beta-glucosidase assays: each assay contained one tablet of Beta-glucazyme substrate (Megazyme catalog No. TBGZ-1000T). Reactions were carried out as described above for the endocellulase assays, except that 5 μL of supernatant was mixed with 100 PL of water in a microplate for recording of absorbance.
-
FIGS. 23A and 23B illustrate the glucanase activity for hydrolyzing starch, cellobiose (pNP-D-cellobioside), xylan (Xylazyme AX), HE-cellulose (Cellazyme C), barley-B-glucan (Beta-glucazyme), pectin and PNP-D-gluopyranoside at 37° C. (FIG. 23A ) and 80° C. (FIG. 23B ). Referring to these figures, it was observed that both AGR2314 and AGR2414 enzymes were highly active in hydrolyzing cellobiose and HE-cellulose at 37° C. and 80° C. - Glucose release from
untreated seed fiber 20 mg seed fiber was digested at pH 5.0 with 5 μM AGR2314 protein for 72 hours at 55 C. A commercial enzyme cocktail was used at full loading (FCT) as a positive control. After enzymatic hydrolysis, the soluble sugars in reaction supernatant were hydrolyzed into monomers via acid hydrolysis at 121° C.FIGS. 24A and 24B illustrate release of monomeric sugars after enzymatic hydrolysis of the seed fiber.FIG. 24A shows glucose yield andFIG. 24B shows xylose yield. Pre-acid hydrolysis (light gray bars) and total (dark gray bars) sugars were separated and quantified via HPLC using a Bio-Rad Aminex HPX-87-P ion-exclusion column. AGR2314 does not release monomeric glucose or xylose from untreated seed fiber. However, this enzyme was able to solubilize untreated seed fiber into oligosaccharides which account for approximately 80% of the total sugars released by a commercially-available cellulase-enzyme cocktail. - Glucose release from dilute acid-pretreated
seed fiber 20 mg seed fiber was pretreated at 80 C in 0.5% H2SO4 for 16 hours, then neutralized to pH 5.0. The pretreated seed fiber was digested at pH 5.0 with 2 μM AGR2314 and a suite of glucanase, cellobiohydrolase, endoglucanase, and beta-glucosidase (all at 2 μM loading) for 72 hours at 55° C. A commercial enzyme cocktail (Accellerase XY, Genencor) was used at full loading (FCT) as a positive control. After enzymatic hydrolysis, the soluble sugars in reaction supernatant were hydrolyzed into monomers via acid hydrolysis at 121° C.FIGS. 25A and 25B illustrate release of monomeric sugars after enzymatic hydrolysis of the seed fiber.FIG. 25A shows glucose yield andFIG. 25B shows xylose yield. Pre-acid hydrolysis (light gray bars) and total (dark gray bars) sugars were separated and quantified via HPLC using a Bio-Rad Aminex HPX-87-P ion-exclusion column. - AGR2314 did not release sugars from pretreated seed fiber at greater levels than the pretreatment itself. When combined with other cell-wall degrading enzymes, approximately 90% of total sugars were released as compared to a commercially-available cellulase-enzyme cocktail.
- The chemical energy contained within an animal's diet, and its availability to the animal eating the diet, are critical characteristics influencing the nutritional value of any diet. Diets rich in energy, provide adequate nutrition and promote rapid growth to higher levels than diets that are deficient in energy. Therefore, determining the energy within a diet, and altering energy availability by using glucanase enzymes, provides an important set of tools to improve animal nutrition and therefore animal performance.
- To demonstrate the use of glucanase enzymes in broiler production, metabolizable energy and nutrient digestibility, male broilers were fed with alternative feed ingredients (wheat, barley and low-fat DDGS) with or without supplemental glucanase. Broiler body weight gain, feed consumption and feed conversion rate were determined and feed glucanase enzyme was evaluated.
- Dietary Treatments and Procedures
- Day-old male broiler were obtained from a commercial hatchery and randomly allocated to 64 battery cages in groups of 10. Experimental diets were fed from 0 to 28 d of ages. Initial group weights were obtained and equalized amongst the treatments. Feed disappearance and body weight were measured weekly (7, 14, 21, and 28 d of age) to calculate live performance parameters (feed consumption, body weight gain, and feed conversion ratio). In addition, excreta were collected twice to determine apparent metabolizable energy (AME) of the diets at 14 and 29 d of age.
- Dietary treatments were fed in a 4×2 factorial design and further delineated below. Four different diets (corn/soybean meal based, corn/wheat based, corn/barley based, and corn/LF-DDGS based diets) and two levels of glucanase (with or without) were fed. Diets were formulated to be isocaloric and all nutrients, with the exception of energy, were formulated to meet or exceed the nutrient requirements. The enzyme treatments had the enzyme added on top of the diet. In addition, titanium dioxide was added to the diets as an indigestible marker to determine AME and nutrient digestibility. Table 6 describes dietary treatments.
-
TABLE 6 Treatment delineation Trt Diet Enzyme 1 Corn-soybean meal − 2 Corn-soybean meal + 3 Corn-soybean meal-wheat − 4 Corn-soybean meal- wheat + 5 Corn-soybean meal-LF- − DDGS 6 Corn-soybean meal-LF- + DDGS 7 Corn-soybean meal-barley − 8 Corn-soybean meal-barley + Total 640 male broilers Total Males needed: 8 treatments × 8 reps × 10 birds/cage = 640 male broilers + 60 for equating = 700 male broilers - Temperature
- Battery cages: 92° F. from placement to 4 d, 90° F. from 5 to 9 d, 84° F. from 10 to 15 d, 80° F. from 16 to 24 d, 78° F. from 25 to 29 d,
- Room Setup
- Prior to bird placement, lighting and temperature in the battery cage rooms were set 48 hours in advance. Wire bottoms were added to the battery cages until
day 0 to 4. Unless noted in the schedule, for collection periods, excreta pans were scrapped on a regular basis to avoid any pest and odor issues. - Lighting Program
- A 23 light:1 dark with a lighting intensity of 3.0 ft2 was implemented from placement until 7 d of age. A 23 light: 1 dark lighting schedule was implemented from 8-21d with a lighting intensity of 1.0 ft candles. A 23 light: 1 dark lighting schedule was implemented from 22-28 d of age with a lighting intensity of 0.3 ft candles.
- Special Instructions
- Wire bottoms were placed into all battery cages prior to the start ofthe experiment or day-old chicks will fall through the floors. Wire bottoms were removed at
d 7. In addition, cage doors were modified to accommodate smaller birds from 0 to 7 d of age. - Any mortality was not replaced.
- All diets were fed in mash form. Mix sheets were forthcoming.
- To avoid cross contamination of the enzyme, separate feed scoops were needed. Table 7 describes experimental timeline.
-
TABLE 7 Timeline of dietary treatments Age of Day birds Experimental Timeline Lighting Temperature Tue −2 23L: 1D 92° F. 3.0 ft2 Thu 0 Place 720 male broilers in battery cages Equate weights Start experimental diets Tue 5 90° Thu 7 Weigh all birds and feed Remove wire bottoms Fri 8 23L: 1D 1.0 ft2 Sat 9 Sun 10 84° Mon 11 Clean excreta pans Start 14 d collection period Thu 14 Weigh all birds and feed Collect excreta for 14 d collection period Sat 16 80° Sun 17 Wed 20 80°B-east Thu 21 Weigh all birds and feed Fri 22 23L: 1D 0.3 ft2 Tues 25 Clean excreta pans 78° Start d 29collection period Fri 28 Weigh all birds and feed 75° Collect excreta for 29 d collection period END OF EXPERIMENT -
FIG. 26 illustrates the body weight gain (BWG) during the 28-day poultry feeding trial. Referring toFIG. 26 , four different diets, corn/soybean meal based, corn/barley based, corn/wheat based, and corn/LF-DDGS based, with (+) or without (−) a glucanase were tested. Still referring toFIG. 26 , average of BWG with or without glucanase across the four diets was shown. It was observed, that body wait gain was on average higher in chickens fed with the diets that included a glucanase. -
FIG. 27 illustrates the changes in poultry BWG per time interval during 28 day feeding trial. Referring toFIG. 27 , initial group weights were obtained and equalized amongst the treatments. BWG was measured weekly (7, 14, 21, and 28 d of age) for broilers feed using the corn/LF-DDGS diet with (+) or without (−) a glucanase. Still referring toFIG. 27 , it was observed across all treatments that body wait gain in chickens fed with the glucanase including diets was higher than in chickens fed with diets without glucanase. -
FIG. 28 illustrates feed consumption during the 28-day poultry feeding trial using two different diets (corn/barley based and corn/LF-DDGS based) with (+) or without (−) a glucanase. Referring toFIG. 28 , it was found that feed consumption was higher for the diets that included a glucanase. -
FIG. 29 illustrates the feed conversion rate (FCR) during the 28-day poultry feeding trial with two different diets (corn/barley based and corn/LF-DDGS based diets) with (+) or without (−) a glucanase. The feed conversion rate refers to the feed consumption required for gaining the body weight for a tested animal. The FCR is calculated by dividing the value of feed consumption by the value of body weight gain. Referring toFIG. 29 , it was observed that the FCR was lower for the diets that included a glucanase. These data indicates that diets that included a glucanase facilitated digestion and feed consumption in the tested animals. - To demonstrate the effect of glucanase enzymes in broiler production, 936 male broilers were feed with varies glucanase concentrations in a 17 day battery trial. Birds were weighed at day 17. Feed composition includes corn, soybean meal and fat (soybean oil). Table 8 describes experimental details of the 17 day battery trial.
-
TABLE 8 Experimental Treatments: (diets were fed through day 17)—total of 9 TRTs Trt Code Description Dose 1 Positive Control (PC) — 2 Negative Control — (NC, less 50-60 kcal/lb of PC) 3 NC + Industry Std Enzyme_1* 0.25 lb/ ton 4 NC + Industry Std Enzyme_2** 0.2 lb/ ton 5 NC + Glucanase 5 6 NC + Glucanase 50 7 NC + Glucanase 100 8 NC + Glucanase 250 9 NC + Glucanase 500 *Industry Std Enzyme_l refers to ENSPIRAT ™ (JBS United) **Industry Std Enzyme_2 refers to HOSTAZYM X ® (Huvepharma) No. of treatments 9 Broilers per replicate 8 Replicates per treatment 13 Broilers per treatment 104 Total No. of replicates 117 Total No. of broilers 936 - Referring to
FIG. 30 , the inclusion of beta-glucanase in treatments 7 (Trt_7) and 8 (Trt_8) significantly (p-value <0.05) increased body weight gain compared to the positive control (PC), negative control (NC), and treatments 3 (Trt_3) and 4 (Trt_4), which contained a commercial NSPase inclusion. The glucanase inclusion in treatments 5 (Trt_5), 6 (Trt_6), and 9 (Trt_9) produced intermediate results. -
- Leeson, S. and L. Caston. 2000. Commercial enzyme and their influence on broilers fed wheat or barley. J. Appl. Poult. Res. 9:242-251.
- Yu, B. and T. K. Chung. 2004. Effects of multiple-enzyme mixtures on growth performance of broilers fed corn-soybean meal diets. J. Appl. Poult. Res.
13:178-182. - The references cited throughout this application, are incorporated for all purposes apparent herein and in the references themselves as if each reference was fully set forth. For the sake of presentation, specific ones of these references are cited at particular locations herein. A citation of a reference at a particular location indicates a manner(s) in which the teachings of the reference are incorporated. However, a citation of a reference at a particular location does not limit the manner in which all of the teachings of the cited reference are incorporated for all purposes.
- It is understood, therefore, that this invention is not limited to the particular embodiments disclosed, but is intended to cover all modifications which are within the spirit and scope of the invention as defined by the appended claims; the above description; and/or shown in the attached drawings.
Claims (17)
1. A transgenic plant, part or seed thereof comprising at least one synthetic nucleic acid encoding a glucanase and at least one synthetic polynucleotide producing a diagnostic amplicon for identifying event 4588.652, wherein the at least one nucleic acid comprises a sequence with at least 90% identity to the sequence set forth in SEQ ID NO: 8, and the at least one synthetic polynucleotide comprises a sequence with at least 90% identity to the sequence selected from the group consisting of SEQ ID NOS: 29-31.
2. The transgenic plant or part thereof of claim 1 , wherein the glucanase is capable of degrading one or more polysaccharides selected from the group consisting of beta-glucan, cellulose, cellobiose, pNP-D-glucopyranoside and xylan.
3. The transgenic plant or part thereof of claim 1 , wherein the glucanase is active upon expression in the plant and exposure to a pH in the range from 5.0 to 10.0.
4. The transgenic plant or part thereof of claim 1 , wherein the glucanase is active upon expression in the plant and exposure to a temperature in the range from 25° C. to 130° C.
5. The transgenic plant or part thereof of claim 1 , wherein the glucanase activity has improved stability upon expression in the plant compared to the activity of a glucanase having an identical amino acid sequence and expressed in a bacterial cell.
6. The transgenic plant or part thereof of claim 1 , wherein a plant is selected from the group consisting of: wheat, maize, barley, and sorghum.
7. An animal feedstock comprising the transgenic plant, part or seed thereof of claim 1 .
8. The animal feedstock of claim 7 further comprising a feed supplement.
9. The animal feedstock of claim 8 , wherein the feed supplement is plant material selected from the group consisting of: a non-transgenic plant, another transgenic, mutant and engineered plant.
10. The animal feedstock of claim 8 , wherein the feed supplement comprises one or more exogenous enzymes selected from the group consisting of: a hydrolytic enzyme selected from the group consisting of: xylanase, endoglucanase, cellulase, protease, phytase, amylase and mannanase.
11. The animal feedstock of claim 8 , wherein the feed supplement comprises at least one component selected from the group consisting of: corn meal, corn pellets, wheat meal, wheat pellets, wheat grain, barley grain, barley pellets, soybean meal, soybean oilcake, sorghum grain and sorghum pellets.
12. The animal feedstock of claim 8 , wherein the feed supplement comprises at least one component selected from the group consisting of: soluble solids, fat and vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, COBAN®, vitamin premix, dicalcium phosphate, selenium premix, choline chloride, sodium chloride, and mineral premix.
13. A method of producing an animal feedstock comprising mixing the transgenic plant, part or seed thereof of claim 1 with other plant material to form a mixture.
14. The method of claim 13 , wherein the method further comprises pelletizing the mixture.
15. A method of increasing metabolizable energy of a diet, wherein the method comprises mixing the transgenic plant, part, or seed thereof of claim 1 with a feed ingredient.
16. The method of 15, wherein the feed ingredient comprises at least one component selected from the group consisting of: corn meal, corn pellets, wheat meal, wheat pellets, wheat grain, wheat middlings, barley grain, barley pellets, soybean meal, soy hulls, dried distillers grain, soybean oilcake, sorghum grain and sorghum pellets.
17. The method of claim 15 , wherein the feed ingredient comprises at least one component selected from the group consisting of: soluble solids, fat and vermiculite, limestone, plain salt, DL-methionine, L-lysine, L-threonine, COBAN®, vitamin premix, dicalcium phosphate, selenium premix, choline chloride, sodium chloride, mineral premix, and one or more exogenous enzymes.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/355,698 US20210380997A1 (en) | 2015-05-14 | 2021-06-23 | Glucanase production and methods of using the same |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201562161482P | 2015-05-14 | 2015-05-14 | |
PCT/US2016/032418 WO2016183467A1 (en) | 2015-05-14 | 2016-05-13 | Glucanase production and methods of using the same |
US201715569592A | 2017-10-26 | 2017-10-26 | |
US16/599,543 US11098319B2 (en) | 2015-05-14 | 2019-10-11 | Glucanase production and methods of using the same |
US17/355,698 US20210380997A1 (en) | 2015-05-14 | 2021-06-23 | Glucanase production and methods of using the same |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/599,543 Continuation US11098319B2 (en) | 2015-05-14 | 2019-10-11 | Glucanase production and methods of using the same |
Publications (1)
Publication Number | Publication Date |
---|---|
US20210380997A1 true US20210380997A1 (en) | 2021-12-09 |
Family
ID=57249184
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/569,592 Active US10494640B2 (en) | 2015-05-14 | 2016-05-13 | Transgenic plants producing glucanase |
US16/599,543 Active 2036-07-14 US11098319B2 (en) | 2015-05-14 | 2019-10-11 | Glucanase production and methods of using the same |
US17/355,698 Pending US20210380997A1 (en) | 2015-05-14 | 2021-06-23 | Glucanase production and methods of using the same |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/569,592 Active US10494640B2 (en) | 2015-05-14 | 2016-05-13 | Transgenic plants producing glucanase |
US16/599,543 Active 2036-07-14 US11098319B2 (en) | 2015-05-14 | 2019-10-11 | Glucanase production and methods of using the same |
Country Status (10)
Country | Link |
---|---|
US (3) | US10494640B2 (en) |
EP (1) | EP3294763B1 (en) |
CN (2) | CN107531766B (en) |
AU (2) | AU2016260521B2 (en) |
BR (1) | BR112017024087A2 (en) |
CA (1) | CA2981500A1 (en) |
CL (2) | CL2017002794A1 (en) |
ES (1) | ES2951012T3 (en) |
MX (1) | MX2017013318A (en) |
WO (1) | WO2016183467A1 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107531766B (en) * | 2015-05-14 | 2022-03-08 | 谷万达公司 | Production of glucanases and methods of using the same |
CA3042046A1 (en) * | 2016-11-08 | 2018-05-17 | Agrivida, Inc. | Phytase production and methods of using the same |
CN109609529B (en) * | 2019-01-25 | 2021-12-31 | 华侨大学 | Preparation method of oligomerization feruloyl esterase based on foldon mediation |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1356066A2 (en) | 2000-10-24 | 2003-10-29 | Syngenta Participations AG | Control of gene expression in plants |
RU2312144C2 (en) | 2001-08-27 | 2007-12-10 | Синджента Партисипейшнс Аг | Autoprocessing plants and parts of plant |
RS20060506A (en) * | 2004-03-08 | 2008-04-04 | Syngenta Participations Ag., | Self-processing plants and plant parts |
US7169967B2 (en) | 2004-03-23 | 2007-01-30 | Applied Biotechnology Institute | Globulin-1 promoter from maize and method of using same |
CA3020590A1 (en) * | 2006-08-04 | 2009-02-12 | Bp Corporation North America Inc. | Glucanases, nucleic acids encoding them and methods for making and using them |
US7928296B2 (en) * | 2006-10-30 | 2011-04-19 | Pioneer Hi-Bred International, Inc. | Maize event DP-098140-6 and compositions and methods for the identification and/or detection thereof |
US20130071884A1 (en) | 2009-11-06 | 2013-03-21 | Agrivida, Inc. | Plants expressing cell wall degrading enzymes and expression vectors |
EP2512226B1 (en) * | 2009-12-17 | 2019-05-01 | Pioneer Hi-Bred International, Inc. | Maize event dp-004114-3 and methods for detection thereof |
AR090320A1 (en) * | 2012-03-30 | 2014-11-05 | Verenium Corp | GENES CODING CELL TO HYDROLIZE GUAR FRACTURING FLUIDS UNDER EXTREME WELL CONDITIONS |
US20170204316A1 (en) * | 2013-09-16 | 2017-07-20 | Basf Enzymes Llc | Controlled break enzyme formulations |
CN107531766B (en) * | 2015-05-14 | 2022-03-08 | 谷万达公司 | Production of glucanases and methods of using the same |
-
2016
- 2016-05-13 CN CN201680027960.4A patent/CN107531766B/en active Active
- 2016-05-13 EP EP16793621.0A patent/EP3294763B1/en active Active
- 2016-05-13 AU AU2016260521A patent/AU2016260521B2/en active Active
- 2016-05-13 US US15/569,592 patent/US10494640B2/en active Active
- 2016-05-13 BR BR112017024087A patent/BR112017024087A2/en active Search and Examination
- 2016-05-13 MX MX2017013318A patent/MX2017013318A/en unknown
- 2016-05-13 CN CN202210137801.7A patent/CN114457181A/en active Pending
- 2016-05-13 WO PCT/US2016/032418 patent/WO2016183467A1/en active Application Filing
- 2016-05-13 ES ES16793621T patent/ES2951012T3/en active Active
- 2016-05-13 CA CA2981500A patent/CA2981500A1/en active Pending
-
2017
- 2017-11-06 CL CL2017002794A patent/CL2017002794A1/en unknown
-
2019
- 2019-10-11 US US16/599,543 patent/US11098319B2/en active Active
-
2021
- 2021-02-17 AU AU2021201026A patent/AU2021201026B2/en active Active
- 2021-06-23 US US17/355,698 patent/US20210380997A1/en active Pending
-
2023
- 2023-05-18 CL CL2023001431A patent/CL2023001431A1/en unknown
Also Published As
Publication number | Publication date |
---|---|
CA2981500A1 (en) | 2016-11-17 |
CL2017002794A1 (en) | 2018-04-06 |
US11098319B2 (en) | 2021-08-24 |
CN107531766B (en) | 2022-03-08 |
US20180295859A1 (en) | 2018-10-18 |
US10494640B2 (en) | 2019-12-03 |
AU2021201026A1 (en) | 2021-03-11 |
WO2016183467A1 (en) | 2016-11-17 |
AU2016260521A1 (en) | 2017-10-12 |
AU2021201026B2 (en) | 2023-04-20 |
CL2023001431A1 (en) | 2023-11-17 |
MX2017013318A (en) | 2018-03-08 |
EP3294763A4 (en) | 2018-09-26 |
AU2016260521B2 (en) | 2020-12-24 |
CN114457181A (en) | 2022-05-10 |
BR112017024087A2 (en) | 2018-08-07 |
EP3294763A1 (en) | 2018-03-21 |
CN107531766A (en) | 2018-01-02 |
ES2951012T3 (en) | 2023-10-17 |
EP3294763B1 (en) | 2023-06-21 |
EP3294763C0 (en) | 2023-06-21 |
US20200032284A1 (en) | 2020-01-30 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20210380997A1 (en) | Glucanase production and methods of using the same | |
JP5829603B2 (en) | Feed supplements | |
JP6391601B2 (en) | Pepsin resistant alpha amylase and uses thereof | |
WO2020200321A1 (en) | Redox enzymes in animal feed compositions | |
US20220183322A1 (en) | Redox enzymes in animal feed compositions | |
US20150150282A1 (en) | Method | |
KR20150038586A (en) | Xylanases for solubilising arabinoxylan-containing material | |
US20220315939A1 (en) | Phytase production and methods of using the same | |
KR20230150828A (en) | Method to improve carbohydrate digestibility by carbohydrase in animal feed by using serine protease | |
CN116887689A (en) | Method for improving the digestibility of carbohydrases in animal feed by using serine proteases | |
BR112019009379B1 (en) | ANIMAL FEED, EVENT IDENTIFICATION KIT AND EVENT IDENTIFICATION METHOD |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION RETURNED BACK TO PREEXAM |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |