US20210332093A9 - Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis - Google Patents
Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis Download PDFInfo
- Publication number
- US20210332093A9 US20210332093A9 US16/481,128 US201816481128A US2021332093A9 US 20210332093 A9 US20210332093 A9 US 20210332093A9 US 201816481128 A US201816481128 A US 201816481128A US 2021332093 A9 US2021332093 A9 US 2021332093A9
- Authority
- US
- United States
- Prior art keywords
- fus
- peptide
- transportin
- canceled
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 230000005937 nuclear translocation Effects 0.000 title claims abstract description 24
- 206010039491 Sarcoma Diseases 0.000 title claims abstract description 10
- 206010016654 Fibrosis Diseases 0.000 title claims description 16
- 230000004761 fibrosis Effects 0.000 title description 13
- 239000003112 inhibitor Substances 0.000 title description 2
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 109
- 238000000034 method Methods 0.000 claims abstract description 40
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 37
- 102000011781 Karyopherins Human genes 0.000 claims abstract description 36
- 108010062228 Karyopherins Proteins 0.000 claims abstract description 36
- 239000000203 mixture Substances 0.000 claims abstract description 36
- 201000010099 disease Diseases 0.000 claims abstract description 30
- 230000027455 binding Effects 0.000 claims abstract description 27
- 230000037319 collagen production Effects 0.000 claims abstract description 20
- 239000012528 membrane Substances 0.000 claims abstract description 18
- 210000000056 organ Anatomy 0.000 claims abstract description 17
- 230000001404 mediated effect Effects 0.000 claims abstract description 15
- 230000003176 fibrotic effect Effects 0.000 claims abstract description 14
- 102000004389 Ribonucleoproteins Human genes 0.000 claims abstract description 11
- 108010081734 Ribonucleoproteins Proteins 0.000 claims abstract description 11
- 210000004027 cell Anatomy 0.000 claims description 68
- 108090000623 proteins and genes Proteins 0.000 claims description 52
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 44
- 102000004169 proteins and genes Human genes 0.000 claims description 42
- 229920001184 polypeptide Polymers 0.000 claims description 36
- 150000001413 amino acids Chemical class 0.000 claims description 27
- 239000003795 chemical substances by application Substances 0.000 claims description 19
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 16
- 230000006378 damage Effects 0.000 claims description 14
- 230000003247 decreasing effect Effects 0.000 claims description 10
- 102000006495 integrins Human genes 0.000 claims description 10
- 108010044426 integrins Proteins 0.000 claims description 10
- 206010061989 glomerulosclerosis Diseases 0.000 claims description 9
- 102000003969 Fibroblast growth factor 4 Human genes 0.000 claims description 7
- 108090000381 Fibroblast growth factor 4 Proteins 0.000 claims description 7
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 7
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 7
- 208000017169 kidney disease Diseases 0.000 claims description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 5
- 230000002209 hydrophobic effect Effects 0.000 claims description 5
- 206010039710 Scleroderma Diseases 0.000 claims description 4
- 108010062307 AAVALLPAVLLALLAP Proteins 0.000 claims description 3
- 201000008808 Fibrosarcoma Diseases 0.000 claims description 3
- 208000019693 Lung disease Diseases 0.000 claims description 3
- 206010028980 Neoplasm Diseases 0.000 claims description 3
- 206010050207 Skin fibrosis Diseases 0.000 claims description 3
- 210000004900 c-terminal fragment Anatomy 0.000 claims description 3
- 230000007882 cirrhosis Effects 0.000 claims description 3
- 208000019425 cirrhosis of liver Diseases 0.000 claims description 3
- 239000003246 corticosteroid Substances 0.000 claims description 3
- 208000019423 liver disease Diseases 0.000 claims description 3
- 201000008968 osteosarcoma Diseases 0.000 claims description 3
- 208000005069 pulmonary fibrosis Diseases 0.000 claims description 3
- 206010067125 Liver injury Diseases 0.000 claims description 2
- 239000000041 non-steroidal anti-inflammatory agent Substances 0.000 claims description 2
- 229940021182 non-steroidal anti-inflammatory drug Drugs 0.000 claims description 2
- 208000017520 skin disease Diseases 0.000 claims 1
- 102000008186 Collagen Human genes 0.000 abstract description 43
- 108010035532 Collagen Proteins 0.000 abstract description 43
- 229920001436 collagen Polymers 0.000 abstract description 43
- 210000003734 kidney Anatomy 0.000 abstract description 20
- 230000026731 phosphorylation Effects 0.000 abstract description 17
- 238000006366 phosphorylation reaction Methods 0.000 abstract description 17
- 210000004899 c-terminal region Anatomy 0.000 abstract description 7
- 230000002401 inhibitory effect Effects 0.000 abstract description 7
- 230000030648 nucleus localization Effects 0.000 abstract description 7
- 230000012223 nuclear import Effects 0.000 abstract description 4
- 238000009825 accumulation Methods 0.000 abstract description 2
- 241000699670 Mus sp. Species 0.000 description 45
- 102000001301 EGF receptor Human genes 0.000 description 40
- 108060006698 EGF receptor Proteins 0.000 description 40
- 235000018102 proteins Nutrition 0.000 description 40
- 235000001014 amino acid Nutrition 0.000 description 27
- 229940024606 amino acid Drugs 0.000 description 26
- 235000002374 tyrosine Nutrition 0.000 description 23
- 210000003584 mesangial cell Anatomy 0.000 description 21
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 20
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 20
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 20
- 230000004913 activation Effects 0.000 description 18
- -1 phospho Chemical class 0.000 description 18
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 16
- 230000015572 biosynthetic process Effects 0.000 description 14
- 239000003623 enhancer Substances 0.000 description 13
- 108020001507 fusion proteins Proteins 0.000 description 12
- 102000037865 fusion proteins Human genes 0.000 description 12
- 208000013901 Nephropathies and tubular disease Diseases 0.000 description 11
- 102000009024 Epidermal Growth Factor Human genes 0.000 description 10
- 241000282414 Homo sapiens Species 0.000 description 10
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 10
- 101710098940 Pro-epidermal growth factor Proteins 0.000 description 10
- 229940009456 adriamycin Drugs 0.000 description 10
- 229960001433 erlotinib Drugs 0.000 description 10
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 10
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- 230000014509 gene expression Effects 0.000 description 9
- 230000001105 regulatory effect Effects 0.000 description 9
- 238000003786 synthesis reaction Methods 0.000 description 9
- 239000004471 Glycine Substances 0.000 description 8
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 8
- 230000037396 body weight Effects 0.000 description 8
- 230000001575 pathological effect Effects 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 7
- 208000035475 disorder Diseases 0.000 description 7
- 238000009472 formulation Methods 0.000 description 7
- 230000001434 glomerular Effects 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 6
- 206010002026 amyotrophic lateral sclerosis Diseases 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 210000004185 liver Anatomy 0.000 description 6
- 230000035772 mutation Effects 0.000 description 6
- 239000000816 peptidomimetic Substances 0.000 description 6
- 238000001262 western blot Methods 0.000 description 6
- 208000027418 Wounds and injury Diseases 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 238000000326 densiometry Methods 0.000 description 5
- 206010012601 diabetes mellitus Diseases 0.000 description 5
- 238000005755 formation reaction Methods 0.000 description 5
- 208000014674 injury Diseases 0.000 description 5
- 210000004072 lung Anatomy 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000008194 pharmaceutical composition Substances 0.000 description 5
- 108020001580 protein domains Proteins 0.000 description 5
- 102000005962 receptors Human genes 0.000 description 5
- 108020003175 receptors Proteins 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 230000002103 transcriptional effect Effects 0.000 description 5
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 4
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 4
- 108090000331 Firefly luciferases Proteins 0.000 description 4
- 102000007999 Nuclear Proteins Human genes 0.000 description 4
- 108010089610 Nuclear Proteins Proteins 0.000 description 4
- 108091005735 TGF-beta receptors Proteins 0.000 description 4
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 210000002744 extracellular matrix Anatomy 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000011068 loading method Methods 0.000 description 4
- 238000007911 parenteral administration Methods 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 210000003491 skin Anatomy 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 3
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 3
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 3
- 102000003727 Caveolin 1 Human genes 0.000 description 3
- 108090000026 Caveolin 1 Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102400001369 Heparin-binding EGF-like growth factor Human genes 0.000 description 3
- 101800001649 Heparin-binding EGF-like growth factor Proteins 0.000 description 3
- 101001060274 Homo sapiens Fibroblast growth factor 4 Proteins 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- 239000005089 Luciferase Substances 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 108700026244 Open Reading Frames Proteins 0.000 description 3
- 101710184528 Scaffolding protein Proteins 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000003828 downregulation Effects 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 239000007850 fluorescent dye Substances 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 210000002216 heart Anatomy 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 210000000936 intestine Anatomy 0.000 description 3
- 230000004807 localization Effects 0.000 description 3
- 238000004949 mass spectrometry Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 150000007523 nucleic acids Chemical group 0.000 description 3
- 210000000496 pancreas Anatomy 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 210000000557 podocyte Anatomy 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 230000002206 pro-fibrotic effect Effects 0.000 description 3
- 210000002307 prostate Anatomy 0.000 description 3
- 210000001525 retina Anatomy 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 150000003668 tyrosines Chemical class 0.000 description 3
- 210000004291 uterus Anatomy 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- ODIGIKRIUKFKHP-UHFFFAOYSA-N (n-propan-2-yloxycarbonylanilino) acetate Chemical compound CC(C)OC(=O)N(OC(C)=O)C1=CC=CC=C1 ODIGIKRIUKFKHP-UHFFFAOYSA-N 0.000 description 2
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 2
- 108700031308 Antennapedia Homeodomain Proteins 0.000 description 2
- 102000004266 Collagen Type IV Human genes 0.000 description 2
- 108010042086 Collagen Type IV Proteins 0.000 description 2
- 208000022461 Glomerular disease Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 2
- 108090000292 RNA-binding protein FUS Proteins 0.000 description 2
- 102000003890 RNA-binding protein FUS Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010052090 Renilla Luciferases Proteins 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000002679 ablation Methods 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 239000003945 anionic surfactant Substances 0.000 description 2
- 230000003510 anti-fibrotic effect Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 208000020832 chronic kidney disease Diseases 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 230000008021 deposition Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000006185 dispersion Substances 0.000 description 2
- 239000002612 dispersion medium Substances 0.000 description 2
- GVGUFUZHNYFZLC-UHFFFAOYSA-N dodecyl benzenesulfonate;sodium Chemical compound [Na].CCCCCCCCCCCCOS(=O)(=O)C1=CC=CC=C1 GVGUFUZHNYFZLC-UHFFFAOYSA-N 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 229940121647 egfr inhibitor Drugs 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 231100000852 glomerular disease Toxicity 0.000 description 2
- 102000057231 human FGF4 Human genes 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000007794 irritation Effects 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 238000007726 management method Methods 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000011987 methylation Effects 0.000 description 2
- 238000007069 methylation reaction Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 230000025308 nuclear transport Effects 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 125000003729 nucleotide group Chemical group 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 108010094020 polyglycine Proteins 0.000 description 2
- 229920000232 polyglycine polymer Polymers 0.000 description 2
- 108010000222 polyserine Proteins 0.000 description 2
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 201000001474 proteinuria Diseases 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 210000000574 retroperitoneal space Anatomy 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229940080264 sodium dodecylbenzenesulfonate Drugs 0.000 description 2
- WQQPDTLGLVLNOH-UHFFFAOYSA-M sodium;4-hydroxy-4-oxo-3-sulfobutanoate Chemical class [Na+].OC(=O)CC(C([O-])=O)S(O)(=O)=O WQQPDTLGLVLNOH-UHFFFAOYSA-M 0.000 description 2
- 238000013268 sustained release Methods 0.000 description 2
- 239000012730 sustained-release form Substances 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 102000027257 transmembrane receptors Human genes 0.000 description 2
- 108091008578 transmembrane receptors Proteins 0.000 description 2
- 108091005990 tyrosine-phosphorylated proteins Proteins 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229920003169 water-soluble polymer Polymers 0.000 description 2
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- XSYUPRQVAHJETO-WPMUBMLPSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-imidaz Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CN=CN1 XSYUPRQVAHJETO-WPMUBMLPSA-N 0.000 description 1
- BENKAPCDIOILGV-RQJHMYQMSA-N (2s,4r)-4-hydroxy-1-[(2-methylpropan-2-yl)oxycarbonyl]pyrrolidine-2-carboxylic acid Chemical compound CC(C)(C)OC(=O)N1C[C@H](O)C[C@H]1C(O)=O BENKAPCDIOILGV-RQJHMYQMSA-N 0.000 description 1
- CUKWUWBLQQDQAC-VEQWQPCFSA-N (3s)-3-amino-4-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s,3s)-1-[[(2s)-1-[(2s)-2-[[(1s)-1-carboxyethyl]carbamoyl]pyrrolidin-1-yl]-3-(1h-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-methyl-1-ox Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C1=CC=C(O)C=C1 CUKWUWBLQQDQAC-VEQWQPCFSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- CDKIEBFIMCSCBB-UHFFFAOYSA-N 1-(6,7-dimethoxy-3,4-dihydro-1h-isoquinolin-2-yl)-3-(1-methyl-2-phenylpyrrolo[2,3-b]pyridin-3-yl)prop-2-en-1-one;hydrochloride Chemical compound Cl.C1C=2C=C(OC)C(OC)=CC=2CCN1C(=O)C=CC(C1=CC=CN=C1N1C)=C1C1=CC=CC=C1 CDKIEBFIMCSCBB-UHFFFAOYSA-N 0.000 description 1
- FDCJDKXCCYFOCV-UHFFFAOYSA-N 1-hexadecoxyhexadecane Chemical compound CCCCCCCCCCCCCCCCOCCCCCCCCCCCCCCCC FDCJDKXCCYFOCV-UHFFFAOYSA-N 0.000 description 1
- POAOYUHQDCAZBD-UHFFFAOYSA-N 2-butoxyethanol Chemical compound CCCCOCCO POAOYUHQDCAZBD-UHFFFAOYSA-N 0.000 description 1
- CTXGTHVAWRBISV-UHFFFAOYSA-N 2-hydroxyethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCO CTXGTHVAWRBISV-UHFFFAOYSA-N 0.000 description 1
- RFVNOJDQRGSOEL-UHFFFAOYSA-N 2-hydroxyethyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCO RFVNOJDQRGSOEL-UHFFFAOYSA-N 0.000 description 1
- VCNPGCHIKPSUSP-UHFFFAOYSA-N 2-hydroxypropyl tetradecanoate Chemical compound CCCCCCCCCCCCCC(=O)OCC(C)O VCNPGCHIKPSUSP-UHFFFAOYSA-N 0.000 description 1
- MZPBGKHCHOCSOL-UHFFFAOYSA-N 3-(dodecylamino)propanoic acid;sodium Chemical compound [Na].CCCCCCCCCCCCNCCC(O)=O MZPBGKHCHOCSOL-UHFFFAOYSA-N 0.000 description 1
- XBQADBXCNQPHHY-NSHDSACASA-N 33305-77-0 Chemical compound CC(C)(C)OC(=O)N[C@H](C(O)=O)CC1=CC=C([N+]([O-])=O)C=C1 XBQADBXCNQPHHY-NSHDSACASA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- XDOLZJYETYVRKV-UHFFFAOYSA-N 7-Aminoheptanoic acid Chemical compound NCCCCCCC(O)=O XDOLZJYETYVRKV-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 102100022900 Actin, cytoplasmic 1 Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 206010001580 Albuminuria Diseases 0.000 description 1
- 101710085003 Alpha-tubulin N-acetyltransferase Proteins 0.000 description 1
- 101710085461 Alpha-tubulin N-acetyltransferase 1 Proteins 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 101800002011 Amphipathic peptide Proteins 0.000 description 1
- 102400000345 Angiotensin-2 Human genes 0.000 description 1
- 101800000733 Angiotensin-2 Proteins 0.000 description 1
- 101150019028 Antp gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 206010058029 Arthrofibrosis Diseases 0.000 description 1
- 108091005753 BiP proteins Proteins 0.000 description 1
- 241000409333 Cabeza Species 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 description 1
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- 244000060011 Cocos nucifera Species 0.000 description 1
- 235000013162 Cocos nucifera Nutrition 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 102000015225 Connective Tissue Growth Factor Human genes 0.000 description 1
- 108010039419 Connective Tissue Growth Factor Proteins 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- CKLJMWTZIZZHCS-UHFFFAOYSA-N D-OH-Asp Natural products OC(=O)C(N)CC(O)=O CKLJMWTZIZZHCS-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 208000007342 Diabetic Nephropathies Diseases 0.000 description 1
- 206010012735 Diarrhoea Diseases 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 206010014415 Electrolyte depletion Diseases 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 208000010201 Exanthema Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 206010073306 Exposure to radiation Diseases 0.000 description 1
- 108010020195 FLAG peptide Proteins 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 102100028072 Fibroblast growth factor 4 Human genes 0.000 description 1
- 108010033708 GFE-1 peptide Proteins 0.000 description 1
- 208000034951 Genetic Translocation Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 101001061518 Homo sapiens RNA-binding protein FUS Proteins 0.000 description 1
- 108010070875 Human Immunodeficiency Virus tat Gene Products Proteins 0.000 description 1
- 208000014919 IgG4-related retroperitoneal fibrosis Diseases 0.000 description 1
- 108010055795 Integrin alpha1beta1 Proteins 0.000 description 1
- 208000002260 Keloid Diseases 0.000 description 1
- 206010023330 Keloid scar Diseases 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- CKLJMWTZIZZHCS-UWTATZPHSA-N L-Aspartic acid Natural products OC(=O)[C@H](N)CC(O)=O CKLJMWTZIZZHCS-UWTATZPHSA-N 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QWCKQJZIFLGMSD-VKHMYHEASA-N L-alpha-aminobutyric acid Chemical compound CC[C@H](N)C(O)=O QWCKQJZIFLGMSD-VKHMYHEASA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- UCUNFLYVYCGDHP-BYPYZUCNSA-N L-methionine sulfone Chemical compound CS(=O)(=O)CC[C@H](N)C(O)=O UCUNFLYVYCGDHP-BYPYZUCNSA-N 0.000 description 1
- UCUNFLYVYCGDHP-UHFFFAOYSA-N L-methionine sulfone Natural products CS(=O)(=O)CCC(N)C(O)=O UCUNFLYVYCGDHP-UHFFFAOYSA-N 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 241000254158 Lampyridae Species 0.000 description 1
- 208000004852 Lung Injury Diseases 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 101710143111 Mothers against decapentaplegic homolog 3 Proteins 0.000 description 1
- TWOFBVMVSYSAFW-UFUGHDFUSA-N N'-(3-aminopropyl)butane-1,4-diamine (3S,8S,9S,10R,13R,14S,17R)-10,13-dimethyl-17-[(2R)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-ol guanidine Chemical compound NC(N)=N.NC(N)=N.NCCCCNCCCN.C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 TWOFBVMVSYSAFW-UFUGHDFUSA-N 0.000 description 1
- 102000004722 NADPH Oxidases Human genes 0.000 description 1
- 108010002998 NADPH Oxidases Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108010088535 Pep-1 peptide Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000029797 Prion Human genes 0.000 description 1
- 108091000054 Prion Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 206010061924 Pulmonary toxicity Diseases 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 229940127361 Receptor Tyrosine Kinase Inhibitors Drugs 0.000 description 1
- 108091005682 Receptor kinases Proteins 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000242739 Renilla Species 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 206010038979 Retroperitoneal fibrosis Diseases 0.000 description 1
- AUNGANRZJHBGPY-SCRDCRAPSA-N Riboflavin Chemical compound OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O AUNGANRZJHBGPY-SCRDCRAPSA-N 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 102000049939 Smad3 Human genes 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 201000009594 Systemic Scleroderma Diseases 0.000 description 1
- 206010042953 Systemic sclerosis Diseases 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102400001320 Transforming growth factor alpha Human genes 0.000 description 1
- 101800004564 Transforming growth factor alpha Proteins 0.000 description 1
- 102100028748 Transportin-1 Human genes 0.000 description 1
- 101710120729 Transportin-1 Proteins 0.000 description 1
- 206010069363 Traumatic lung injury Diseases 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 101710175714 Tyrosine aminotransferase Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 102100036976 X-ray repair cross-complementing protein 6 Human genes 0.000 description 1
- 101710124907 X-ray repair cross-complementing protein 6 Proteins 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 150000008055 alkyl aryl sulfonates Chemical class 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- 239000002280 amphoteric surfactant Substances 0.000 description 1
- 229940035676 analgesics Drugs 0.000 description 1
- 229940035674 anesthetics Drugs 0.000 description 1
- 229950006323 angiotensin ii Drugs 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 230000001539 anorectic effect Effects 0.000 description 1
- 239000000730 antalgic agent Substances 0.000 description 1
- 230000001088 anti-asthma Effects 0.000 description 1
- 230000003556 anti-epileptic effect Effects 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 229940124599 anti-inflammatory drug Drugs 0.000 description 1
- 230000001022 anti-muscarinic effect Effects 0.000 description 1
- 230000001754 anti-pyretic effect Effects 0.000 description 1
- 239000000924 antiasthmatic agent Substances 0.000 description 1
- 239000001961 anticonvulsive agent Substances 0.000 description 1
- 229960003965 antiepileptics Drugs 0.000 description 1
- 239000000739 antihistaminic agent Substances 0.000 description 1
- 229940125715 antihistaminic agent Drugs 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 229940124433 antimigraine drug Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 239000000164 antipsychotic agent Substances 0.000 description 1
- 229940005529 antipsychotics Drugs 0.000 description 1
- 239000002221 antipyretic Substances 0.000 description 1
- 229940125716 antipyretic agent Drugs 0.000 description 1
- 229940027983 antiseptic and disinfectant quaternary ammonium compound Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 230000010516 arginylation Effects 0.000 description 1
- 229960005261 aspartic acid Drugs 0.000 description 1
- 230000001746 atrial effect Effects 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- 230000002457 bidirectional effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 229940124630 bronchodilator Drugs 0.000 description 1
- 239000000168 bronchodilator agent Substances 0.000 description 1
- 108010025307 buforin II Proteins 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229940125692 cardiovascular agent Drugs 0.000 description 1
- 239000002327 cardiovascular agent Substances 0.000 description 1
- 230000007681 cardiovascular toxicity Effects 0.000 description 1
- 231100000060 cardiovascular toxicity Toxicity 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 239000003093 cationic surfactant Substances 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 229960000800 cetrimonium bromide Drugs 0.000 description 1
- UKVZSPHYQJNTOU-IVBHRGSNSA-N chembl1240717 Chemical compound C([C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)[C@H](C)O)CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(O)=O)C1=CC=CC=C1 UKVZSPHYQJNTOU-IVBHRGSNSA-N 0.000 description 1
- 239000013043 chemical agent Substances 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 108091006046 chimeric mutant proteins Proteins 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 208000022831 chronic renal failure syndrome Diseases 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000007711 cytoplasmic localization Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 208000033679 diabetic kidney disease Diseases 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 230000007783 downstream signaling Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 208000028208 end stage renal disease Diseases 0.000 description 1
- 201000000523 end stage renal failure Diseases 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 230000003203 everyday effect Effects 0.000 description 1
- 201000005884 exanthem Diseases 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 101150101373 fus gene Proteins 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- 230000006251 gamma-carboxylation Effects 0.000 description 1
- 239000003193 general anesthetic agent Substances 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229940075507 glyceryl monostearate Drugs 0.000 description 1
- 229940075529 glyceryl stearate Drugs 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 150000003278 haem Chemical group 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 102000045839 human FUS Human genes 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 239000003326 hypnotic agent Substances 0.000 description 1
- 230000000147 hypnotic effect Effects 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- 210000001117 keloid Anatomy 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 229940094506 lauryl betaine Drugs 0.000 description 1
- IZWSFJTYBVKZNK-UHFFFAOYSA-N lauryl sulfobetaine Chemical compound CCCCCCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O IZWSFJTYBVKZNK-UHFFFAOYSA-N 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000005229 liver cell Anatomy 0.000 description 1
- 231100000515 lung injury Toxicity 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 1
- 239000003149 muscarinic antagonist Substances 0.000 description 1
- 206010028537 myelofibrosis Diseases 0.000 description 1
- QCTVGFNUKWXQNN-UHFFFAOYSA-N n-(2-hydroxypropyl)octadecanamide Chemical compound CCCCCCCCCCCCCCCCCC(=O)NCC(C)O QCTVGFNUKWXQNN-UHFFFAOYSA-N 0.000 description 1
- DVEKCXOJTLDBFE-UHFFFAOYSA-N n-dodecyl-n,n-dimethylglycinate Chemical compound CCCCCCCCCCCC[N+](C)(C)CC([O-])=O DVEKCXOJTLDBFE-UHFFFAOYSA-N 0.000 description 1
- 238000013059 nephrectomy Methods 0.000 description 1
- 238000007857 nested PCR Methods 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- GHLZUHZBBNDWHW-UHFFFAOYSA-N nonanamide Chemical compound CCCCCCCCC(N)=O GHLZUHZBBNDWHW-UHFFFAOYSA-N 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000012758 nuclear staining Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 229920002114 octoxynol-9 Polymers 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 239000000734 parasympathomimetic agent Substances 0.000 description 1
- 230000001499 parasympathomimetic effect Effects 0.000 description 1
- 229940005542 parasympathomimetics Drugs 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 108010043655 penetratin Proteins 0.000 description 1
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 231100000374 pneumotoxicity Toxicity 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920000724 poly(L-arginine) polymer Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 229920002523 polyethylene Glycol 1000 Polymers 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229940056099 polyglyceryl-4 oleate Drugs 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000009145 protein modification Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 230000007047 pulmonary toxicity Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229940043131 pyroglutamate Drugs 0.000 description 1
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 201000008158 rapidly progressive glomerulonephritis Diseases 0.000 description 1
- 206010037844 rash Diseases 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 108010054624 red fluorescent protein Proteins 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000007634 remodeling Methods 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000008458 response to injury Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical class O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 229940125723 sedative agent Drugs 0.000 description 1
- 239000000932 sedative agent Substances 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 231100000046 skin rash Toxicity 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 1
- IDXHDUOOTUFFOX-UHFFFAOYSA-M sodium;2-[2-hydroxyethyl-[2-(tetradecanoylamino)ethyl]amino]acetate Chemical compound [Na+].CCCCCCCCCCCCCC(=O)NCCN(CCO)CC([O-])=O IDXHDUOOTUFFOX-UHFFFAOYSA-M 0.000 description 1
- DCQXTYAFFMSNNH-UHFFFAOYSA-M sodium;2-[bis(2-hydroxyethyl)amino]ethanol;acetate Chemical compound [Na+].CC([O-])=O.OCCN(CCO)CCO DCQXTYAFFMSNNH-UHFFFAOYSA-M 0.000 description 1
- LLKGTXLYJMUQJX-UHFFFAOYSA-M sodium;3-[2-carboxyethyl(dodecyl)amino]propanoate Chemical compound [Na+].CCCCCCCCCCCCN(CCC(O)=O)CCC([O-])=O LLKGTXLYJMUQJX-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940100515 sorbitan Drugs 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 230000001954 sterilising effect Effects 0.000 description 1
- 238000004659 sterilization and disinfection Methods 0.000 description 1
- 239000000021 stimulant Substances 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000003760 tallow Substances 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 108010062760 transportan Proteins 0.000 description 1
- PBKWZFANFUTEPS-CWUSWOHSSA-N transportan Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(N)=O)[C@@H](C)CC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CN)[C@@H](C)O)C1=CC=C(O)C=C1 PBKWZFANFUTEPS-CWUSWOHSSA-N 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 1
- 238000001291 vacuum drying Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4705—Regulators; Modulating activity stimulating, promoting or activating activity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
- C07K14/4703—Inhibitors; Suppressors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1777—Integrin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1825—Fibroblast growth factor [FGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factors [FGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70546—Integrin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70546—Integrin superfamily
- C07K14/70557—Integrin beta3-subunit-containing molecules, e.g. CD41, CD51, CD61
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- End stage glomerular disease is the most common cause of chronic kidney failure and represents a major cause of morbidity and mortality for Veterans and civilian patients.
- ECM extracellular matrix
- glomerulosclerosis the synthesis and remodeling of ECM components (mainly collagens) are uncontrolled thus leading to scarred glomeruli characterized by abnormal collagen deposition, particularly collagens type I, IV, V and VI.
- compositions and methods for inhibiting collagen production mediated by the Fused in Sarcoma (FUS) ribonucleoprotein can therefore be used to treat and prevent fibrotic disease in a subject, such as a subject with liver, kidney, or lung disease or damage.
- the C terminal domain of FUS contains an uncommon nuclear localization sequence (NLS) motif called PY-NLS that binds the nuclear import receptor transportin. Phosphorylation of FUS leads to its association with transportin and nuclear translocation with consequent increased in collagen production. Therefore, disclosed herein is an isolated peptide that comprises a transportin-binding moiety, which inhibits FUS from binding transportin, linked to a membrane translocating motif.
- NLS nuclear localization sequence
- the transportin-binding moiety comprises a C-terminal fragment of a FUS ribonucleoprotein.
- the transportin-binding moiety can comprise the amino acid sequence SRGEHRQDRRERPY (SEQ ID NO:1), or a conservative variant thereof.
- the membrane translocating motif comprises a signal sequence hydrophobic region (SSHR).
- the SSHR can be derived from an integrin 133 protein, such as a human integrin 133 protein, or from a fibroblast growth factor 4 (FGF4) protein, such as a human FGF4 protein.
- the membrane translocating motif comprises the amino acid sequence XXXXLLPXXLLALLAP (SEQ ID NO:2) or XXXXLLPXXLLAVLAP (SEQ ID NO:3), wherein X is any amino acid or absent.
- the membrane translocating motif comprises the amino acid sequence AAVALLPAVLLALLAP (SEQ ID NO:4) or AAVALLPAVLLAVLAP (SEQ ID NO:5).
- the polypeptide comprises the amino acid sequence AAVALLPAVLLALLAP—SRGEHRQDRRERPY (SEQ ID NO:6) or AAVALLPAVLLAVLAP—SRGEHRQDRRERPY (SEQ ID NO:7), wherein “—” is a linker or peptide bond.
- Linkers can be short peptide sequences that occur between protein domains.
- the linkers can be flexible or rigid. Flexible linkers are often composed of flexible residues like glycine and serine so that the adjacent protein domains are free to move relative to one another.
- the linker can be a polyglycine (e.g. 3, 4, or 5 glycine), a polyserine (e.g.
- the linker can be a glycine and serine linker, such as, for example, a G4S, GSG4, G2SG3SG2, G2SG, G3S linker, or any other linker known in the art where the base linker sequence can optionally be repeated 2, 3, 4, or more times.
- the polypeptide comprises the amino acid sequence
- the disclosed peptide can further include one or more additional moieties.
- the peptide can contain a homing peptide or organ-specific or cell-specific Fab antibody fragment for targeted delivery to an organ, such as the lung, kidney, skin, heart, pancreas, uterus, retina, intestines, prostate, or liver.
- the peptide can also contain a label, such as a fluorescent dye.
- Also disclosed is a method for decreasing FUS-mediated collagen production by a cell comprising contacting the cell with an effective amount of a composition comprising an agent that inhibits nuclear translocation of FUS. Also disclosed is a method for treating fibrotic disease in a subject that involves administering to the subject a therapeutically effective amount of a composition comprising an agent that inhibits nuclear translocation of FUS.
- the agent used in the disclosed methods inhibits FUS from binding transportin.
- the agent can compete with FUS for binding to transportin, or can compete with transportin for binding to FUS.
- the agent comprises a peptide disclosed herein having a transportin-binding moiety linked to a membrane translocating motif.
- the disclosed method can be used to treat any condition involving abnormal FUS-mediated collagen formation.
- the method can be used to treat a fibrosis involving abnormally excessive collagen accumulation.
- the subject can have a kidney disease or damage, wherein the method inhibits glomerulosclerosis in the subject.
- the subject can have a liver disease or damage, wherein the method inhibits cirrhosis in the subject.
- the subject can have a lung disease or damage, wherein the method inhibits pulmonary fibrosis in the subject.
- the subject can have a retroperitoneal fibrosis, wherein the method inhibits the formation of fibrous tissue in the retroperitoneum.
- the subject can have skin fibrosis (scleroderma) associated with systemic sclerosis in which integrins and transforming growth factor beta as well as connective tissue growth factor play significant role (Ray K. Nat Rev Rheumatol 2013, 11:637
- the subject can have a fibrosarcoma or osteosarcoma tumor, wherein the method inhibits collagen production by the tumor.
- the disclosed compositions can further contain or be administered with other diagnostic or therapeutic agents for fibrosis.
- the disclosed composition can contain or be administered with a corticosteroid or a non-steroidal anti-inflammatory agent.
- the disclosed composition contains or is administered with a nuclear transport modifier (NTM) that targets nuclear transport by an importin, such as those described in U.S. Pat. Nos. 8,932,559, 9,044,433, and 9,492,544, which are incorporated by reference in their entirety for the teaching of these NTM molecules and uses thereof.
- NTM nuclear transport modifier
- FIGS. 1A to 1E Images of glomeruli from BALB/c WT and Itg ⁇ 1KO mice 8 weeks after ADR injection. Note that crossing the Itg ⁇ 1KO mice with the wave-2 mice or treating them with erlotinib improved glomerular injury (A), albuminuria (mean ⁇ SEM of 5-7 mice/group) (B, C), and kidney collagen IV levels (erlotinib group shown only, mean ⁇ SEM of 3 mice/group) (D, E).
- FIGS. 2A to 2D Kidney paraffin sections of the mice indicated were co-stained with anti-FUS (green) and anti-phospho EGFR (red) antibodies. Note that FUS is highly expressed and co-localize with phospho EGFR in the glomeruli of Itg ⁇ 1KO mice (B mean ⁇ SEM of 10 glom/mice with 3 mice evaluated).
- C, D Nuclear fractionation of glomeruli isolated from 5 WT and 5 Itg ⁇ 1KO mice showed significantly higher nuclear FUS levels in the Itg ⁇ 1KO mice.
- FIGS. 3A to 3C Kidney paraffin sections of eNOSKO or eNOSKO mice crossed with a mouse model of type 2 diabetes (db/db) were stained with anti-FUS antibody. Note the presence of FUS in the glomeruli of diabetic mice only (24 weeks old mice).
- B,C BALB/c WT mice were injected with adriamycin and then sacrificed at the time indicated. Nuclear fractions from isolated glomeruli blotted with anti-FUS or anti-HDAC2 (as loading control) (C, mean ⁇ SEM of 6 mice/treatment).
- FIGS. 4A to 4C (A, B) Nuclear (N) and non-nuclear (NN) fractions of WT and Itg ⁇ 1KO mesangial cells showing significantly higher levels of FUS in the nuclei of Itg ⁇ 1KO cells. (B, mean ⁇ SEM of 6 samples). (C) Non-nuclear and nuclear fractions were immuno-precipitated with the anti-pY antibody 4G10 or IgG control and then analyzed by Western Blot for levels of FUS. Note that tyrosine phosphorylated FUS is detected primarily in the nuclei of Itg ⁇ 1KO cells.
- FIGS. 5A to 5F WT and Itg ⁇ 1KO mesangial cells were either kept untreated or treated with erlotinib (ERL) and the levels of phospho EGFR (A, B), nuclear FUS (A, C), collagen IV (D, E) and nuclear phosphorylated FUS (F,) were analyzed by Western blot.
- ERL significantly decreased EGFR activation, nuclear FUS levels, collagen IV levels and tyrosine phosphorylated FUS.
- B C mean ⁇ SEM of 6 samples).
- FIGS. 6A to 6F WT and Itg ⁇ 1KO mesangial cells were treated with EGF for 0 or 30 minutes. The levels of phospho-EGFR and EGFR were then analyzed by Western blot (A) and quantified by densitometry analysis (B, mean SEM of 6 samples). (C) WT (W) and Itg ⁇ 1KO (K) cells were transiently transfected with RFP or RFP-FUS cDNA and levels of endogenous FUS and RPF-FUS were analyzed by Western blot with anti-RFP or anti-FUS antibody.
- RFP-FUS transfected cells were treated with EGF for 0 or 30 minutes and then nuclear RFP-FUS (counterstaining with DAPI) was evaluated.
- E The number of RFP-FUS and DAPI cells per microscopic field was counted and expressed as RFP-FUS/DAPI (mean ⁇ SEM of 150 cells). WT and Itg ⁇ 1KO mesangial cells were treated with EGF for 0 or 24 hours.
- the levels of Collagen IV and AKT (as loading control) were analyzed by Western blot and quantified by densitometry analysis (F, mean ⁇ SEM of 3 samples).
- FIGS. 7A to 7C Itg ⁇ 1KO mesangial cells were treated with scrambled-(Ser) or FUS-siRNA. 48 hours later the levels of FUS and collagen IV were analyzed by WB and quantified by densitometry analysis. (B, mean ⁇ SEM of 3 samples).
- C Itg ⁇ 1KO cells were treated with Scr- or FUS-siRNA. 24 hours later they were transiently transfected with the collagen IV enhancer (E)/firefly luciferase or enhancer/promoter (E/P)/firefly luciferase constructs together with renilla luciferase cDNAs. 24 hours later, the levels of firefly/ renilla luciferase activity were analyzed (mean ⁇ SEM of 4 samples).
- FIGS. 8A to 8D (A) Itg ⁇ 1KO mesangial cells were treated with 0.1 ⁇ M FUS PY-NLS derived peptide or its mutant form for 24 hours and then left untreated or treated with EGF (20 ng/ml) for 3 hours. Cells where stained with anti-FUS antibody (Red) or DAPI (Blue) to visualize FUS localization. (B) The intensity of FUS nuclear staining was measured using Image-J and expressed as mean of intensity/cell (mean ⁇ SEM of 50 cells). WT and Itg ⁇ 1KO mesangial cells were treated with EGF for 0 or 24 hours in the presence of either FUS PY-NLS derived peptide or its mutant form for 24 hours. The levels of Collagen IV and FAK (as loading control) were then analyzed by Westem blot (C) and quantified by densitometry analysis (D, mean ⁇ SEM of 3 samples).
- FIGS. 10A and 10B Schematic representation of a possible Itg ⁇ 1 ⁇ 1/FUS interaction in healthy WT (A) or Itg ⁇ 1KO (B) mesangial cells. It was hypothesize that in healthy cells (A), Itg ⁇ 1 ⁇ 1 prevents FUS tyrosine phosphorylation, nuclear translocation, and activation of collagen IV synthesis in a both EGFR-dependent and -independent manner. In Itg ⁇ 1KO cells (B), increased phosphorylation of FUS leads to its association with transportin and nuclear translocation with consequent increased collagen IV synthesis.
- FIG. 11 In vivo delivery of FAM FUS-PY-NLS peptide injected 5 times every 2 hours. Mice were then sacrificed and kidney and liver frozen sections were analyzed under an epifluorescence microscope. Fluorescent peptide is displayed intracellularly in kidney glomeruli and liver cells.
- subject refers to any individual who is the target of administration or treatment.
- the subject can be a vertebrate, for example, a mammal.
- the subject can be a human or veterinary patient.
- patient refers to a subject under the treatment of a clinician, e.g., physician.
- terapéuticaally effective refers to the amount of the composition used is of sufficient quantity to ameliorate one or more causes or symptoms of a disease or disorder. Such amelioration only requires a reduction or alteration, not necessarily elimination.
- pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- treatment refers to the medical management of a patient with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder.
- This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder.
- this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.
- prevent refers to a treatment that forestalls or slows the onset of a disease or condition or reduced the severity of the disease or condition.
- a treatment can treat a disease in a subject having symptoms of the disease, it can also prevent that disease in a subject who has yet to suffer some or all of the symptoms.
- inhibitor refers to a decrease in an activity, response, condition, disease, or other biological parameter. This can include but is not limited to the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels.
- peptide “peptide,” “polypeptide,” and “protein” are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another.
- polypeptide refers to amino acids joined to each other by peptide bonds or modified peptide bonds, e.g., peptide isoesters, etc. and may contain modified amino acids other than the 20 gene-encoded amino acids.
- the polypeptides can be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Modifications can occur anywhere in the polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. The same type of modification can be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide can have many types of modifications.
- Modifications include, without limitation, acetylation, acylation, ADP-ribosylation, amidation, covalent cross-linking or cyclization, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of a phosphytidylinositol, disulfide bond formation, demethylation, formation of cysteine or pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristolyation, oxidation, pergylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of amino acids to protein such as arginylation.
- peptidomimetic means a mimetic of a peptide which includes some alteration of the normal peptide chemistry. Peptidomimetics typically enhance some property of the original peptide, such as increase stability, increased efficacy, enhanced delivery, increased half-life, etc. Methods of making peptidomimetics based upon a known polypeptide sequence is described, for example, in U.S. Pat. Nos. 5,631,280; 5,612,895; and 5,579,250. Use of peptidomimetics can involve the incorporation of a non-amino acid residue with non-amide linkages at a given position.
- One embodiment of the present invention is a peptidomimetic wherein the compound has a bond, a peptide backbone or an amino acid component replaced with a suitable mimic.
- suitable amino acids which may be suitable amino acid mimics include ⁇ -alanine, L- ⁇ -amino butyric acid, L- ⁇ -amino butyric acid, L- ⁇ -amino isobutyric acid, L- ⁇ -amino caproic acid, 7-amino heptanoic acid, L-aspartic acid, L-glutamic acid, N- ⁇ -Boc-N- ⁇ -CBZ-L-lysine, N- ⁇ -Boc-N- ⁇ -Fmoc-L-lysine, L-methionine sulfone, L-norleucine, L-norvaline, N- ⁇ -Boc-N- ⁇ CBZ-L-ornithine, N- ⁇ -Boc-N- ⁇ -C
- protein domain refers to a portion of a protein, portions of a protein, or an entire protein showing structural integrity; this determination may be based on amino acid composition of a portion of a protein, portions of a protein, or the entire protein.
- amino acid refers to an amino acid that is incorporated into a polypeptide.
- the amino acid may be a naturally occurring amino acid and, unless otherwise limited, may encompass known analogs of natural amino acids that can function in a similar manner as naturally occurring amino, acids.
- a “fusion protein” refers to a polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide.
- the fusion protein can be formed by the chemical coupling of the constituent polypeptides or it can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein.
- a single chain fusion protein is a fusion protein having a single contiguous polypeptide backbone. Fusion proteins can be prepared using conventional techniques in molecular biology to join the two genes in frame into a single nucleic acid, and then expressing the nucleic acid in an appropriate host cell under conditions in which the fusion protein is produced.
- the C terminal domain of FUS contains an uncommon nuclear localization sequence (NLS) motif called PY-NLS that binds the nuclear import receptor transportin. Phosphorylation of FUS leads to its association with transportin and nuclear translocation with consequent increased in collagen production. Therefore, disclosed herein is an isolated peptide (or peptidomimetic thereof) comprising a transportin-binding moiety, which inhibits FUS from binding transportin, linked to a membrane translocating motif. In some embodiments, the disclosed peptide has a binding affinity greater than about 10 5 (e.g., 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , and 10 12 or more) moles/liter for transportin.
- 10 5 e.g., 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , and 10 12 or more
- the transportin-binding moiety comprises a C-terminal fragment of a FUS ribonucleoprotein.
- the transportin-binding moiety can comprise the amino acid sequence SRGEHRQDRRERPY (SEQ ID NO:1), or a conservative variant thereof.
- Non-limiting examples of membrane translocating motifs include Polyarginine (e.g., R9), Antennapedia sequences, TAT, HIV-Tat, Penetratin, Antp-3A (Antp mutant), Buforin II, Transportan, MAP (model amphipathic peptide), K-FGF, Ku70, Prion, pVEC, Pep-1, SynB1, Pep-7, HN-1, BGSC (Bis-Guanidinium-Spermidine-Cholesterol, and BGTC (Bis-Guanidinium-Tren-Cholesterol).
- Polyarginine e.g., R9
- Antennapedia sequences e.g., TAT, HIV-Tat, Penetratin, Antp-3A (Antp mutant), Buforin II, Transportan, MAP (model amphipathic peptide), K-FGF, Ku70, Prion, pVEC, Pep-1, SynB1, Pep-7, HN-1,
- the membrane translocating motif comprises a signal sequence hydrophobic region (SSHR).
- the SSHR can be derived from an integrin ⁇ 3 protein, such as a human integrin ⁇ 3 protein, or from a fibroblast growth factor 4 (FGF4) protein, such as a human FGF4 protein.
- FGF4 fibroblast growth factor 4
- the membrane translocating motif comprises the amino acid sequence XXXXLLPXXLLALLAP (SEQ ID NO:2) or XXXXLLPXXLLAVLAP (SEQ ID NO:3), wherein X is any amino acid or absent.
- the membrane translocating motif comprises the amino acid sequence AAVALLPAVLLALLAP (SEQ ID NO:4) or AAVALLPAVLLAVLAP (SEQ ID NO:5).
- the polypeptide comprises the amino acid sequence AAVALLPAVLLALLAP—SRGEHRQDRRERPY (SEQ ID NO:6) or AAVALLPAVLLAVLAP—SRGEHRQDRRERPY (SEQ ID NO:7), wherein “—” is a linker or peptide bond.
- Linkers can be short peptide sequences that occur between protein domains.
- the linkers can be flexible or rigid. Flexible linkers are often composed of flexible residues like glycine and serine so that the adjacent protein domains are free to move relative to one another.
- the linker can be a polyglycine (e.g. 3, 4, or 5 glycine), a polyserine (e.g.
- the linker can be a glycine and serine linker, such as, for example, a G4S, GSG4, G2SG3SG2, G2SG, G3S linker, or any other linker known in the art where the base linker sequence can optionally be repeated 2, 3, 4, or more times.
- the polypeptide comprises the amino acid sequence
- the disclosed peptide can further include one or more additional moieties.
- the peptide can contain a homing peptide or organ-specific or cell-specific Fab antibody fragment for targeted delivery to an organ, such as the lung, kidney, skin, heart, pancreas, uterus, retina, intestines, prostate, or liver.
- the peptide can also contain a label, such as a fluorescent dye.
- the methods for selecting homing peptides or Fab antibody fragments are available as described in several publications. For example, those skilled in the art can use published protocols in Korbelin J t al 2016 Mol.
- homing peptides include but are not limited to the lysine glutamine (K2E3) 3 K peptide which has renal specificity; CARSKNKDC (SEQ ID NO: 12) which has vascular specificity; and the lung homing peptide X 1 -G-F-E-X 2 (SEQ ID NO: 13), where X 1 and X 2 each is 1 to 10 independently selected amino acids including, for example, the sequence CGFECVRQCPERC (SEQ ID NO: 14) or CGFELETC (SEQ ID NO: 15).
- the disclosed peptide comprises the amino acid sequence
- the disclosed peptide comprises the amino acid sequence
- the disclosed polypeptide comprises a conservative variant of a disclosed amino acid sequence.
- the disclosed polypeptide comprises a disclosed amino acid sequence having 1, 2, 3, or 4 conservative amino acid substitutions.
- the disclosed peptide can have a variety of lengths and structures as described herein.
- the disclosed peptide can consist essentially of from about 25 to about 100 amino acids, including about 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more amino acids.
- the disclosed peptide can comprise less than about 100 amino acid residues, including less than about 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, or 30 amino acid residues.
- the disclosed peptide can comprise more than about 25 amino acid residues, including more than about 25, 30, 35, 40, 45, or 50 amino acid residues.
- the disclosed polypeptides can be artificial sequences and can be synthesized in vitro and/or recombinantly.
- the disclosed polypeptides can be peptides that are not naturally occurring proteins and can be peptides that have at least two contiguous sequences that are not contiguous in a naturally occurring protein.
- Fusion proteins also known as chimeric proteins, are proteins created through the joining of two or more genes which originally coded for separate proteins. Translation of this fusion gene results in a single polypeptide with function properties derived from each of the original proteins. Recombinant fusion proteins can be created artificially by recombinant DNA technology for use in biological research or therapeutics. Chimeric mutant proteins occur naturally when a large-scale mutation, typically a chromosomal translocation, creates a novel coding sequence containing parts of the coding sequences from two different genes.
- fusion proteins are made possible by the fact that many protein functional domains are modular.
- the linear portion of a polypeptide which corresponds to a given domain, such as a tyrosine kinase domain may be removed from the rest of the protein without destroying its intrinsic enzymatic capability.
- any of the herein disclosed functional domains can be used to design a fusion protein.
- a recombinant fusion protein is a protein created through genetic engineering of a fusion gene. This typically involves removing the stop codon from a cDNA sequence coding for the first protein, then appending the cDNA sequence of the second protein in frame through ligation or overlap extension PCR. That DNA sequence will then be expressed by a cell as a single protein.
- the protein can be engineered to include the full sequence of both original proteins, or only a portion of either.
- linker or “spacer” peptides are also added which make it more likely that the proteins fold independently and behave as expected.
- linkers in protein or peptide fusions are sometimes engineered with cleavage sites for proteases or chemical agents which enable the liberation of the two separate proteins.
- This technique is often used for identification and purification of proteins, by fusing a GST protein, FLAG peptide, or a hexa-his peptide (aka: a 6 ⁇ his-tag) which can be isolated using nickel or cobalt resins (affinity chromatography).
- Chimeric proteins can also be manufactured with toxins or anti-bodies attached to them in order to study disease development.
- IRES elements can be used to create multigene, or polycistronic, messages.
- IRES elements are able to bypass the ribosome scanning model of 5′ methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988).
- IRES elements from two members of the picornavirus family polio and encephalomyocarditis have been described (Pelletier and Sonenberg, 1988), as well an IRES from a mammalian message (Macejak and Sarnow, 1991).
- IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages.
- IRES element By virtue of the IRES element, each open reading frame is accessible to ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (U.S. Pat. Nos. 5,925,565 and 5,935,819; PCT/US99/05781). IRES sequences are known in the art and include those from encephalomycarditis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell.
- EMCV encephalomycarditis virus
- the disclosed peptide can further include one or more additional moieties.
- the peptide can contain a homing peptide for targeted delivery to an organ, such as the lung, kidney, skin, heart, pancreas, uterus, retina, intestines, prostate, or liver.
- the peptide can also contain a label, such as a fluorescent dye.
- the homing peptide can be an Fab antibody fragment specific for an organ-specific or cell-specific epitope (such as, for example, a cell-specific or organ-specific peptide, polypeptide, or protein).
- organ-specific and “cell-specific” epitope is meant an epitope (such as, for example, a peptide, polypeptide, or protein) whose expression is limited to that cell-type or organ.
- Therapeutic molecules such as the polypeptides disclosed herein, can be used therapeutically in combination with a pharmaceutically acceptable carrier.
- pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- Pharmaceutical carriers suitable for administration of the molecules provided herein include any such carriers known to those skilled in the art to be suitable for the particular mode of administration.
- Pharmaceutical compositions may include thickeners, diluents, buffers, preservatives, surface active agents and the like in addition to the molecule of choice.
- Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents, anti-inflammatory agents, anesthetics, and the like.
- Liquid pharmaceutically administrable compositions can, for example, be prepared by dissolving, dispersing, or otherwise mixing a molecules as defined above and optional pharmaceutical adjuvants in a carrier, such as, for example, water, saline, aqueous dextrose, glycerol, glycols, ethanol, and the like, to thereby form a solution or suspension.
- a carrier such as, for example, water, saline, aqueous dextrose, glycerol, glycols, ethanol, and the like, to thereby form a solution or suspension.
- the pharmaceutical composition to be administered may also contain minor amounts of nontoxic auxiliary substances such as wetting agents, emulsifying agents, solubilizing agents, pH buffering agents and the like, for example, acetate, sodium citrate, cyclodextrin derivatives, sorbitan monolaurate, triethanolamine sodium acetate, triethanolamine oleate, and other such agents.
- nontoxic auxiliary substances such as wetting agents, emulsifying agents, solubilizing agents, pH buffering agents and the like, for example, acetate, sodium citrate, cyclodextrin derivatives, sorbitan monolaurate, triethanolamine sodium acetate, triethanolamine oleate, and other such agents.
- Parenteral formulations can be prepared as aqueous compositions using techniques is known in the art. Typically, such compositions can be prepared as injectable formulations, for example, solutions or suspensions; solid forms suitable for using to prepare solutions or suspensions upon the addition of a reconstitution medium prior to injection; emulsions, such as water-in-oil (w/o) emulsions, oil-in-water (o/w) emulsions, and microemulsions thereof, liposomes, or emulsomes.
- injectable formulations for example, solutions or suspensions
- solid forms suitable for using to prepare solutions or suspensions upon the addition of a reconstitution medium prior to injection emulsions, such as water-in-oil (w/o) emulsions, oil-in-water (o/w) emulsions, and microemulsions thereof, liposomes, or emulsomes.
- emulsions such as water-in-oil (w/o) emulsion
- Solutions and dispersions of the active compounds as the free acid or base or pharmacologically acceptable salts thereof can be prepared in water or another solvent or dispersing medium suitably mixed with one or more pharmaceutically acceptable excipients including, but not limited to, surfactants, dispersants, emulsifiers, pH modifying agents, and combination thereof.
- Suitable surfactants may be anionic, cationic, amphoteric or nonionic surface active agents.
- Suitable anionic surfactants include, but are not limited to, those containing carboxylate, sulfonate and sulfate ions.
- anionic surfactants include sodium, potassium, ammonium of long chain alkyl sulfonates and alkyl aryl sulfonates such as sodium dodecylbenzene sulfonate; dialkyl sodium sulfosuccinates, such as sodium dodecylbenzene sulfonate; dialkyl sodium sulfosuccinates, such as sodium bis-(2-ethylthioxyl)-sulfosuccinate; and alkyl sulfates such as sodium lauryl sulfate.
- Cationic surfactants include, but are not limited to, quaternary ammonium compounds such as benzalkonium chloride, benzethonium chloride, cetrimonium bromide, stearyl dimethylbenzyl ammonium chloride, polyoxyethylene and coconut amine.
- nonionic surfactants include ethylene glycol monostearate, propylene glycol myristate, glyceryl monostearate, glyceryl stearate, polyglyceryl-4-oleate, sorbitan acylate, sucrose acylate, PEG-150 laurate, PEG-400 monolaurate, polyoxyethylene monolaurate, polysorbates, polyoxyethylene octylphenylether, PEG-1000 cetyl ether, polyoxyethylene tridecyl ether, polypropylene glycol butyl ether, Poloxamer® 401, stearoyl monoisopropanolamide, and polyoxyethylene hydrogenated tallow amide.
- amphoteric surfactants include sodium N-dodecyl- ⁇ -alanine, sodium N-lauryl- ⁇ -iminodipropionate, myristoamphoacetate, lauryl betaine and lauryl sulfobetaine.
- the formulation can contain a preservative to prevent the growth of microorganisms. Suitable preservatives include, but are not limited to, parabens, chlorobutanol, phenol, sorbic acid, and thimerosal.
- the formulation may also contain an antioxidant to prevent degradation of the active agent(s).
- the formulation is typically buffered to a pH of 3-8 for parenteral administration upon reconstitution.
- Suitable buffers include, but are not limited to, phosphate buffers, acetate buffers, and citrate buffers.
- Water soluble polymers are often used in formulations for parenteral administration. Suitable water-soluble polymers include, but are not limited to, polyvinylpyrrolidone, dextran, carboxymethylcellulose, and polyethylene glycol.
- Sterile injectable solutions can be prepared by incorporating the active compounds in the required amount in the appropriate solvent or dispersion medium with one or more of the excipients listed above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those listed above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the powders can be prepared in such a manner that the particles are porous in nature, which can increase dissolution of the particles. Methods for making porous particles are well known in the art.
- compositions can be designed for immediate release, sustained release, delayed release and/or burst release of one or more polypeptides in a therapeutically effective amount.
- the formulation provides an initial burst release of a “loading dosage”, followed by a sustained release to maintain the therapeutically effective dosage. This can be accomplished using a delayed and/or extended release formulation.
- methods for reducing, inhibiting, preventing, or treating FUS-mediated collagen production by a cell comprising administering to the subject a therapeutically effective amount of a composition comprising an agent that inhibits nuclear translocation of Fused in Sarcoma (FUS).
- the agent for reducing, inhibiting, preventing, or treating a fibrotic disease or FUS collagen production can be any isolated peptides disclosed herein comprising a transportin-binding moiety linked to a membrane translocating motif.
- fibrotic diseases can include, but are not limited to pulmonary fibrosis (including, cystic fibrosis and radiation induced lung injury), atrial fibrosis, glomerulosclerosis, kidney damage, skin fibrosis (scleroderma), scleroderma from a systemic fibrosis, cirrhosis, Crohn's Disease, Keloid, Myelofibrosis, arthrofibrosis, fibrosarcoma, osteosarcoma tumor, or collagen production by a tumor.
- pulmonary fibrosis including, cystic fibrosis and radiation induced lung injury
- atrial fibrosis including, atrial fibrosis, glomerulosclerosis, kidney damage, skin fibrosis (scleroderma), scleroderma from a systemic fibrosis, cirrhosis, Crohn's Disease, Keloid, Myelofibrosis, arthrofibrosis, fibrosarcoma, osteosarcoma tumor, or collagen production by
- the method involves administering a polypeptide disclosed herein.
- the disclosed polypeptides can in some cases be administered in a dose equivalent to parenteral administration of about 0.1 ng to about 100 g per kg of body weight, about 10 ng to about 50 g per kg of body weight, about 100 ng to about 1 g per kg of body weight, from about 1 ⁇ g to about 100 mg per kg of body weight, from about 1 ⁇ g to about 50 mg per kg of body weight, from about 1 mg to about 500 mg per kg of body weight; and from about 1 mg to about 50 mg per kg of body weight.
- the amount of polypeptide administered to achieve a therapeutic effective dose is about 0.1 ng, 1 ng, 10 ng, 100 ng, 1 ⁇ g, 10 ⁇ g, 100 ⁇ g, 1 mg, 2 mg, 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, 10 mg, 11 mg, 12 mg, 13 mg, 14 mg, 15 mg, 16 mg, 17 mg, 18 mg, 19 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg, 100 mg, 500 mg per kg of body weight or greater.
- the dose of polypeptide to be administered provides a final plasma level of polypeptide of about 100 ng/ml to about 1000 ng/ml, about 1100 ng/ml to about 1450 ng/ml, 100 ng/ml to about 250 ng/ml, about 200 ng/ml to about 350 ng/ml, about 300 ng/ml to about 450 ng/ml, about 350 ng/ml to about 450 ng/ml, about 400 ng/ml to about 550 ng/ml, about 500 ng/ml to about 650 ng/ml, about 600 ng/ml to about 750 ng/ml, about 700 ng/ml to about 850 ng/ml, about 800 ng/ml to about 950 ng/ml, about 900 ng/ml to about 1050 ng/ml, about 1000 ng/ml to about 1150 ng/ml, about 100 ng/ml to about 1250
- compositions including pharmaceutical composition, may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated.
- the disclosed compositions can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intracavity, transdermally, or topically.
- the disclosed composition can be administered therapeutically, to treat, prevent, or reduce fibrotic disease or FUS-mediated collagen production in a subject or prophylactically, to patients or subjects at risk for fibrosis. Accordingly, the compositions may be administered prior to the onset of fibrosis (including, for example, prior to exposure to radiation which could result in fibrotic injury). In one aspect, the disclosed compositions can be administered to the patient or subject as a single one time injection or as multiple administrations. For example, the disclosed compositions can be administered at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 times per day.
- compositions can be administered to the patient or subject at least once about every 4, 6, 8, 12, 24 hours, or every day, every other day, every third day, every fourth day, every fifth day, every sixth day, once a week, once every two weeks, once every three weeks, once a month, once every two months, once every three months, once every four months, once every five months, once every six months, once every seven months, once every eight months, once every nine months, once every ten months, once every eleven months, once every year, once every eighteen months, once every two year, once every three years, once every four years, or once every five years.
- Treatment can be continued as long as needed to reduce, inhibit, prevent, or eliminate the fibrotic disease or symptoms associated with the disease.
- the disclosed polypeptides can be administered adjunctively with other active compounds such as analgesics, anti-inflammatory drugs, antipyretics, antiepileptics, antihistamines, antimigraine drugs, antimuscarinics, anxioltyics, sedatives, hypnotics, antipsychotics, bronchodilators, anti-asthma drugs, cardiovascular drugs, corticosteroids, doparninergics, electrolytes, parasympathomimetics, stimulants, anorectics and anti-narcoleptics.
- active compounds such as analgesics, anti-inflammatory drugs, antipyretics, antiepileptics, antihistamines, antimigraine drugs, antimuscarinics, anxioltyics, sedatives, hypnotics, antipsychotics, bronchodilators, anti-asthma drugs, cardiovascular drugs, corticosteroids, doparninergics, electro
- compositions disclosed herein may be administered prophylactically to patients or subjects who are at risk for fibrosis.
- the method can further comprise identifying a subject at risk for fibrosis prior to administration of the herein disclosed compositions.
- Integrins are transmembrane receptors for ECM components composed of non-covalently bound ⁇ and ⁇ subunits that heterodimerize to produce 24 different transmembrane receptors (Hynes, R. 2002. Cell 110:673-687; Pan, L., et al. 2016. Springerplus 5:1094). Integrin ⁇ 1 ⁇ 1 (Itg ⁇ 1 ⁇ 1) is a major collagen IV receptor that is highly expressed by podocytes, endothelial cells and mesangial cells of the glomerulus (Patey, N., et al. 1994. Cell Adhes Commun 2:159-167).
- Itg ⁇ 1 ⁇ 1 does not affect the normal glomerular function; however, this integrin plays an important role in regulating the glomerulus response to injury. Itg ⁇ 1 ⁇ 1 has been identified as a negative, inhibitory, modulator of glomerular injury. To this end, Itg ⁇ 1 ⁇ 1 prevents excessive injury-mediated glomerulosclerosis by negatively regulating EGF receptor (EGFR) tyrosine phosphorylation, by preventing the assembly of the NADPH oxidase and generation of profibrotic ROS, and by negatively regulating collagen levels at both translational and transcriptional levels (Chen, X., et al. 2007. Mol Cell Biol 27:3313-3326; Chen, X., et al. 2004.
- EGFR EGF receptor
- TGF- ⁇ receptor II has also been identified as another target of Itg ⁇ 1 ⁇ 1. Itg ⁇ 1 ⁇ 1 also negatively regulates TGF- ⁇ receptor II-mediated SMAD3 activation and pro-fibrotic signaling by downregulating the tyrosine phosphorylation levels of TGF- ⁇ receptor II (Chen, X., et al. 2014. J Clin Invest 124:3295-3310).
- a mechanism whereby Itg ⁇ 1 ⁇ 1 negatively regulates the tyrosine phosphorylation levels of several growth factor receptors as well as scaffolding proteins is by recruiting and activating the tyrosine phosphatase TCPTP (Mattila, E., et al. 2005. Nat Cell Biol 7:78-85). Consistent with this finding, cells lacking Itg ⁇ 1 ⁇ 1 do not recruit and activate TCPTP thus showing increased basal levels of tyrosine phosphorylated proteins (Chen, X., et al. 2007. Mol Cell Biol 27:3313-3326).
- mice lacking Itg ⁇ 1 ⁇ 1 manifest excessive and accelerated glomerulosclerosis following various models of glomerular injury, including partial renal ablation, adriamycin injection, oxidative stress, and type 1 diabetes (Chen, X., et al. 2004. Am J Pathol 165:617-630; Wang, H., et al. 2015. Kidney Int 87:948-962; Borza, C. M., et al. 2012. J Am Soc Nephrol 23:1027-1038; Zent, R., et al. 2006. Kidney Int 70:460-470; Yu, L., et al. 2012. Kidney Int 81:1086-1097).
- EGFR is a receptor tyrosine kinase activated by several ligands including EGF, TGF- ⁇ , and HB-EGF. This receptor is expressed by mesangial cells and podocytes and plays an important role in the development of the kidney (Zhuang, S., et al. 2014. Kidney Int Suppl (2011) 4:70-74). In addition, EGFR is a key determinant in the initiation, development and progression of kidney glomerular injury.
- mice lacking HB-EGF expression specifically in endothelial cells show decrease glomerular EGFR activation and decreased angiotensin-II mediated glomerular injury (Zeng, F., et al. 2016. Am J Physiol Renal Physiol:ajprenal 311(4):F695-F707).
- Itg ⁇ 1 ⁇ 1 A key negative regulator of EGFR activation and pro-fibrotic function is Itg ⁇ 1 ⁇ 1. At least two mechanisms account for this negative regulation: Itg ⁇ 1 ⁇ 1 binds and activates TCPTP and interacts with the membrane scaffolding protein caveolin 1, two negative regulators of EGFR activation (Chen, X., et al. 2010. Mol Cell Biol 30:3048-3058; Borza, C. M., et al. 2010. J Biol Chem 285:40114-40124; Borza, C. M., et al. 2010. J Biol Chem 285:40114-40124; Abulrob, A., et al. 2004. Oncogene 23:6967-6979). To further determine the contribution of EGFR to glomerular injury in Itg ⁇ 1KO mice, a genetic and a pharmacological approach was used.
- FUS is shown herein to contain Tyr6 and Tyr296 as two EGFR phosphorylatable and TCPTP dephosphorylatable tyrosines.
- levels of nuclear FUS seem to be associated with levels of activated EGFR.
- FUS also known as translocated in liposarcoma (TLS)
- TLS translocated in liposarcoma
- FUS consists of an N-terminal end involved in transcriptional activation and a C-terminal end involved in protein-RNA and protein-protein interactions (Sama, R. R., et al. 2014. ASN Neuro 6).
- the C terminal domain also contains an uncommon nuclear localization sequence (NLS) motif called PY-NLS because the PY is localized at the C-terminus of the protein.
- NLS nuclear localization sequence
- the PY-NLS binds the nuclear import receptor transportin (or karyopherin ⁇ 2) (Dormann, D., et al. 2010. Embo J 29:2841-2857).
- ALS amyotrophic lateral sclerosis
- mice have been generated that express human FUSWT or the pathological mutation FUSR521G (no longer able to translocate to the nucleus) under the control of the cytomegalovirus immediate early enhancer-chicken ⁇ -actin hybrid promoter. These mice express wild type or mutated FUS only when crossed with a Cre mouse line. When crossed with a global Cre mouse line, thus forcing expression of these two proteins in all cells, these mice are born alive but develop severe motor deficits phenocopying the human diseases (Sephton, C. F., et al. 2014. Proc Natl Acad Sci U.S.A. 111:E4769-4778).
- mice have been crossed with PDGFR-Cre mice in order to drive expression of WT and mutated form of FUS preferentially in mesangial cells.
- FUShet mice were also obtained. While FUSKO mice die immediately after birth on a C57/B6 background (Hicks, G. G., et al. 2000. Nat Genet 24:175-179), their survival rate increases on the BALB/c background. These mice are used to analyze the contribution of FUS in the regulation of collagen production in both physiological and pathological conditions.
- FUS is a Ribonucleoprotein Regulated by TCPTP and EGFR.
- FUS is a RNA-protein binding molecule that consists of an N-terminal end involved in transcriptional activation and a C-terminal end involved in protein and RNA binding.
- the rationale for selecting this candidate for study is as following: 1) FUS binds Sp1 (Dhar, S. K., et al. 2014. Antioxid Redox Signal 20:1550-1566) a transcriptional activator involved in collagen synthesis and fibrosis (Ghosh, A. K., et al. 2013. Exp Biol Med (Maywood) 238:461-481). 2) Patients with ALS show decreased levels of collagen in skin and blood (34, 35). 3) Collagen IV is a multimeric protein composed of 3 ⁇ subunits.
- subunits are encoded by 6 different genes ( ⁇ 1- ⁇ 6), each of which can form a triple helix with 2 other subunits to form type IV collagen.
- the ⁇ 1 and ⁇ 2 chains form the ⁇ 1 ⁇ 2 ⁇ 1 type IV collagen and their transcription is regulated by a bidirectional promoter (846 bp) and a enhancer (329 bp) located in the first intron of the ⁇ 1(IV) chain gene (Burbelo, P. D., et al. 1988. Proc Natl Acad Sci USA 85:9679-9682).
- ALGGEN-PROMO-v3 revealed the presence of 4 and 9 FUS responsive element in the enhancer and promoter, respectively.
- FUS has 36 tyrosines and analysis of FUS with PhosphoMotif Finder revealed Tyr6 and Tyr296 as two EGFR phosphorylatable and TCPTP dephosphorylatable tyrosines.
- PhosphoMotif Finder revealed Tyr6 and Tyr296 as two EGFR phosphorylatable and TCPTP dephosphorylatable tyrosines.
- Studies in Drosophila suggest a genetic link between Cabeza (orthologue of human FUS) and rhomboid-1, a key component of the EGFR signaling pathway (Shimamura, M., et al. 2014. Exp Cell Res 326:36-45).
- Data shown below clearly suggest a link between nuclear localization of FUS and collagen synthesis.
- FUS levels were analyzed in the glomeruli of control and type 2 diabetic mice. While no expression of this ribonucleoprotein was detected in the glomeruli of non-diabetic mice, FUS expression became evident in the glomeruli of type 2 diabetic mice ( FIG. 3A ).
- WT mice were treated with Adriamycin (ADR) and a significant increase in nuclear FUS levels was observed in glomeruli isolated 3 days after ADR treatment ( FIG. 3B ,C).
- ADR Adriamycin
- mesangial cells were isolated from WT and Itg ⁇ 1KO mice and the basal level of nuclear FUS was analyzed. FUS was detected in the nuclei of both WT and Itg ⁇ 1KO mesangial cells, although its levels were higher and more tyrosine phosphorylated in the latter group ( FIG. 4A-C ).
- mesangial cells were treated with erlotinib. This EGFR inhibitor decreased EGFR activation ( 5 A,B) and significantly decreased nuclear FUS ( FIG. 5A ,C) and collagen IV levels ( FIG.
- RFP-FUS Red Fluorescent Protein gene
- FIGS. 4,5 To determine whether the increased total and phosphorylated levels of nuclear FUS observed in Itg ⁇ 1KO cells ( FIGS. 4,5 ) are responsible for increased levels of collagen production in these cells ( FIG. 5D ,E), Itg ⁇ 1KO cells were treated with either scrambled (Scr) or FUS siRNA and then the levels of FUS and collagen IV were analyzed. The focus was on collagen IV, as it is the major Itg ⁇ 1 ⁇ 1 binding collagen (Gardner, H., et al. 1996. Dev Biol 175:301-313); and the collagen IV promoter and enhancer region contain several FUS responsive elements. FUS-siRNA, but not Scr-siRNA, significantly downregulated FUS levels and this event was accompanied by a significant decrease in collagen IV production ( FIG. 7A ,B). Thus, FUS either directly and/or indirectly controls collagen levels.
- FUS has an uncommon nuclear localization sequence (NLS) motif called PY-NLS because the PY is localized at the C-terminus of the protein (RGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY, SEQ ID NO:12).
- NLS nuclear localization sequence
- This non-classical NLS motif is recognized by transportin and methylation of the arginine in the RGG motif or phosphorylation of the tyrosine in the PY motif alters FUS/transportin interaction and interferes with FUS nuclear translocation (Zhang, Z. C., et al. 2012. Proc Natl Acad Sci USA 109:12017-12021).
- a peptide AAVALLPAVLLALLAPSRGEHRQDRRERPY (SEQ ID NO:8) was designed carrying a FUS PY-NLS derived peptide (bold) fused with the signal sequence hydrophobic region of FGF4 (Italicized).
- Signal sequence hydrophobic region was designed as a membrane translocating fragment that enables NLS to cross cell membrane bypassing endosomal pathway (Veach, R. A., et al. 2004. J Biol Chem 279:11425-11431).
- the mutated version of the fragment-designed peptide AAVALLPAVLLALLAPSEGEHRADEEERGA (SEQ ID NO:13) contained amino acid replacements in PY-NLS of FUS.
Abstract
Description
- This application claims the benefit of U.S. Provisional Patent Application Ser. No. 62/451,636 filed Jan. 27, 2017, which is fully incorporated herein by reference in its entirety.
- This invention was made with Government Support under Grant No. DK095761 awarded by the National Institutes of Health and Grant No. BX002025 from the Department of Veterans Affairs. The Government has certain rights in the invention.
- End stage glomerular disease is the most common cause of chronic kidney failure and represents a major cause of morbidity and mortality for Veterans and civilian patients. Despite the fact that glomerular disease has multiple etiologies, the final pathology is characterized by overproduction and deposition of extracellular matrix (ECM) and ensuing glomerulosclerosis (Borza, C. M., et al. 2015. Curr Top Membr 76:231-253). In glomerulosclerosis, the synthesis and remodeling of ECM components (mainly collagens) are uncontrolled thus leading to scarred glomeruli characterized by abnormal collagen deposition, particularly collagens type I, IV, V and VI. Although many pathways have been implicated in both initiation and progression to glomerular fibrosis, to date there are very few therapeutic options to treat glomerulosclerosis. Thus, there is the need of identifying key factors contributing to the initiation and/or progression to glomerulosclerosis, and fibrotic diseases in other organs (e.g. liver, lungs, skin, retroperitoneal space), with the expectation that targeting such factors will help in slowing and ideally suppressing fibrotic responses, and ultimately reducing end stage kidney disease as well as other organs' fibrotic diseases.
- Disclosed herein are compositions and methods for inhibiting collagen production mediated by the Fused in Sarcoma (FUS) ribonucleoprotein. These compositions and methods can therefore be used to treat and prevent fibrotic disease in a subject, such as a subject with liver, kidney, or lung disease or damage.
- As disclosed herein, the C terminal domain of FUS contains an uncommon nuclear localization sequence (NLS) motif called PY-NLS that binds the nuclear import receptor transportin. Phosphorylation of FUS leads to its association with transportin and nuclear translocation with consequent increased in collagen production. Therefore, disclosed herein is an isolated peptide that comprises a transportin-binding moiety, which inhibits FUS from binding transportin, linked to a membrane translocating motif.
- In some embodiments, the transportin-binding moiety comprises a C-terminal fragment of a FUS ribonucleoprotein. For example, the transportin-binding moiety can comprise the amino acid sequence SRGEHRQDRRERPY (SEQ ID NO:1), or a conservative variant thereof.
- In some embodiments, the membrane translocating motif comprises a signal sequence hydrophobic region (SSHR). For example, the SSHR can be derived from an integrin 133 protein, such as a human integrin 133 protein, or from a fibroblast growth factor 4 (FGF4) protein, such as a human FGF4 protein. In some embodiments, the membrane translocating motif comprises the amino acid sequence XXXXLLPXXLLALLAP (SEQ ID NO:2) or XXXXLLPXXLLAVLAP (SEQ ID NO:3), wherein X is any amino acid or absent. In some embodiments, the membrane translocating motif comprises the amino acid sequence AAVALLPAVLLALLAP (SEQ ID NO:4) or AAVALLPAVLLAVLAP (SEQ ID NO:5).
- In some embodiments, the polypeptide comprises the amino acid sequence AAVALLPAVLLALLAP—SRGEHRQDRRERPY (SEQ ID NO:6) or AAVALLPAVLLAVLAP—SRGEHRQDRRERPY (SEQ ID NO:7), wherein “—” is a linker or peptide bond. Linkers can be short peptide sequences that occur between protein domains. The linkers can be flexible or rigid. Flexible linkers are often composed of flexible residues like glycine and serine so that the adjacent protein domains are free to move relative to one another. In particular, the linker can be a polyglycine (e.g. 3, 4, or 5 glycine), a polyserine (e.g. 3, 4, or 5 serine), or a combination of glycine and serine including repeating combinations. For example, the linker can be a glycine and serine linker, such as, for example, a G4S, GSG4, G2SG3SG2, G2SG, G3S linker, or any other linker known in the art where the base linker sequence can optionally be repeated 2, 3, 4, or more times. In some embodiments, the polypeptide comprises the amino acid sequence
-
(SEQ ID NO: 8) AAVALLPAVLLALLAPSRGEHRQDRRERPY or (SEQ ID NO: 9) AAVALLPAVLLAVLAPSRGEHRQDRRERPY. - The disclosed peptide can further include one or more additional moieties. For example, the peptide can contain a homing peptide or organ-specific or cell-specific Fab antibody fragment for targeted delivery to an organ, such as the lung, kidney, skin, heart, pancreas, uterus, retina, intestines, prostate, or liver. The peptide can also contain a label, such as a fluorescent dye.
- Also disclosed is a method for decreasing FUS-mediated collagen production by a cell, comprising contacting the cell with an effective amount of a composition comprising an agent that inhibits nuclear translocation of FUS. Also disclosed is a method for treating fibrotic disease in a subject that involves administering to the subject a therapeutically effective amount of a composition comprising an agent that inhibits nuclear translocation of FUS.
- In some embodiments, the agent used in the disclosed methods inhibits FUS from binding transportin. For example, the agent can compete with FUS for binding to transportin, or can compete with transportin for binding to FUS. In some embodiments, the agent comprises a peptide disclosed herein having a transportin-binding moiety linked to a membrane translocating motif.
- The disclosed method can be used to treat any condition involving abnormal FUS-mediated collagen formation. In particular, the method can be used to treat a fibrosis involving abnormally excessive collagen accumulation. For example, the subject can have a kidney disease or damage, wherein the method inhibits glomerulosclerosis in the subject. The subject can have a liver disease or damage, wherein the method inhibits cirrhosis in the subject. The subject can have a lung disease or damage, wherein the method inhibits pulmonary fibrosis in the subject. The subject can have a retroperitoneal fibrosis, wherein the method inhibits the formation of fibrous tissue in the retroperitoneum. The subject can have skin fibrosis (scleroderma) associated with systemic sclerosis in which integrins and transforming growth factor beta as well as connective tissue growth factor play significant role (Ray K. Nat Rev Rheumatol 2013, 11:637
- The subject can have a fibrosarcoma or osteosarcoma tumor, wherein the method inhibits collagen production by the tumor.
- The disclosed compositions can further contain or be administered with other diagnostic or therapeutic agents for fibrosis. For example, the disclosed composition can contain or be administered with a corticosteroid or a non-steroidal anti-inflammatory agent. In some embodiments, the disclosed composition contains or is administered with a nuclear transport modifier (NTM) that targets nuclear transport by an importin, such as those described in U.S. Pat. Nos. 8,932,559, 9,044,433, and 9,492,544, which are incorporated by reference in their entirety for the teaching of these NTM molecules and uses thereof.
- The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.
-
FIGS. 1A to 1E . (A) Images of glomeruli from BALB/c WT and Itgα1KOmice 8 weeks after ADR injection. Note that crossing the Itgα1KO mice with the wave-2 mice or treating them with erlotinib improved glomerular injury (A), albuminuria (mean±SEM of 5-7 mice/group) (B, C), and kidney collagen IV levels (erlotinib group shown only, mean±SEM of 3 mice/group) (D, E). -
FIGS. 2A to 2D . (A, B) Kidney paraffin sections of the mice indicated were co-stained with anti-FUS (green) and anti-phospho EGFR (red) antibodies. Note that FUS is highly expressed and co-localize with phospho EGFR in the glomeruli of Itgα1KO mice (B mean±SEM of 10 glom/mice with 3 mice evaluated). (C, D) Nuclear fractionation of glomeruli isolated from 5 WT and 5 Itgα1KO mice showed significantly higher nuclear FUS levels in the Itgα1KO mice. -
FIGS. 3A to 3C . (A) Kidney paraffin sections of eNOSKO or eNOSKO mice crossed with a mouse model oftype 2 diabetes (db/db) were stained with anti-FUS antibody. Note the presence of FUS in the glomeruli of diabetic mice only (24 weeks old mice). (B,C) BALB/c WT mice were injected with adriamycin and then sacrificed at the time indicated. Nuclear fractions from isolated glomeruli blotted with anti-FUS or anti-HDAC2 (as loading control) (C, mean±SEM of 6 mice/treatment). -
FIGS. 4A to 4C . (A, B) Nuclear (N) and non-nuclear (NN) fractions of WT and Itgα1KO mesangial cells showing significantly higher levels of FUS in the nuclei of Itgα1KO cells. (B, mean±SEM of 6 samples). (C) Non-nuclear and nuclear fractions were immuno-precipitated with the anti-pY antibody 4G10 or IgG control and then analyzed by Western Blot for levels of FUS. Note that tyrosine phosphorylated FUS is detected primarily in the nuclei of Itgα1KO cells. -
FIGS. 5A to 5F . WT and Itgα1KO mesangial cells were either kept untreated or treated with erlotinib (ERL) and the levels of phospho EGFR (A, B), nuclear FUS (A, C), collagen IV (D, E) and nuclear phosphorylated FUS (F,) were analyzed by Western blot. In Itgα1KO cells, ERL significantly decreased EGFR activation, nuclear FUS levels, collagen IV levels and tyrosine phosphorylated FUS. (B, C mean±SEM of 6 samples). NN=non-nuclear; N=nuclear. -
FIGS. 6A to 6F . WT and Itgα1KO mesangial cells were treated with EGF for 0 or 30 minutes. The levels of phospho-EGFR and EGFR were then analyzed by Western blot (A) and quantified by densitometry analysis (B, mean SEM of 6 samples). (C) WT (W) and Itgα1KO (K) cells were transiently transfected with RFP or RFP-FUS cDNA and levels of endogenous FUS and RPF-FUS were analyzed by Western blot with anti-RFP or anti-FUS antibody. (D) RFP-FUS transfected cells were treated with EGF for 0 or 30 minutes and then nuclear RFP-FUS (counterstaining with DAPI) was evaluated. (E) The number of RFP-FUS and DAPI cells per microscopic field was counted and expressed as RFP-FUS/DAPI (mean±SEM of 150 cells). WT and Itgα1KO mesangial cells were treated with EGF for 0 or 24 hours. The levels of Collagen IV and AKT (as loading control) were analyzed by Western blot and quantified by densitometry analysis (F, mean±SEM of 3 samples). -
FIGS. 7A to 7C . (A, B) Itgα1KO mesangial cells were treated with scrambled-(Ser) or FUS-siRNA. 48 hours later the levels of FUS and collagen IV were analyzed by WB and quantified by densitometry analysis. (B, mean±SEM of 3 samples). (C) Itgα1KO cells were treated with Scr- or FUS-siRNA. 24 hours later they were transiently transfected with the collagen IV enhancer (E)/firefly luciferase or enhancer/promoter (E/P)/firefly luciferase constructs together with renilla luciferase cDNAs. 24 hours later, the levels of firefly/renilla luciferase activity were analyzed (mean±SEM of 4 samples). -
FIGS. 8A to 8D . (A) Itgα1KO mesangial cells were treated with 0.1 μM FUS PY-NLS derived peptide or its mutant form for 24 hours and then left untreated or treated with EGF (20 ng/ml) for 3 hours. Cells where stained with anti-FUS antibody (Red) or DAPI (Blue) to visualize FUS localization. (B) The intensity of FUS nuclear staining was measured using Image-J and expressed as mean of intensity/cell (mean±SEM of 50 cells). WT and Itgα1KO mesangial cells were treated with EGF for 0 or 24 hours in the presence of either FUS PY-NLS derived peptide or its mutant form for 24 hours. The levels of Collagen IV and FAK (as loading control) were then analyzed by Westem blot (C) and quantified by densitometry analysis (D, mean±SEM of 3 samples). -
FIGS. 9A to 9C . (A) Lysates from WT (W) and Itgα1KO (K) mesangial cells were immuno-precipitated with anti-EGFR antibody or IgG and then analyzed by Western blot for levels of EGFR, phospho EGFR and FUS. (B, C) The levels of phosphor EGFR, EGFR and FUS were analyzed by densitometry and expressed as pEGFR/EGFR and FUS/EGFR ratio (n=4 experiments). -
FIGS. 10A and 10B . Schematic representation of a possible Itgα1β1/FUS interaction in healthy WT (A) or Itgα1KO (B) mesangial cells. It was hypothesize that in healthy cells (A), Itgα1β1 prevents FUS tyrosine phosphorylation, nuclear translocation, and activation of collagen IV synthesis in a both EGFR-dependent and -independent manner. In Itgα1KO cells (B), increased phosphorylation of FUS leads to its association with transportin and nuclear translocation with consequent increased collagen IV synthesis. -
FIG. 11 . In vivo delivery of FAM FUS-PY-NLS peptide injected 5 times every 2 hours. Mice were then sacrificed and kidney and liver frozen sections were analyzed under an epifluorescence microscope. Fluorescent peptide is displayed intracellularly in kidney glomeruli and liver cells. - The term “subject” refers to any individual who is the target of administration or treatment. The subject can be a vertebrate, for example, a mammal. Thus, the subject can be a human or veterinary patient. The term “patient” refers to a subject under the treatment of a clinician, e.g., physician.
- The term “therapeutically effective” refers to the amount of the composition used is of sufficient quantity to ameliorate one or more causes or symptoms of a disease or disorder. Such amelioration only requires a reduction or alteration, not necessarily elimination.
- The term “pharmaceutically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- The terms “treatment” and “treating” refer to the medical management of a patient with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.
- The term “prevent” refers to a treatment that forestalls or slows the onset of a disease or condition or reduced the severity of the disease or condition. Thus, if a treatment can treat a disease in a subject having symptoms of the disease, it can also prevent that disease in a subject who has yet to suffer some or all of the symptoms.
- The term “inhibit,” “reduce,” or “suppress” refers to a decrease in an activity, response, condition, disease, or other biological parameter. This can include but is not limited to the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels.
- The terms “peptide,” “polypeptide,” and “protein” are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another.
- In addition, as used herein, the term “polypeptide” refers to amino acids joined to each other by peptide bonds or modified peptide bonds, e.g., peptide isoesters, etc. and may contain modified amino acids other than the 20 gene-encoded amino acids. The polypeptides can be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Modifications can occur anywhere in the polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. The same type of modification can be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide can have many types of modifications. Modifications include, without limitation, acetylation, acylation, ADP-ribosylation, amidation, covalent cross-linking or cyclization, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of a phosphytidylinositol, disulfide bond formation, demethylation, formation of cysteine or pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristolyation, oxidation, pergylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of amino acids to protein such as arginylation. (See Proteins—Structure and Molecular Properties 2nd Ed., T. E. Creighton, W.H. Freeman and Company, New York (1993); Posttranslational Covalent Modification of Proteins, B. C. Johnson, Ed., Academic Press, New York, pp. 1-12 (1983)).
- As used herein, “peptidomimetic” means a mimetic of a peptide which includes some alteration of the normal peptide chemistry. Peptidomimetics typically enhance some property of the original peptide, such as increase stability, increased efficacy, enhanced delivery, increased half-life, etc. Methods of making peptidomimetics based upon a known polypeptide sequence is described, for example, in U.S. Pat. Nos. 5,631,280; 5,612,895; and 5,579,250. Use of peptidomimetics can involve the incorporation of a non-amino acid residue with non-amide linkages at a given position. One embodiment of the present invention is a peptidomimetic wherein the compound has a bond, a peptide backbone or an amino acid component replaced with a suitable mimic. Some non-limiting examples of unnatural amino acids which may be suitable amino acid mimics include β-alanine, L-α-amino butyric acid, L-γ-amino butyric acid, L-α-amino isobutyric acid, L-ε-amino caproic acid, 7-amino heptanoic acid, L-aspartic acid, L-glutamic acid, N-ε-Boc-N-α-CBZ-L-lysine, N-ε-Boc-N-α-Fmoc-L-lysine, L-methionine sulfone, L-norleucine, L-norvaline, N-α-Boc-N-δCBZ-L-ornithine, N-δ-Boc-N-α-CBZ-L-ornithine, Boc-p-nitro-L-phenylalanine, Boc-hydroxyproline, and Boc-L-thioproline.
- The term “protein domain” refers to a portion of a protein, portions of a protein, or an entire protein showing structural integrity; this determination may be based on amino acid composition of a portion of a protein, portions of a protein, or the entire protein.
- The term “residue” as used herein refers to an amino acid that is incorporated into a polypeptide. The amino acid may be a naturally occurring amino acid and, unless otherwise limited, may encompass known analogs of natural amino acids that can function in a similar manner as naturally occurring amino, acids.
- A “fusion protein” refers to a polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide. The fusion protein can be formed by the chemical coupling of the constituent polypeptides or it can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein. A single chain fusion protein is a fusion protein having a single contiguous polypeptide backbone. Fusion proteins can be prepared using conventional techniques in molecular biology to join the two genes in frame into a single nucleic acid, and then expressing the nucleic acid in an appropriate host cell under conditions in which the fusion protein is produced.
- The C terminal domain of FUS contains an uncommon nuclear localization sequence (NLS) motif called PY-NLS that binds the nuclear import receptor transportin. Phosphorylation of FUS leads to its association with transportin and nuclear translocation with consequent increased in collagen production. Therefore, disclosed herein is an isolated peptide (or peptidomimetic thereof) comprising a transportin-binding moiety, which inhibits FUS from binding transportin, linked to a membrane translocating motif. In some embodiments, the disclosed peptide has a binding affinity greater than about 105 (e.g., 106, 107, 108, 109, 1010, 1011, and 1012 or more) moles/liter for transportin.
- In some embodiments, the transportin-binding moiety comprises a C-terminal fragment of a FUS ribonucleoprotein. For example, the transportin-binding moiety can comprise the amino acid sequence SRGEHRQDRRERPY (SEQ ID NO:1), or a conservative variant thereof.
- Non-limiting examples of membrane translocating motifs include Polyarginine (e.g., R9), Antennapedia sequences, TAT, HIV-Tat, Penetratin, Antp-3A (Antp mutant), Buforin II, Transportan, MAP (model amphipathic peptide), K-FGF, Ku70, Prion, pVEC, Pep-1, SynB1, Pep-7, HN-1, BGSC (Bis-Guanidinium-Spermidine-Cholesterol, and BGTC (Bis-Guanidinium-Tren-Cholesterol).
- In some embodiments, the membrane translocating motif comprises a signal sequence hydrophobic region (SSHR). For example, the SSHR can be derived from an integrin β3 protein, such as a human integrin β3 protein, or from a fibroblast growth factor 4 (FGF4) protein, such as a human FGF4 protein. In some embodiments, the membrane translocating motif comprises the amino acid sequence XXXXLLPXXLLALLAP (SEQ ID NO:2) or XXXXLLPXXLLAVLAP (SEQ ID NO:3), wherein X is any amino acid or absent. In some embodiments, the membrane translocating motif comprises the amino acid sequence AAVALLPAVLLALLAP (SEQ ID NO:4) or AAVALLPAVLLAVLAP (SEQ ID NO:5).
- In some embodiments, the polypeptide comprises the amino acid sequence AAVALLPAVLLALLAP—SRGEHRQDRRERPY (SEQ ID NO:6) or AAVALLPAVLLAVLAP—SRGEHRQDRRERPY (SEQ ID NO:7), wherein “—” is a linker or peptide bond. Linkers can be short peptide sequences that occur between protein domains. The linkers can be flexible or rigid. Flexible linkers are often composed of flexible residues like glycine and serine so that the adjacent protein domains are free to move relative to one another. In particular, the linker can be a polyglycine (e.g. 3, 4, or 5 glycine), a polyserine (e.g. 3, 4, or 5 serine), or a combination of glycine and serine including repeating combinations. For example, the linker can be a glycine and serine linker, such as, for example, a G4S, GSG4, G2SG3SG2, G2SG, G3S linker, or any other linker known in the art where the base linker sequence can optionally be repeated 2, 3, 4, or more times. In some embodiments, the polypeptide comprises the amino acid sequence
-
(SEQ ID NO: 8) AAVALLPAVLLALLAPSRGEHRQDRRERPY or (SEQ ID NO: 9) AAVALLPAVLLAVLAPSRGEHRQDRRERPY. - The disclosed peptide can further include one or more additional moieties. For example, the peptide can contain a homing peptide or organ-specific or cell-specific Fab antibody fragment for targeted delivery to an organ, such as the lung, kidney, skin, heart, pancreas, uterus, retina, intestines, prostate, or liver. The peptide can also contain a label, such as a fluorescent dye. The methods for selecting homing peptides or Fab antibody fragments are available as described in several publications. For example, those skilled in the art can use published protocols in Korbelin J t al 2016 Mol. Therapy, 24(6):1050-1061), Pulmonary Targeting of Adeno-associated Viral Vectors by Next-generation Sequencing-guided Screening of Random Capsid Displayed peptide Libraries, Rosowski S et al Microb Cell Fact. 2018 Jan. 9; 17(1):3. doi: 10.1186/s12934-017-0853-z A novel one-step approach for the construction of yeast surface display Fab antibody libraries, and Kelly R L et al 2018 J. Mol. Biol. 430(1):119-130,doi: 10.1016/j.jmb.2017.11.008. Epub 2017 Nov. 26. Examples of homing peptides include but are not limited to the lysine glutamine (K2E3)3K peptide which has renal specificity; CARSKNKDC (SEQ ID NO: 12) which has vascular specificity; and the lung homing peptide X1-G-F-E-X2(SEQ ID NO: 13), where X1 and X2 each is 1 to 10 independently selected amino acids including, for example, the sequence CGFECVRQCPERC (SEQ ID NO: 14) or CGFELETC (SEQ ID NO: 15). In some aspects, the disclosed peptide comprises the amino acid sequence
-
(SEQ ID NO: 10) XXXXLLPXXLLA$LAP-SRGEHRQDRRERPY, - wherein “X” is any amino acid or a peptide bond,
- wherein “$” is a valine or a leucine, and
- wherein “—” is a linker or a peptide bond.
- In some aspects, the disclosed peptide comprises the amino acid sequence
-
(SEQ ID NO: 11) AAVALLPAVLLA$LAP-SRGEHRQDRRERPY, - wherein “X” is any amino acid or a peptide bond,
- wherein “$” is a valine or a leucine, and
- wherein “—” is a linker or a peptide bond.
- In some aspects, the disclosed polypeptide comprises a conservative variant of a disclosed amino acid sequence. For example, in some aspects, the disclosed polypeptide comprises a disclosed amino acid sequence having 1, 2, 3, or 4 conservative amino acid substitutions.
- The disclosed peptide can have a variety of lengths and structures as described herein. In some aspects, the disclosed peptide can consist essentially of from about 25 to about 100 amino acids, including about 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more amino acids. The disclosed peptide can comprise less than about 100 amino acid residues, including less than about 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, or 30 amino acid residues. The disclosed peptide can comprise more than about 25 amino acid residues, including more than about 25, 30, 35, 40, 45, or 50 amino acid residues.
- The disclosed polypeptides can be artificial sequences and can be synthesized in vitro and/or recombinantly. The disclosed polypeptides can be peptides that are not naturally occurring proteins and can be peptides that have at least two contiguous sequences that are not contiguous in a naturally occurring protein.
- Fusion proteins, also known as chimeric proteins, are proteins created through the joining of two or more genes which originally coded for separate proteins. Translation of this fusion gene results in a single polypeptide with function properties derived from each of the original proteins. Recombinant fusion proteins can be created artificially by recombinant DNA technology for use in biological research or therapeutics. Chimeric mutant proteins occur naturally when a large-scale mutation, typically a chromosomal translocation, creates a novel coding sequence containing parts of the coding sequences from two different genes.
- The functionality of fusion proteins is made possible by the fact that many protein functional domains are modular. In other words, the linear portion of a polypeptide which corresponds to a given domain, such as a tyrosine kinase domain, may be removed from the rest of the protein without destroying its intrinsic enzymatic capability. Thus, any of the herein disclosed functional domains can be used to design a fusion protein.
- A recombinant fusion protein is a protein created through genetic engineering of a fusion gene. This typically involves removing the stop codon from a cDNA sequence coding for the first protein, then appending the cDNA sequence of the second protein in frame through ligation or overlap extension PCR. That DNA sequence will then be expressed by a cell as a single protein. The protein can be engineered to include the full sequence of both original proteins, or only a portion of either.
- If the two entities are proteins, often linker (or “spacer”) peptides are also added which make it more likely that the proteins fold independently and behave as expected. Especially in the case where the linkers enable protein purification, linkers in protein or peptide fusions are sometimes engineered with cleavage sites for proteases or chemical agents which enable the liberation of the two separate proteins. This technique is often used for identification and purification of proteins, by fusing a GST protein, FLAG peptide, or a hexa-his peptide (aka: a 6×his-tag) which can be isolated using nickel or cobalt resins (affinity chromatography). Chimeric proteins can also be manufactured with toxins or anti-bodies attached to them in order to study disease development.
- Alternatively, internal ribosome entry sites (IRES) elements can be used to create multigene, or polycistronic, messages. IRES elements are able to bypass the ribosome scanning model of 5′ methylated Cap dependent translation and begin translation at internal sites (Pelletier and Sonenberg, 1988). IRES elements from two members of the picornavirus family (polio and encephalomyocarditis) have been described (Pelletier and Sonenberg, 1988), as well an IRES from a mammalian message (Macejak and Sarnow, 1991). IRES elements can be linked to heterologous open reading frames. Multiple open reading frames can be transcribed together, each separated by an IRES, creating polycistronic messages. By virtue of the IRES element, each open reading frame is accessible to ribosomes for efficient translation. Multiple genes can be efficiently expressed using a single promoter/enhancer to transcribe a single message (U.S. Pat. Nos. 5,925,565 and 5,935,819; PCT/US99/05781). IRES sequences are known in the art and include those from encephalomycarditis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell. Biol., 11:5848-5849 (1991); BiP protein (Macejak and Sarnow, Nature, 353:91 (1991)); the Antennapedia gene of drosophilia (exons d and e) [Oh et al., Genes & Development, 6:1643-1653 (1992)); those in polio virus [Pelletier and Sonenberg, Nature, 334:320325 (1988); see also Mountford and Smith, TIG, 11:179-184 (1985)).
- The disclosed peptide can further include one or more additional moieties. For example, the peptide can contain a homing peptide for targeted delivery to an organ, such as the lung, kidney, skin, heart, pancreas, uterus, retina, intestines, prostate, or liver. The peptide can also contain a label, such as a fluorescent dye. In one aspect, the homing peptide can be an Fab antibody fragment specific for an organ-specific or cell-specific epitope (such as, for example, a cell-specific or organ-specific peptide, polypeptide, or protein). It is understood and herein contemplated that by “organ-specific” and “cell-specific” epitope is meant an epitope (such as, for example, a peptide, polypeptide, or protein) whose expression is limited to that cell-type or organ.
- Therapeutic molecules, such as the polypeptides disclosed herein, can be used therapeutically in combination with a pharmaceutically acceptable carrier. The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- Pharmaceutical carriers suitable for administration of the molecules provided herein include any such carriers known to those skilled in the art to be suitable for the particular mode of administration. Pharmaceutical compositions may include thickeners, diluents, buffers, preservatives, surface active agents and the like in addition to the molecule of choice. Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents, anti-inflammatory agents, anesthetics, and the like.
- Liquid pharmaceutically administrable compositions can, for example, be prepared by dissolving, dispersing, or otherwise mixing a molecules as defined above and optional pharmaceutical adjuvants in a carrier, such as, for example, water, saline, aqueous dextrose, glycerol, glycols, ethanol, and the like, to thereby form a solution or suspension. If desired, the pharmaceutical composition to be administered may also contain minor amounts of nontoxic auxiliary substances such as wetting agents, emulsifying agents, solubilizing agents, pH buffering agents and the like, for example, acetate, sodium citrate, cyclodextrin derivatives, sorbitan monolaurate, triethanolamine sodium acetate, triethanolamine oleate, and other such agents.
- The compounds described herein can be formulated for parenteral administration. Parenteral formulations can be prepared as aqueous compositions using techniques is known in the art. Typically, such compositions can be prepared as injectable formulations, for example, solutions or suspensions; solid forms suitable for using to prepare solutions or suspensions upon the addition of a reconstitution medium prior to injection; emulsions, such as water-in-oil (w/o) emulsions, oil-in-water (o/w) emulsions, and microemulsions thereof, liposomes, or emulsomes.
- Solutions and dispersions of the active compounds as the free acid or base or pharmacologically acceptable salts thereof can be prepared in water or another solvent or dispersing medium suitably mixed with one or more pharmaceutically acceptable excipients including, but not limited to, surfactants, dispersants, emulsifiers, pH modifying agents, and combination thereof.
- Suitable surfactants may be anionic, cationic, amphoteric or nonionic surface active agents. Suitable anionic surfactants include, but are not limited to, those containing carboxylate, sulfonate and sulfate ions. Examples of anionic surfactants include sodium, potassium, ammonium of long chain alkyl sulfonates and alkyl aryl sulfonates such as sodium dodecylbenzene sulfonate; dialkyl sodium sulfosuccinates, such as sodium dodecylbenzene sulfonate; dialkyl sodium sulfosuccinates, such as sodium bis-(2-ethylthioxyl)-sulfosuccinate; and alkyl sulfates such as sodium lauryl sulfate. Cationic surfactants include, but are not limited to, quaternary ammonium compounds such as benzalkonium chloride, benzethonium chloride, cetrimonium bromide, stearyl dimethylbenzyl ammonium chloride, polyoxyethylene and coconut amine. Examples of nonionic surfactants include ethylene glycol monostearate, propylene glycol myristate, glyceryl monostearate, glyceryl stearate, polyglyceryl-4-oleate, sorbitan acylate, sucrose acylate, PEG-150 laurate, PEG-400 monolaurate, polyoxyethylene monolaurate, polysorbates, polyoxyethylene octylphenylether, PEG-1000 cetyl ether, polyoxyethylene tridecyl ether, polypropylene glycol butyl ether, Poloxamer® 401, stearoyl monoisopropanolamide, and polyoxyethylene hydrogenated tallow amide. Examples of amphoteric surfactants include sodium N-dodecyl-β-alanine, sodium N-lauryl-β-iminodipropionate, myristoamphoacetate, lauryl betaine and lauryl sulfobetaine.
- The formulation can contain a preservative to prevent the growth of microorganisms. Suitable preservatives include, but are not limited to, parabens, chlorobutanol, phenol, sorbic acid, and thimerosal. The formulation may also contain an antioxidant to prevent degradation of the active agent(s).
- The formulation is typically buffered to a pH of 3-8 for parenteral administration upon reconstitution. Suitable buffers include, but are not limited to, phosphate buffers, acetate buffers, and citrate buffers.
- Water soluble polymers are often used in formulations for parenteral administration. Suitable water-soluble polymers include, but are not limited to, polyvinylpyrrolidone, dextran, carboxymethylcellulose, and polyethylene glycol.
- Sterile injectable solutions can be prepared by incorporating the active compounds in the required amount in the appropriate solvent or dispersion medium with one or more of the excipients listed above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those listed above. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The powders can be prepared in such a manner that the particles are porous in nature, which can increase dissolution of the particles. Methods for making porous particles are well known in the art.
- Pharmaceutical formulations can be designed for immediate release, sustained release, delayed release and/or burst release of one or more polypeptides in a therapeutically effective amount. In a preferred embodiment, the formulation provides an initial burst release of a “loading dosage”, followed by a sustained release to maintain the therapeutically effective dosage. This can be accomplished using a delayed and/or extended release formulation.
- Disclosed herein are methods for reducing, inhibiting, preventing, or treating a fibrotic disease in a subject comprising administering to the subject a therapeutically effective amount of a composition comprising an agent that inhibits nuclear translocation of Fused in Sarcoma (FUS). Similarly, disclosed herein are methods for reducing, inhibiting, preventing, or treating FUS-mediated collagen production by a cell comprising administering to the subject a therapeutically effective amount of a composition comprising an agent that inhibits nuclear translocation of Fused in Sarcoma (FUS). It is understood and herein contemplated that the agent for reducing, inhibiting, preventing, or treating a fibrotic disease or FUS collagen production can be any isolated peptides disclosed herein comprising a transportin-binding moiety linked to a membrane translocating motif.
- As disclosed herein, fibrotic diseases can include, but are not limited to pulmonary fibrosis (including, cystic fibrosis and radiation induced lung injury), atrial fibrosis, glomerulosclerosis, kidney damage, skin fibrosis (scleroderma), scleroderma from a systemic fibrosis, cirrhosis, Crohn's Disease, Keloid, Myelofibrosis, arthrofibrosis, fibrosarcoma, osteosarcoma tumor, or collagen production by a tumor.
- In particular embodiments, the method involves administering a polypeptide disclosed herein. For example, the disclosed polypeptides can in some cases be administered in a dose equivalent to parenteral administration of about 0.1 ng to about 100 g per kg of body weight, about 10 ng to about 50 g per kg of body weight, about 100 ng to about 1 g per kg of body weight, from about 1 μg to about 100 mg per kg of body weight, from about 1 μg to about 50 mg per kg of body weight, from about 1 mg to about 500 mg per kg of body weight; and from about 1 mg to about 50 mg per kg of body weight. Alternatively, the amount of polypeptide administered to achieve a therapeutic effective dose is about 0.1 ng, 1 ng, 10 ng, 100 ng, 1 μg, 10 μg, 100 μg, 1 mg, 2 mg, 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, 10 mg, 11 mg, 12 mg, 13 mg, 14 mg, 15 mg, 16 mg, 17 mg, 18 mg, 19 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg, 100 mg, 500 mg per kg of body weight or greater.
- In some embodiments, the dose of polypeptide to be administered provides a final plasma level of polypeptide of about 100 ng/ml to about 1000 ng/ml, about 1100 ng/ml to about 1450 ng/ml, 100 ng/ml to about 250 ng/ml, about 200 ng/ml to about 350 ng/ml, about 300 ng/ml to about 450 ng/ml, about 350 ng/ml to about 450 ng/ml, about 400 ng/ml to about 550 ng/ml, about 500 ng/ml to about 650 ng/ml, about 600 ng/ml to about 750 ng/ml, about 700 ng/ml to about 850 ng/ml, about 800 ng/ml to about 950 ng/ml, about 900 ng/ml to about 1050 ng/ml, about 1000 ng/ml to about 1150 ng/ml, about 100 ng/ml to about 1250 ng/ml, about 1200 ng/ml to about 1350 ng/ml, about 1300 ng/ml to about 1500 ng/ml.
- The herein disclosed compositions, including pharmaceutical composition, may be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated. For example, the disclosed compositions can be administered intravenously, intraperitoneally, intramuscularly, subcutaneously, intracavity, transdermally, or topically.
- The disclosed composition can be administered therapeutically, to treat, prevent, or reduce fibrotic disease or FUS-mediated collagen production in a subject or prophylactically, to patients or subjects at risk for fibrosis. Accordingly, the compositions may be administered prior to the onset of fibrosis (including, for example, prior to exposure to radiation which could result in fibrotic injury). In one aspect, the disclosed compositions can be administered to the patient or subject as a single one time injection or as multiple administrations. For example, the disclosed compositions can be administered at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 times per day. The compositions can be administered to the patient or subject at least once about every 4, 6, 8, 12, 24 hours, or every day, every other day, every third day, every fourth day, every fifth day, every sixth day, once a week, once every two weeks, once every three weeks, once a month, once every two months, once every three months, once every four months, once every five months, once every six months, once every seven months, once every eight months, once every nine months, once every ten months, once every eleven months, once every year, once every eighteen months, once every two year, once every three years, once every four years, or once every five years. Treatment can be continued as long as needed to reduce, inhibit, prevent, or eliminate the fibrotic disease or symptoms associated with the disease.
- The disclosed polypeptides can be administered adjunctively with other active compounds such as analgesics, anti-inflammatory drugs, antipyretics, antiepileptics, antihistamines, antimigraine drugs, antimuscarinics, anxioltyics, sedatives, hypnotics, antipsychotics, bronchodilators, anti-asthma drugs, cardiovascular drugs, corticosteroids, doparninergics, electrolytes, parasympathomimetics, stimulants, anorectics and anti-narcoleptics.
- As noted above, the compositions disclosed herein may be administered prophylactically to patients or subjects who are at risk for fibrosis. Thus, the method can further comprise identifying a subject at risk for fibrosis prior to administration of the herein disclosed compositions.
- A number of embodiments of the invention have been described.
- Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.
- Integrins are transmembrane receptors for ECM components composed of non-covalently bound α and β subunits that heterodimerize to produce 24 different transmembrane receptors (Hynes, R. 2002. Cell 110:673-687; Pan, L., et al. 2016. Springerplus 5:1094). Integrin α1β1 (Itgα1β1) is a major collagen IV receptor that is highly expressed by podocytes, endothelial cells and mesangial cells of the glomerulus (Patey, N., et al. 1994. Cell Adhes Commun 2:159-167). Absence of Itgα1β1 does not affect the normal glomerular function; however, this integrin plays an important role in regulating the glomerulus response to injury. Itgα1β1 has been identified as a negative, inhibitory, modulator of glomerular injury. To this end, Itgα1β1 prevents excessive injury-mediated glomerulosclerosis by negatively regulating EGF receptor (EGFR) tyrosine phosphorylation, by preventing the assembly of the NADPH oxidase and generation of profibrotic ROS, and by negatively regulating collagen levels at both translational and transcriptional levels (Chen, X., et al. 2007. Mol Cell Biol 27:3313-3326; Chen, X., et al. 2004. Am J Pathol 165:617-630; Chen, X., et al. 2010. Mol Cell Biol 30:3048-3058; Wang, H., et al. 2015. Kidney Int 87:948-962; Gardner, H., et al. 1999. J Cell Sci 112:263-272). Itgα1β1 exerts its anti-fibrotic role by regulating both the level and tyrosine phosphorylation of caveolin-1 a scaffolding protein that controls EGFR activation (Chen, X., et al. 2010. Mol Cell Biol 30:3048-3058; Borza, C. M., et al. 2010. J Biol Chem 285:40114-40124). TGF-β receptor II has also been identified as another target of Itgα1β1. Itgα1β1 also negatively regulates TGF-β receptor II-mediated SMAD3 activation and pro-fibrotic signaling by downregulating the tyrosine phosphorylation levels of TGF-β receptor II (Chen, X., et al. 2014. J Clin Invest 124:3295-3310).
- A mechanism whereby Itgα1β1 negatively regulates the tyrosine phosphorylation levels of several growth factor receptors as well as scaffolding proteins is by recruiting and activating the tyrosine phosphatase TCPTP (Mattila, E., et al. 2005. Nat Cell Biol 7:78-85). Consistent with this finding, cells lacking Itgα1β1 do not recruit and activate TCPTP thus showing increased basal levels of tyrosine phosphorylated proteins (Chen, X., et al. 2007. Mol Cell Biol 27:3313-3326). Mice lacking Itgα1β1 manifest excessive and accelerated glomerulosclerosis following various models of glomerular injury, including partial renal ablation, adriamycin injection, oxidative stress, and
type 1 diabetes (Chen, X., et al. 2004. Am J Pathol 165:617-630; Wang, H., et al. 2015. Kidney Int 87:948-962; Borza, C. M., et al. 2012. J Am Soc Nephrol 23:1027-1038; Zent, R., et al. 2006. Kidney Int 70:460-470; Yu, L., et al. 2012. Kidney Int 81:1086-1097). - A key question is how Itgα1β1, in addition to the targets indicated above, controls collagen levels at the transcriptional level. The activation of many transcription factors and their nuclear translocation are regulated by tyrosine phosphorylation (Rebelo, S., et al. 2015. Cell Signal 27:2589-2598; Thapar, R. 2015. ACS Chem Biol 10:652-666). Thus, immunoprecipitation of nuclear proteins from wild type (WT) and Itgα1KO mesangial cells was performed using anti-phosphotyrosine antibody. The complexes were analyzed by mass spectrometry in order to identify highly tyrosine phosphorylated nuclear proteins only in Itgα1KO cells. As disclosed herein, increased levels of total and tyrosine phosphorylated nuclear ribonucleoprotein Fused in Sarcoma (FUS) in Itgα1KO cells are associated with increased collagen production, and reducing FUS levels diminishes collagen production. Thus, Itgα1β1 plays an anti-fibrotic action by decreasing the tyrosine phosphorylation and nuclear levels of FUS.
- EGFR is a receptor tyrosine kinase activated by several ligands including EGF, TGF-α, and HB-EGF. This receptor is expressed by mesangial cells and podocytes and plays an important role in the development of the kidney (Zhuang, S., et al. 2014. Kidney Int Suppl (2011) 4:70-74). In addition, EGFR is a key determinant in the initiation, development and progression of kidney glomerular injury. In the ⅚ nephrectomy model, for example, inhibition of EGFR reduces glomerular fibrosis suggesting that activation of EGFR occurs in the course of glomeruli injury and contributes to fibrosis (Liu, N., et al. 2012. PLoS ONE 7:e36194). In both mice and humans with rapidly progressive glomerulonephritis expression of HB-EGF by podocytes promotes EGFR phosphorylation and activation thus contributing to glomerular injury (Bollee, G., et al. 2011. Nat Med 17:1242-1250). In addition, mice lacking HB-EGF expression specifically in endothelial cells, show decrease glomerular EGFR activation and decreased angiotensin-II mediated glomerular injury (Zeng, F., et al. 2016. Am J Physiol Renal Physiol:ajprenal 311(4):F695-F707).
- A key negative regulator of EGFR activation and pro-fibrotic function is Itgα1β1. At least two mechanisms account for this negative regulation: Itgα1β1 binds and activates TCPTP and interacts with the membrane
scaffolding protein caveolin 1, two negative regulators of EGFR activation (Chen, X., et al. 2010. Mol Cell Biol 30:3048-3058; Borza, C. M., et al. 2010. J Biol Chem 285:40114-40124; Borza, C. M., et al. 2010. J Biol Chem 285:40114-40124; Abulrob, A., et al. 2004. Oncogene 23:6967-6979). To further determine the contribution of EGFR to glomerular injury in Itgα1KO mice, a genetic and a pharmacological approach was used. - In the first model, Itgα1KO mice were crossed with mice expressing a functionally hypomorphic EGFR (waved-2 mice) (Luetteke, N.C., et al. 1994. Genes Dev 8:399-413) and then subjected to adriamycin (ADR)-mediated injury. In the second model, wild type (WT) and Itgα1KO mice were injected with ADR and then left untreated or treated with the EGFR inhibitor erlotinib (20 mg/Kg/day i.p.). Compared to WT mice, Itgα1KO mice developed significantly more glomerular injury, proteinuria and
glomerular collagen synthesis 8 weeks after ADR treatment (FIG. 1A-E ). Crossing the Itgα1KO mice with the wave-2 mice or treating them with erlotinib significantly improved glomerular injury, proteinuria and collagen synthesis (FIG. 1A-E ). - Although this data suggests that blocking EGFR with available receptor tyrosine kinase inhibitors might be a promising strategy for the treatment and management of glomerular injury, it is important to notice that prolonged treatment with receptor kinase inhibitors, including erlotinib, can cause some severe side effects. The most common side effects include skin rash, cardiovascular and pulmonary toxicities, electrolyte depletion, diarrhea and renal complications (reviewed in (Liu, F., et al. 2016. Int J Mol Sci 17). Thus, the identification of key downstream signaling molecules activated by the integrins/EGFR axis or integrins alones, might represent a valid tool to better target kidney disease and avoid severe side effects. In this regard, FUS is shown herein to contain Tyr6 and Tyr296 as two EGFR phosphorylatable and TCPTP dephosphorylatable tyrosines. In addition, levels of nuclear FUS seem to be associated with levels of activated EGFR.
- FUS, also known as translocated in liposarcoma (TLS), is a heterogeneous ribonucleoprotein able to bind RNA and proteins (Sama, R. R., et al. 2014. ASN Neuro 6). FUS consists of an N-terminal end involved in transcriptional activation and a C-terminal end involved in protein-RNA and protein-protein interactions (Sama, R. R., et al. 2014. ASN Neuro 6). The C terminal domain also contains an uncommon nuclear localization sequence (NLS) motif called PY-NLS because the PY is localized at the C-terminus of the protein. The PY-NLS binds the nuclear import receptor transportin (or karyopherin β2) (Dormann, D., et al. 2010. Embo J 29:2841-2857). In 2009, two groups analyzed several unrelated families who presented with amyotrophic lateral sclerosis (ALS) phenotype and found 14 mutations in the FUS gene, thus providing the first evidence that FUS is linked to familiar ALS (Kwiatkowski, T. J., Jr., et al. 2009. Science 323:1205-1208; Vance, C., et al. 2009. Science 323:1208-1211). Indeed, mutations in the C-terminal domain of FUS that prevent nuclear translocation thus causing increased cytoplasmic localization and formation of stress granule-like structures account for ˜5% of familiar ALS cases (reviewed in (Sama, R. R., et al. 2014. ASN Neuro 6). In addition to mutations, overexpression of FUS can also be pathogenic in human patients (Sabatelli, M., et al. 2013. Hum Mol Genet 22:4748-4755). After these findings, mouse models of ALS overexpressing FUS or carrying the same FUS mutations identified in humans have been generated (Picher-Martel, V., et al. 2016. Acta Neuropathol Commun 4:70). Mice have been generated that express human FUSWT or the pathological mutation FUSR521G (no longer able to translocate to the nucleus) under the control of the cytomegalovirus immediate early enhancer-chicken β-actin hybrid promoter. These mice express wild type or mutated FUS only when crossed with a Cre mouse line. When crossed with a global Cre mouse line, thus forcing expression of these two proteins in all cells, these mice are born alive but develop severe motor deficits phenocopying the human diseases (Sephton, C. F., et al. 2014. Proc Natl Acad Sci U.S.A. 111:E4769-4778). These mice have been crossed with PDGFR-Cre mice in order to drive expression of WT and mutated form of FUS preferentially in mesangial cells. FUShet mice were also obtained. While FUSKO mice die immediately after birth on a C57/B6 background (Hicks, G. G., et al. 2000. Nat Genet 24:175-179), their survival rate increases on the BALB/c background. These mice are used to analyze the contribution of FUS in the regulation of collagen production in both physiological and pathological conditions.
- Increased Nuclear Phosphorylated FUS in Itgα1KO Mesangial Cells.
- A key question is to understand the molecular mechanisms whereby Itgα1β1 controls collagen levels at the transcriptional level. The nuclear translocation and activation of many transcription factors are processes regulated by tyrosine phosphorylation (Rebelo, S., et al. 2015. Cell Signal 27:2589-2598; Thapar, R. 2015. ACS Chem Biol 10:652-666). Cells lacking Itgα1β1 have increased basal levels of tyrosine phosphorylated proteins (e.g., EGFR, TGFβ receptor II and caveolin-1) (Chen, X., et al. 2007. Mol Cell Biol 27:3313-3326; Borza, C. M., et al. 2010. J Biol Chem 285:40114-40124; Chen, X., et al. 2014. J Clin Invest 124:3295-3310) due to inability to recruit and activate the tyrosine phosphatase TCPTP (Mattila, E., et al. 2005. Nat Cell Biol 7:78-85). In order to identify highly tyrosine phosphorylated nuclear proteins only in Itgα1KO, but not wild type (WT) cells, immuno-precipitation of nuclear proteins from WT and Itgα1KO mesangial cells was performed using anti-phosphotyrosine antibody and the complexes analyzed by mass spectrometry. Five potential hits were identified with 1 of them being the ribonucleoprotein Fused in Sarcoma (FUS).
- FUS is a Ribonucleoprotein Regulated by TCPTP and EGFR.
- FUS is a RNA-protein binding molecule that consists of an N-terminal end involved in transcriptional activation and a C-terminal end involved in protein and RNA binding. The rationale for selecting this candidate for study is as following: 1) FUS binds Sp1 (Dhar, S. K., et al. 2014. Antioxid Redox Signal 20:1550-1566) a transcriptional activator involved in collagen synthesis and fibrosis (Ghosh, A. K., et al. 2013. Exp Biol Med (Maywood) 238:461-481). 2) Patients with ALS show decreased levels of collagen in skin and blood (34, 35). 3) Collagen IV is a multimeric protein composed of 3 α subunits. These subunits are encoded by 6 different genes (α1-α6), each of which can form a triple helix with 2 other subunits to form type IV collagen. The α1 and α2 chains form the α1α2α1 type IV collagen and their transcription is regulated by a bidirectional promoter (846 bp) and a enhancer (329 bp) located in the first intron of the α1(IV) chain gene (Burbelo, P. D., et al. 1988. Proc Natl Acad Sci USA 85:9679-9682). Analysis of the murine enhancer and promoter sequence with ALGGEN-PROMO-v3 revealed the presence of 4 and 9 FUS responsive element in the enhancer and promoter, respectively. 4) FUS has 36 tyrosines and analysis of FUS with PhosphoMotif Finder revealed Tyr6 and Tyr296 as two EGFR phosphorylatable and TCPTP dephosphorylatable tyrosines. 5) Studies in Drosophila suggest a genetic link between Cabeza (orthologue of human FUS) and rhomboid-1, a key component of the EGFR signaling pathway (Shimamura, M., et al. 2014. Exp Cell Res 326:36-45). 6) Data shown below clearly suggest a link between nuclear localization of FUS and collagen synthesis.
- Increased Levels of FUS in Itgα1KO Glomeruli.
- To validate the mass spectrometry analysis, the nuclear levels of FUS in glomeruli from WT and Itgα1KO mice was analyzed. Nuclear FUS was detected in the glomeruli of both WT and Itgα1KO mice, although it was significantly more in the latter group (
FIG. 2A-D ). Interestingly nuclear FUS was found to localize with activated EGFR, which was evident only in glomeruli of Itgα1KO, but not WT mice (FIG. 2A ) supporting the finding of increased basal level activation of EGFR in the absence of Itgα1β1 (Chen, X., et al. 2010. Mol Cell Biol 30:3048-3058). - Increased Glomerular FUS Expression in Human and Mouse Diseased Kidneys.
- To determine whether levels of glomerular FUS are increased in kidney disease, FUS levels were analyzed in the glomeruli of control and
type 2 diabetic mice. While no expression of this ribonucleoprotein was detected in the glomeruli of non-diabetic mice, FUS expression became evident in the glomeruli oftype 2 diabetic mice (FIG. 3A ). To further confirm that the levels of FUS increase following injury, WT mice were treated with Adriamycin (ADR) and a significant increase in nuclear FUS levels was observed in glomeruli isolated 3 days after ADR treatment (FIG. 3B ,C). Interestingly, analysis of kidneys from healthy human subjects or individuals with early and late diabetic nephropathy, revealed expression of nuclear FUS only in the glomeruli of diabetic subjects, clearly suggesting that FUS is upregulated in kidney disease. - Increased FUS Nuclear Levels Directly Correlate to Collagen Synthesis.
- To further confirm the in vivo data, mesangial cells were isolated from WT and Itgα1KO mice and the basal level of nuclear FUS was analyzed. FUS was detected in the nuclei of both WT and Itgα1KO mesangial cells, although its levels were higher and more tyrosine phosphorylated in the latter group (
FIG. 4A-C ). To determine whether nuclear translocation of FUS is dependent on EGFR activation, mesangial cells were treated with erlotinib. This EGFR inhibitor decreased EGFR activation (5A,B) and significantly decreased nuclear FUS (FIG. 5A ,C) and collagen IV levels (FIG. 5D ,E), and these events were more pronounced in Itgα1KO mesangial cells. Treatment with erlotinib also significantly decreased the levels of nuclear tyrosine phosphorylated FUS (FIG. 5F ), suggesting a potential link between EGFR activation, FUS phosphorylation and nuclear FUS localization. - FUS Nuclear Translocation is Dependent Upon EGFR Activation.
- Mesangial cells were transiently transfected with murine FUS cDNA inserted downstream the Red Fluorescent Protein gene (RFP-FUS) (
FIG. 6C ) and its basal nuclear localization was determined. RFP-FUS was detected in the nuclei of both WT and Itgα1KO cells, although it was significantly more in the latter group (FIG. 6D ,E). When cells were treated for 30 minutes with EGF, increased activation of EGFR was observed in both WT and Itgα1KO cells, although it was more evident in the Itgα1KO cells (FIG. 6A ,B). Treatment with EGF, also significantly promoted more RFP-FUS nuclear translocation in Itgα1KO cells compared to WT cells (FIG. 6D ,E). - Downregulation of FUS Decreased Basal Collagen Production in Itgα1KO Cells.
- To determine whether the increased total and phosphorylated levels of nuclear FUS observed in Itgα1KO cells (
FIGS. 4,5 ) are responsible for increased levels of collagen production in these cells (FIG. 5D ,E), Itgα1KO cells were treated with either scrambled (Scr) or FUS siRNA and then the levels of FUS and collagen IV were analyzed. The focus was on collagen IV, as it is the major Itgα1β1 binding collagen (Gardner, H., et al. 1996. Dev Biol 175:301-313); and the collagen IV promoter and enhancer region contain several FUS responsive elements. FUS-siRNA, but not Scr-siRNA, significantly downregulated FUS levels and this event was accompanied by a significant decrease in collagen IV production (FIG. 7A ,B). Thus, FUS either directly and/or indirectly controls collagen levels. - FUS Knockdown Decreases Collagen Transcription Levels.
- As the collagen IV enhancer/promoter contains FUS responsive elements, whether FUS can control collagen at the transcriptional levels was analyzed. Itgα1KO cells were treated with Scr- or FUS-siRNA and then the cells were transfected with a firefly luciferase reporter gene under the control of the collagen IV enhancer or enhancer/promoter. Analysis of luciferase activity (normalized to renilla) in cells treated with Scr-siRNA revealed the collagen IV enhancer by itself failed to promote luciferase transcription, while the collagen IV enhancer/promoter promoted robust luciferase transcription (
FIG. 7C ). Downregulation of FUS resulted in ˜50% reduction in the collagen IV enhancer/activity, suggesting that FUS can control collagen IV production the transcriptional level (FIG. 7C ). - Design and Testing of Cell-Penetrating Peptides that Inhibit FUS Nuclear Translocation.
- At present there are no inhibitors available to prevent FUS function and/or nuclear translocation. FUS has an uncommon nuclear localization sequence (NLS) motif called PY-NLS because the PY is localized at the C-terminus of the protein (RGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY, SEQ ID NO:12). This non-classical NLS motif is recognized by transportin and methylation of the arginine in the RGG motif or phosphorylation of the tyrosine in the PY motif alters FUS/transportin interaction and interferes with FUS nuclear translocation (Zhang, Z. C., et al. 2012. Proc Natl Acad Sci USA 109:12017-12021).
- Based on this finding, a peptide AAVALLPAVLLALLAPSRGEHRQDRRERPY (SEQ ID NO:8) was designed carrying a FUS PY-NLS derived peptide (bold) fused with the signal sequence hydrophobic region of FGF4 (Italicized). Signal sequence hydrophobic region was designed as a membrane translocating fragment that enables NLS to cross cell membrane bypassing endosomal pathway (Veach, R. A., et al. 2004. J Biol Chem 279:11425-11431). The mutated version of the fragment-designed peptide AAVALLPAVLLALLAPSEGEHRADEEERGA (SEQ ID NO:13) contained amino acid replacements in PY-NLS of FUS.
- Both peptides were purified and tested for cytotoxicity at the concentrations used in these experiments. Itgα1KO mesangial cells were pre-treated with these peptides (0.1 μM) for 24 hours and then left untreated or treated with EGF for 3 hours. FUS localization was then analyzed by immunofluorescence using anti-FUS antibody. FUS PY-NSL derived peptide, but not its mutated version, significantly inhibited both basal and EGF-mediated FUS nuclear translocation (
FIG. 8A , B). Cells treated with the FUS PY-NSL derived peptide also showed cytoplasmic FUS indicating that the peptide efficiently prevents FUS nuclear translocation (FIG. 8A ). - Based on the finding that cells lacking Itgα1β1 show increased tyrosine phosphorylated and nuclear levels of FUS and that FUS nuclear levels are positively associated to collagen production, it is proposed that, in the course of glomerular injury, Itgα1β1 attenuates excessive and unwanted collagen synthesis by negatively regulating FUS tyrosine phosphorylation, nuclear translocation, and activation of collagen transcription (
FIGS. 10A and 10B ). - Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
- Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.
Claims (32)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/481,128 US20210332093A9 (en) | 2013-04-11 | 2018-01-29 | Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361810939P | 2013-04-11 | 2013-04-11 | |
US14/251,135 US9492544B2 (en) | 2013-04-11 | 2014-04-11 | Compositions and methods for targeting nuclear import shuttles and treating inflammatory disorders |
US15/297,996 US10568928B2 (en) | 2013-04-11 | 2016-10-19 | Compositions and methods for targeting nuclear import shuttles and treating inflammatory disorders |
US201762451636P | 2017-01-27 | 2017-01-27 | |
PCT/US2018/015702 WO2018140863A1 (en) | 2017-01-27 | 2018-01-29 | Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis |
US16/481,128 US20210332093A9 (en) | 2013-04-11 | 2018-01-29 | Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/297,996 Continuation US10568928B2 (en) | 2013-04-11 | 2016-10-19 | Compositions and methods for targeting nuclear import shuttles and treating inflammatory disorders |
Publications (2)
Publication Number | Publication Date |
---|---|
US20190352355A1 US20190352355A1 (en) | 2019-11-21 |
US20210332093A9 true US20210332093A9 (en) | 2021-10-28 |
Family
ID=62978447
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/481,128 Pending US20210332093A9 (en) | 2013-04-11 | 2018-01-29 | Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis |
Country Status (4)
Country | Link |
---|---|
US (1) | US20210332093A9 (en) |
EP (1) | EP3573637A4 (en) |
CA (1) | CA3051855A1 (en) |
WO (1) | WO2018140863A1 (en) |
Family Cites Families (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5925A (en) | 1848-11-14 | Improvement in harvesting-machines | ||
US565A (en) | 1838-01-09 | Mode of | ||
US5331573A (en) | 1990-12-14 | 1994-07-19 | Balaji Vitukudi N | Method of design of compounds that mimic conformational features of selected peptides |
DE4228457A1 (en) | 1992-08-27 | 1994-04-28 | Beiersdorf Ag | Production of heterodimeric PDGF-AB using a bicistronic vector system in mammalian cells |
US5631280A (en) | 1995-03-29 | 1997-05-20 | Merck & Co., Inc. | Inhibitors of farnesyl-protein transferase |
AU4815397A (en) * | 1996-10-15 | 1998-05-11 | Vanderbilt University | Method of disrupting cellular adhesion |
US8470976B2 (en) * | 2006-06-17 | 2013-06-25 | Board Of Regents, The University Of Texas System | Methods and compositions for targeting macromolecules into the nucleus |
KR20100056509A (en) * | 2007-09-11 | 2010-05-27 | 몬도바이오테크 래보래토리즈 아게 | Use of a peptide as a therapeutic agent |
US9150860B2 (en) * | 2008-07-22 | 2015-10-06 | The General Hospital Corporation | FUS/TLS-based compounds and methods for diagnosis, treatment and prevention of amyotrophic lateral sclerosis and related motor neuron diseases |
US8932559B2 (en) | 2011-10-06 | 2015-01-13 | Vanderbilt University | Compositions and methods for preserving insulin-producing cells and insulin production and treating diabetes |
US9388224B2 (en) * | 2011-10-06 | 2016-07-12 | Vanderbilt University | Compositions for preserving insulin-producing cells and insulin production and treating diabetes |
WO2013052813A1 (en) | 2011-10-06 | 2013-04-11 | Vanderbilt University | Compositions and methods for treating and preventing hyperlipidemia, fatty liver, atherosclerosis and other disorders associated with metabolic syndrome |
US9492544B2 (en) * | 2013-04-11 | 2016-11-15 | Vanderbilt University | Compositions and methods for targeting nuclear import shuttles and treating inflammatory disorders |
GB201319620D0 (en) * | 2013-11-06 | 2013-12-18 | Norwegian University Of Science And Technology | Immunosuppressive agents and their use in therapy |
WO2015171641A1 (en) * | 2014-05-05 | 2015-11-12 | Brigham And Women's Hospital, Inc. | Coordinate control of pathogenic signaling by the mir-130/301 family in pulmonary hypertension and fibroproliferative diseases |
KR102552274B1 (en) | 2015-10-08 | 2023-07-07 | 삼성디스플레이 주식회사 | Condensed-cyclic compound and organic light emitting device comprising the same |
-
2018
- 2018-01-29 CA CA3051855A patent/CA3051855A1/en active Pending
- 2018-01-29 EP EP18744420.3A patent/EP3573637A4/en active Pending
- 2018-01-29 WO PCT/US2018/015702 patent/WO2018140863A1/en unknown
- 2018-01-29 US US16/481,128 patent/US20210332093A9/en active Pending
Non-Patent Citations (2)
Title |
---|
Axe et al., Journal of Molecular Biology, 301(3):585-595, 2000. * |
Chichili et al., Protein Science, 22:153-167, 2013. * |
Also Published As
Publication number | Publication date |
---|---|
CA3051855A1 (en) | 2018-08-02 |
WO2018140863A1 (en) | 2018-08-02 |
EP3573637A1 (en) | 2019-12-04 |
EP3573637A4 (en) | 2020-11-11 |
US20190352355A1 (en) | 2019-11-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11542500B2 (en) | TRIM11 for degradation of protein aggregates | |
US10301375B2 (en) | TAT-CrmA anti-apoptotic fusion proteins | |
US20160237129A1 (en) | Mitochondrial targeting and therapeutic use thereof | |
US20180346531A1 (en) | Compositions and methods for delivering biotherapeutics | |
JP2019501210A (en) | Peptide having efficacy for preventing and regenerating nerve cells and composition containing the same | |
US9522193B2 (en) | Compositions and methods for transport across the blood brain barrier | |
US20170029798A1 (en) | Development of Improved Cell-Permeable (iCP) Parkin Recombinant Protein as a Protein-Based Anti-Neurodegenerative Agent for the Treatment of Parkinson's Disease-Associated Phenotypes by Utilizing BBB-Penetrating Protein Delivery System MITT, Enabled by Advanced Macromolecule Transduction Domain (aMTD) | |
JP2022532092A (en) | BNIP3 peptide for the treatment of reperfusion injury | |
US20210299263A1 (en) | Cell-penetrating peptides | |
US9273116B2 (en) | Fusion protein comprising albumin and retinol-binding protein | |
US20210332093A9 (en) | Fused in sarcoma (fus) nuclear translocation inhibitors for preventing fibrosis | |
US20200230207A1 (en) | Treatment of bone growth disorders | |
CN113301914A (en) | Compositions and methods for treating and preventing fibrosis | |
KR20200039621A (en) | Compositions and methods for the treatment of myelin disorder | |
JP2006501812A (en) | BAX inhibitory peptides derived from KU-70 and their use to protect damaged cells | |
KR20230159847A (en) | Compositions and methods for targeting inflammatory or activated cells and treating or ameliorating inflammatory conditions and pain | |
CN117881687A (en) | Polypeptide inhibitors and uses thereof | |
KR20200045446A (en) | Compositions and methods for the treatment of Alzheimer's disease | |
Nagel | Cell-penetrating peptide-enhanced delivery of heat shock proteins in models of neurodegeneration |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: THE UNITED STATES AS REPRESENTED BY THE DEPARTMENT OF VETERANS AFFAIRS, DISTRICT OF COLUMBIA Free format text: ASSIGNMENT OF JOINT AND UNDIVIDED INTEREST;ASSIGNOR:VANDERBILT UNIVERSITY;REEL/FRAME:049947/0811 Effective date: 20171220 Owner name: VANDERBILT UNIVERSITY, TENNESSEE Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:POZZI, AMBRA A.;CHIUSA, MANUEL;HAWIGER, JACK J.;AND OTHERS;REEL/FRAME:049942/0442 Effective date: 20171218 Owner name: THE UNITED STATES AS REPRESENTED BY THE DEPARTMENT Free format text: ASSIGNMENT OF JOINT AND UNDIVIDED INTEREST;ASSIGNOR:VANDERBILT UNIVERSITY;REEL/FRAME:049947/0811 Effective date: 20171220 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |