US20210214408A1 - Targeting anabolic drugs for accelerated fracture repair - Google Patents
Targeting anabolic drugs for accelerated fracture repair Download PDFInfo
- Publication number
- US20210214408A1 US20210214408A1 US17/058,884 US201917058884A US2021214408A1 US 20210214408 A1 US20210214408 A1 US 20210214408A1 US 201917058884 A US201917058884 A US 201917058884A US 2021214408 A1 US2021214408 A1 US 2021214408A1
- Authority
- US
- United States
- Prior art keywords
- fracture
- nmol
- bone
- compound
- day
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000001195 anabolic effect Effects 0.000 title abstract description 28
- 239000003814 drug Substances 0.000 title abstract description 13
- 229940079593 drug Drugs 0.000 title abstract description 12
- 230000008439 repair process Effects 0.000 title description 48
- 230000008685 targeting Effects 0.000 title description 18
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 96
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 32
- 239000003102 growth factor Substances 0.000 claims abstract description 16
- 230000002227 vasoactive effect Effects 0.000 claims abstract description 6
- 210000000988 bone and bone Anatomy 0.000 claims description 146
- 150000001875 compounds Chemical class 0.000 claims description 65
- 101800001717 Preptin Proteins 0.000 claims description 46
- 125000005647 linker group Chemical group 0.000 claims description 28
- 102000012421 C-Type Natriuretic Peptide Human genes 0.000 claims description 23
- 101800000060 C-type natriuretic peptide Proteins 0.000 claims description 23
- 239000012634 fragment Substances 0.000 claims description 22
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 claims description 18
- 102100037852 Insulin-like growth factor I Human genes 0.000 claims description 18
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 18
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 18
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 18
- 235000013922 glutamic acid Nutrition 0.000 claims description 18
- 239000004220 glutamic acid Substances 0.000 claims description 18
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 claims description 18
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims description 17
- 235000021242 lactoferrin Nutrition 0.000 claims description 17
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 claims description 16
- 108010063045 Lactoferrin Proteins 0.000 claims description 16
- 102000010445 Lactoferrin Human genes 0.000 claims description 16
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical group C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 claims description 16
- 229940078795 lactoferrin Drugs 0.000 claims description 16
- 108090000663 Annexin A1 Proteins 0.000 claims description 14
- 102100040006 Annexin A1 Human genes 0.000 claims description 14
- 101800001586 Ghrelin Proteins 0.000 claims description 14
- 102400000442 Ghrelin-28 Human genes 0.000 claims description 14
- GNKDKYIHGQKHHM-RJKLHVOGSA-N ghrelin Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)CN)COC(=O)CCCCCCC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1N=CNC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C1=CC=CC=C1 GNKDKYIHGQKHHM-RJKLHVOGSA-N 0.000 claims description 14
- 229920001184 polypeptide Polymers 0.000 claims description 14
- 150000001413 amino acids Chemical class 0.000 claims description 12
- 235000001014 amino acid Nutrition 0.000 claims description 11
- 102000043136 MAP kinase family Human genes 0.000 claims description 10
- 239000003795 chemical substances by application Substances 0.000 claims description 10
- 108090000623 proteins and genes Proteins 0.000 claims description 10
- 102000018233 Fibroblast Growth Factor Human genes 0.000 claims description 9
- 108050007372 Fibroblast Growth Factor Proteins 0.000 claims description 9
- 108091054455 MAP kinase family Proteins 0.000 claims description 9
- 230000037361 pathway Effects 0.000 claims description 9
- 235000018102 proteins Nutrition 0.000 claims description 9
- 102000004169 proteins and genes Human genes 0.000 claims description 9
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 claims description 8
- 235000003704 aspartic acid Nutrition 0.000 claims description 8
- 229940126864 fibroblast growth factor Drugs 0.000 claims description 8
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 claims description 7
- 108090000190 Thrombin Proteins 0.000 claims description 7
- 125000000539 amino acid group Chemical group 0.000 claims description 7
- 229960004072 thrombin Drugs 0.000 claims description 7
- 239000000556 agonist Substances 0.000 claims description 6
- 150000003839 salts Chemical class 0.000 claims description 6
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 5
- 108700027654 Mitogen-Activated Protein Kinase 10 Proteins 0.000 claims description 5
- 102100026931 Mitogen-activated protein kinase 10 Human genes 0.000 claims description 5
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 claims description 4
- 108091005804 Peptidases Proteins 0.000 claims description 4
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 claims description 4
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 claims description 4
- 239000004365 Protease Substances 0.000 claims description 4
- 230000002491 angiogenic effect Effects 0.000 claims description 4
- 239000011203 carbon fibre reinforced carbon Substances 0.000 claims description 4
- 150000002148 esters Chemical class 0.000 claims description 4
- 230000000921 morphogenic effect Effects 0.000 claims description 3
- 125000006353 oxyethylene group Chemical group 0.000 claims description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 2
- 150000001408 amides Chemical class 0.000 claims description 2
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 claims description 2
- 102000014429 Insulin-like growth factor Human genes 0.000 claims 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 claims 2
- 125000002237 D-aspartyl group Chemical group [H]OC(=O)[C@]([H])(N([H])[H])C([H])([H])C(*)=O 0.000 claims 1
- 125000004077 D-glutamic acid group Chemical group [H]N([H])[C@@]([H])(C(=O)[*])C([H])([H])C([H])([H])C(N([H])[H])=O 0.000 claims 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 claims 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 claims 1
- 102000009465 Growth Factor Receptors Human genes 0.000 claims 1
- 108010009202 Growth Factor Receptors Proteins 0.000 claims 1
- 101000899361 Homo sapiens Bone morphogenetic protein 7 Proteins 0.000 claims 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 claims 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 claims 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims 1
- 208000010392 Bone Fractures Diseases 0.000 abstract description 331
- 230000035876 healing Effects 0.000 abstract description 114
- 230000019491 signal transduction Effects 0.000 abstract description 4
- 206010017076 Fracture Diseases 0.000 description 320
- 239000000562 conjugate Substances 0.000 description 142
- 206010020649 Hyperkeratosis Diseases 0.000 description 76
- 241000699670 Mus sp. Species 0.000 description 60
- 210000000689 upper leg Anatomy 0.000 description 58
- 102400000023 Preptin Human genes 0.000 description 45
- 238000001727 in vivo Methods 0.000 description 45
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical group [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 42
- 239000011780 sodium chloride Substances 0.000 description 42
- 238000010254 subcutaneous injection Methods 0.000 description 40
- 239000007929 subcutaneous injection Substances 0.000 description 40
- 230000000694 effects Effects 0.000 description 39
- 210000000963 osteoblast Anatomy 0.000 description 35
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 30
- 230000000373 effect on fracture Effects 0.000 description 28
- 108010003205 Vasoactive Intestinal Peptide Proteins 0.000 description 27
- 102400000015 Vasoactive intestinal peptide Human genes 0.000 description 27
- VBUWHHLIZKOSMS-RIWXPGAOSA-N invicorp Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 VBUWHHLIZKOSMS-RIWXPGAOSA-N 0.000 description 27
- 238000002591 computed tomography Methods 0.000 description 26
- 238000004458 analytical method Methods 0.000 description 22
- 230000037118 bone strength Effects 0.000 description 20
- 230000037182 bone density Effects 0.000 description 19
- VNTJGCYVIRTGMZ-PXGLAOGESA-N 2-[[2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s,3r)-2-[[(2s)-2-[[2-[[(2s)-5-amino-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-aminopropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-5-oxopentanoyl]amino]acety Chemical compound C([C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)N)CC(C)C)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)NCC(=O)NCC(O)=O)C1=CC=C(O)C=C1 VNTJGCYVIRTGMZ-PXGLAOGESA-N 0.000 description 17
- 101800003595 Osteogenic growth peptide Proteins 0.000 description 17
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 description 16
- 102400000096 Substance P Human genes 0.000 description 16
- 101800003906 Substance P Proteins 0.000 description 16
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 15
- 230000004069 differentiation Effects 0.000 description 15
- 230000035755 proliferation Effects 0.000 description 14
- 102000008186 Collagen Human genes 0.000 description 13
- 108010035532 Collagen Proteins 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 13
- 229920001436 collagen Polymers 0.000 description 13
- 239000002202 Polyethylene glycol Substances 0.000 description 12
- 229940024606 amino acid Drugs 0.000 description 12
- 210000002997 osteoclast Anatomy 0.000 description 12
- 229920001223 polyethylene glycol Polymers 0.000 description 12
- 102400000076 Osteostatin Human genes 0.000 description 11
- 230000002378 acidificating effect Effects 0.000 description 11
- 231100000673 dose–response relationship Toxicity 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- 102000004264 Osteopontin Human genes 0.000 description 10
- 108010081689 Osteopontin Proteins 0.000 description 10
- 230000011164 ossification Effects 0.000 description 10
- 230000011664 signaling Effects 0.000 description 10
- -1 PSI Proteins 0.000 description 9
- 102000043299 Parathyroid hormone-related Human genes 0.000 description 9
- 102000013275 Somatomedins Human genes 0.000 description 9
- 230000004913 activation Effects 0.000 description 9
- 230000008468 bone growth Effects 0.000 description 9
- 230000014509 gene expression Effects 0.000 description 9
- 230000002188 osteogenic effect Effects 0.000 description 9
- 239000011347 resin Substances 0.000 description 9
- 229920005989 resin Polymers 0.000 description 9
- 230000004936 stimulating effect Effects 0.000 description 9
- 239000003263 anabolic agent Substances 0.000 description 8
- 230000033558 biomineral tissue development Effects 0.000 description 8
- 230000018678 bone mineralization Effects 0.000 description 8
- 230000006378 damage Effects 0.000 description 8
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 7
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 7
- 101710123753 Parathyroid hormone-related protein Proteins 0.000 description 7
- 208000027418 Wounds and injury Diseases 0.000 description 7
- 229940124325 anabolic agent Drugs 0.000 description 7
- 150000001510 aspartic acids Chemical class 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 229960002448 dasatinib Drugs 0.000 description 7
- 238000006073 displacement reaction Methods 0.000 description 7
- 230000001965 increasing effect Effects 0.000 description 7
- 230000005012 migration Effects 0.000 description 7
- 238000013508 migration Methods 0.000 description 7
- 108010005195 parathyroid hormone-related protein (107-111) Proteins 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 108010081589 Becaplermin Proteins 0.000 description 6
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 description 6
- 102000001893 Bone Morphogenetic Protein Receptors Human genes 0.000 description 6
- 108010040422 Bone Morphogenetic Protein Receptors Proteins 0.000 description 6
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 6
- 108010090290 Growth Differentiation Factor 2 Proteins 0.000 description 6
- 102100040892 Growth/differentiation factor 2 Human genes 0.000 description 6
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 6
- 102000015636 Oligopeptides Human genes 0.000 description 6
- 108010038807 Oligopeptides Proteins 0.000 description 6
- 108010035042 Osteoprotegerin Proteins 0.000 description 6
- 102000008108 Osteoprotegerin Human genes 0.000 description 6
- 108091008611 Protein Kinase B Proteins 0.000 description 6
- 210000004271 bone marrow stromal cell Anatomy 0.000 description 6
- 208000014674 injury Diseases 0.000 description 6
- XXUPLYBCNPLTIW-UHFFFAOYSA-N octadec-7-ynoic acid Chemical compound CCCCCCCCCCC#CCCCCCC(O)=O XXUPLYBCNPLTIW-UHFFFAOYSA-N 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 150000004922 Dasatinib derivatives Chemical group 0.000 description 5
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 5
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 5
- 108090000189 Neuropeptides Proteins 0.000 description 5
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 5
- 230000033115 angiogenesis Effects 0.000 description 5
- 239000000539 dimer Substances 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 238000000034 method Methods 0.000 description 5
- 239000000863 peptide conjugate Substances 0.000 description 5
- 108010018091 rusalatide acetate Proteins 0.000 description 5
- 238000001356 surgical procedure Methods 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 4
- OGWYPOZJKVZDEZ-SZCRPAFJSA-N 137348-10-8 Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCC(=O)OC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)[C@@H](C)O)C(C)C)[C@@H](C)O)NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)OC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(C)C)C1C=NC=N1 OGWYPOZJKVZDEZ-SZCRPAFJSA-N 0.000 description 4
- 108010059616 Activins Proteins 0.000 description 4
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 4
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 4
- CJLHTKGWEUGORV-UHFFFAOYSA-N Artemin Chemical compound C1CC2(C)C(O)CCC(=C)C2(O)C2C1C(C)C(=O)O2 CJLHTKGWEUGORV-UHFFFAOYSA-N 0.000 description 4
- 108010049931 Bone Morphogenetic Protein 2 Proteins 0.000 description 4
- 102100024506 Bone morphogenetic protein 2 Human genes 0.000 description 4
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 4
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 4
- 102100026818 Inhibin beta E chain Human genes 0.000 description 4
- 101800000169 Osteostatin Proteins 0.000 description 4
- 229920000388 Polyphosphate Polymers 0.000 description 4
- 102000001253 Protein Kinase Human genes 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 4
- 239000000488 activin Substances 0.000 description 4
- 210000001185 bone marrow Anatomy 0.000 description 4
- AHMIRVCNZZUANP-LPBAWZRYSA-N chrysalin Chemical compound CC(O)=O.CC(O)=O.C([C@@H](C(=O)N[C@@H](C(C)C)C(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](C)N)C1=CC=CC=C1.C([C@@H](C(=O)N[C@@H](C(C)C)C(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](C)N)C1=CC=CC=C1.C([C@@H](C(=O)N[C@@H](C(C)C)C(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)CNC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](C)N)C1=CC=CC=C1 AHMIRVCNZZUANP-LPBAWZRYSA-N 0.000 description 4
- 102100021145 fMet-Leu-Phe receptor Human genes 0.000 description 4
- 230000004153 glucose metabolism Effects 0.000 description 4
- 229940088597 hormone Drugs 0.000 description 4
- 239000005556 hormone Substances 0.000 description 4
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 4
- 239000002207 metabolite Substances 0.000 description 4
- 230000004072 osteoblast differentiation Effects 0.000 description 4
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 239000001205 polyphosphate Substances 0.000 description 4
- 235000011176 polyphosphates Nutrition 0.000 description 4
- 230000003389 potentiating effect Effects 0.000 description 4
- 230000001737 promoting effect Effects 0.000 description 4
- 125000006850 spacer group Chemical group 0.000 description 4
- 102000009076 src-Family Kinases Human genes 0.000 description 4
- 108010087686 src-Family Kinases Proteins 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000029663 wound healing Effects 0.000 description 4
- OYIFNHCXNCRBQI-UHFFFAOYSA-N 2-aminoadipic acid Chemical compound OC(=O)C(N)CCCC(O)=O OYIFNHCXNCRBQI-UHFFFAOYSA-N 0.000 description 3
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 3
- WFDIJRYMOXRFFG-UHFFFAOYSA-N Acetic anhydride Chemical compound CC(=O)OC(C)=O WFDIJRYMOXRFFG-UHFFFAOYSA-N 0.000 description 3
- OGSPWJRAVKPPFI-UHFFFAOYSA-N Alendronic Acid Chemical compound NCCCC(O)(P(O)(O)=O)P(O)(O)=O OGSPWJRAVKPPFI-UHFFFAOYSA-N 0.000 description 3
- 102000009840 Angiopoietins Human genes 0.000 description 3
- 108010009906 Angiopoietins Proteins 0.000 description 3
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 description 3
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 description 3
- 208000006386 Bone Resorption Diseases 0.000 description 3
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 3
- 102000010970 Connexin Human genes 0.000 description 3
- 108050001175 Connexin Proteins 0.000 description 3
- 102000007665 Extracellular Signal-Regulated MAP Kinases Human genes 0.000 description 3
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 3
- 101150019331 FGF2 gene Proteins 0.000 description 3
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 3
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 3
- 108010055717 JNK Mitogen-Activated Protein Kinases Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102000003797 Neuropeptides Human genes 0.000 description 3
- 102000003982 Parathyroid hormone Human genes 0.000 description 3
- 108090000445 Parathyroid hormone Proteins 0.000 description 3
- 102000035195 Peptidases Human genes 0.000 description 3
- 102000014128 RANK Ligand Human genes 0.000 description 3
- 108010025832 RANK Ligand Proteins 0.000 description 3
- 108010043267 Sp7 Transcription Factor Proteins 0.000 description 3
- 208000013201 Stress fracture Diseases 0.000 description 3
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 3
- 102000040945 Transcription factor Human genes 0.000 description 3
- 108091023040 Transcription factor Proteins 0.000 description 3
- 102100032317 Transcription factor Sp7 Human genes 0.000 description 3
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 3
- 102000013814 Wnt Human genes 0.000 description 3
- 108050003627 Wnt Proteins 0.000 description 3
- 229940062527 alendronate Drugs 0.000 description 3
- 108010032967 beta-Arrestin 2 Proteins 0.000 description 3
- 210000001772 blood platelet Anatomy 0.000 description 3
- 229940112869 bone morphogenetic protein Drugs 0.000 description 3
- 230000024279 bone resorption Effects 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910052791 calcium Inorganic materials 0.000 description 3
- 230000022159 cartilage development Effects 0.000 description 3
- 230000007547 defect Effects 0.000 description 3
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 3
- 210000002889 endothelial cell Anatomy 0.000 description 3
- 102000012803 ephrin Human genes 0.000 description 3
- 108060002566 ephrin Proteins 0.000 description 3
- 210000002744 extracellular matrix Anatomy 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 210000003976 gap junction Anatomy 0.000 description 3
- 239000000122 growth hormone Substances 0.000 description 3
- 230000035992 intercellular communication Effects 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 230000002297 mitogenic effect Effects 0.000 description 3
- 230000000399 orthopedic effect Effects 0.000 description 3
- 239000000199 parathyroid hormone Substances 0.000 description 3
- 229960001319 parathyroid hormone Drugs 0.000 description 3
- 239000000813 peptide hormone Substances 0.000 description 3
- 238000010647 peptide synthesis reaction Methods 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 230000002062 proliferating effect Effects 0.000 description 3
- 108060006633 protein kinase Proteins 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 102100033367 Appetite-regulating hormone Human genes 0.000 description 2
- 101710111255 Appetite-regulating hormone Proteins 0.000 description 2
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 2
- 102100026376 Artemin Human genes 0.000 description 2
- 101710205806 Artemin Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 101150061927 BMP2 gene Proteins 0.000 description 2
- 102100029648 Beta-arrestin-2 Human genes 0.000 description 2
- 102100022525 Bone morphogenetic protein 6 Human genes 0.000 description 2
- 102000052052 Casein Kinase II Human genes 0.000 description 2
- 108010010919 Casein Kinase II Proteins 0.000 description 2
- 102000015225 Connective Tissue Growth Factor Human genes 0.000 description 2
- 108010039419 Connective Tissue Growth Factor Proteins 0.000 description 2
- 102000015775 Core Binding Factor Alpha 1 Subunit Human genes 0.000 description 2
- 108010024682 Core Binding Factor Alpha 1 Subunit Proteins 0.000 description 2
- 102000001189 Cyclic Peptides Human genes 0.000 description 2
- 108010069514 Cyclic Peptides Proteins 0.000 description 2
- 150000008559 D-glutamic acids Chemical class 0.000 description 2
- 102400000686 Endothelin-1 Human genes 0.000 description 2
- 101800004490 Endothelin-1 Proteins 0.000 description 2
- 108010011459 Exenatide Proteins 0.000 description 2
- 108091008794 FGF receptors Proteins 0.000 description 2
- 108010073385 Fibrin Proteins 0.000 description 2
- 102000009123 Fibrin Human genes 0.000 description 2
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 2
- 108010049003 Fibrinogen Proteins 0.000 description 2
- 102000008946 Fibrinogen Human genes 0.000 description 2
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 2
- 102100037362 Fibronectin Human genes 0.000 description 2
- 102000034615 Glial cell line-derived neurotrophic factor Human genes 0.000 description 2
- 108091010837 Glial cell line-derived neurotrophic factor Proteins 0.000 description 2
- 108010051696 Growth Hormone Proteins 0.000 description 2
- 229920002971 Heparan sulfate Polymers 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 108010033040 Histones Proteins 0.000 description 2
- 101000899390 Homo sapiens Bone morphogenetic protein 6 Proteins 0.000 description 2
- 101000958041 Homo sapiens Musculin Proteins 0.000 description 2
- 101000595923 Homo sapiens Placenta growth factor Proteins 0.000 description 2
- 101001050288 Homo sapiens Transcription factor Jun Proteins 0.000 description 2
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 2
- 101000818522 Homo sapiens fMet-Leu-Phe receptor Proteins 0.000 description 2
- 102000036770 Islet Amyloid Polypeptide Human genes 0.000 description 2
- 108010041872 Islet Amyloid Polypeptide Proteins 0.000 description 2
- 102000019145 JUN kinase activity proteins Human genes 0.000 description 2
- 108090000581 Leukemia inhibitory factor Proteins 0.000 description 2
- 108010075639 MAP Kinase Kinase Kinase 5 Proteins 0.000 description 2
- 102000019149 MAP kinase activity proteins Human genes 0.000 description 2
- 108040008097 MAP kinase activity proteins Proteins 0.000 description 2
- 102100033127 Mitogen-activated protein kinase kinase kinase 5 Human genes 0.000 description 2
- 208000006670 Multiple fractures Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 102000002451 NPR2 Human genes 0.000 description 2
- 108010025020 Nerve Growth Factor Proteins 0.000 description 2
- 102000014413 Neuregulin Human genes 0.000 description 2
- 108050003475 Neuregulin Proteins 0.000 description 2
- 108010015406 Neurturin Proteins 0.000 description 2
- 102100021584 Neurturin Human genes 0.000 description 2
- 102000038030 PI3Ks Human genes 0.000 description 2
- 108091007960 PI3Ks Proteins 0.000 description 2
- 108700020797 Parathyroid Hormone-Related Proteins 0.000 description 2
- 102100036893 Parathyroid hormone Human genes 0.000 description 2
- 108091000080 Phosphotransferase Proteins 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 102100035194 Placenta growth factor Human genes 0.000 description 2
- 102000016611 Proteoglycans Human genes 0.000 description 2
- 108010067787 Proteoglycans Proteins 0.000 description 2
- 108010094028 Prothrombin Proteins 0.000 description 2
- 102100027378 Prothrombin Human genes 0.000 description 2
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 102100038803 Somatotropin Human genes 0.000 description 2
- 102100023132 Transcription factor Jun Human genes 0.000 description 2
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 2
- 102100038286 Vasoactive intestinal polypeptide receptor 2 Human genes 0.000 description 2
- 206010052428 Wound Diseases 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- UCTWMZQNUQWSLP-UHFFFAOYSA-N adrenaline Chemical compound CNCC(O)C1=CC=C(O)C(O)=C1 UCTWMZQNUQWSLP-UHFFFAOYSA-N 0.000 description 2
- 230000000845 anti-microbial effect Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 108010038664 atrial natriuretic factor receptor B Proteins 0.000 description 2
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000010256 bone deposition Effects 0.000 description 2
- 230000003399 chemotactic effect Effects 0.000 description 2
- 210000001612 chondrocyte Anatomy 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 210000003275 diaphysis Anatomy 0.000 description 2
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 2
- 230000035194 endochondral ossification Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 229960001519 exenatide Drugs 0.000 description 2
- 101710108492 fMet-Leu-Phe receptor Proteins 0.000 description 2
- YSFTYXKQUONNFY-NQXPEFQPSA-N fgf2 Chemical compound C([C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H]1NCCC1)C1=CC=CC=C1 YSFTYXKQUONNFY-NQXPEFQPSA-N 0.000 description 2
- 229950003499 fibrin Drugs 0.000 description 2
- 229940012952 fibrinogen Drugs 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000003324 growth hormone secretagogue Substances 0.000 description 2
- 230000011132 hemopoiesis Effects 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 102000046949 human MSC Human genes 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 210000004153 islets of langerhan Anatomy 0.000 description 2
- 229940043355 kinase inhibitor Drugs 0.000 description 2
- 238000010603 microCT Methods 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- WWZKQHOCKIZLMA-UHFFFAOYSA-N octanoic acid Chemical compound CCCCCCCC(O)=O WWZKQHOCKIZLMA-UHFFFAOYSA-N 0.000 description 2
- 230000009818 osteogenic differentiation Effects 0.000 description 2
- 208000002865 osteopetrosis Diseases 0.000 description 2
- 210000004663 osteoprogenitor cell Anatomy 0.000 description 2
- 102000020233 phosphotransferase Human genes 0.000 description 2
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 2
- 230000001023 pro-angiogenic effect Effects 0.000 description 2
- 108010070945 proinsulin-like growth factor II Proteins 0.000 description 2
- 229940039716 prothrombin Drugs 0.000 description 2
- 238000007634 remodeling Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000004043 responsiveness Effects 0.000 description 2
- 229920002477 rna polymer Polymers 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- QZAYGJVTTNCVMB-UHFFFAOYSA-N serotonin Chemical compound C1=C(O)C=C2C(CCN)=CNC2=C1 QZAYGJVTTNCVMB-UHFFFAOYSA-N 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 230000017423 tissue regeneration Effects 0.000 description 2
- 238000012549 training Methods 0.000 description 2
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 2
- 230000004218 vascular function Effects 0.000 description 2
- JWZZKOKVBUJMES-UHFFFAOYSA-N (+-)-Isoprenaline Chemical compound CC(C)NCC(O)C1=CC=C(O)C(O)=C1 JWZZKOKVBUJMES-UHFFFAOYSA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- NEHWBYHLYZGBNO-BVEPWEIPSA-N (2s)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2s)-2-[(2-amino-2-methylpropanoyl)amino]-3-(1h-imidazol-5-yl)propanoyl]amino]-3-naphthalen-2-ylpropanoyl]amino]-3-phenylpropanoyl]amino]hexanamide Chemical compound C([C@H](NC(=O)C(C)(N)C)C(=O)N[C@H](CC=1C=C2C=CC=CC2=CC=1)C(=O)N[C@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CN=CN1 NEHWBYHLYZGBNO-BVEPWEIPSA-N 0.000 description 1
- WZHKXNSOCOQYQX-FUAFALNISA-N (2s)-6-amino-2-[[(2r)-2-[[(2s)-2-[[(2s)-2-[[(2r)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]propanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]-3-phenylpropanoyl]amino]hexanamide Chemical compound C([C@H](N)C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CN=CN1 WZHKXNSOCOQYQX-FUAFALNISA-N 0.000 description 1
- RVWNMGKSNGWLOL-GIIHNPQRSA-N (2s)-6-amino-2-[[(2r)-2-[[(2s)-2-[[(2s)-2-[[(2r)-2-[[(2s)-2-amino-3-(1h-imidazol-5-yl)propanoyl]amino]-3-(2-methyl-1h-indol-3-yl)propanoyl]amino]propanoyl]amino]-3-(1h-indol-3-yl)propanoyl]amino]-3-phenylpropanoyl]amino]hexanamide Chemical compound C([C@H](N)C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CN=CN1 RVWNMGKSNGWLOL-GIIHNPQRSA-N 0.000 description 1
- XJOTXKZIRSHZQV-RXHOOSIZSA-N (3S)-3-amino-4-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S,3S)-1-[[(1R,6R,12R,17R,20S,23S,26R,31R,34R,39R,42S,45S,48S,51S,59S)-51-(4-aminobutyl)-31-[[(2S)-6-amino-1-[[(1S,2R)-1-carboxy-2-hydroxypropyl]amino]-1-oxohexan-2-yl]carbamoyl]-20-benzyl-23-[(2S)-butan-2-yl]-45-(3-carbamimidamidopropyl)-48-(hydroxymethyl)-42-(1H-imidazol-4-ylmethyl)-59-(2-methylsulfanylethyl)-7,10,19,22,25,33,40,43,46,49,52,54,57,60,63,64-hexadecaoxo-3,4,14,15,28,29,36,37-octathia-8,11,18,21,24,32,41,44,47,50,53,55,58,61,62,65-hexadecazatetracyclo[32.19.8.26,17.212,39]pentahexacontan-26-yl]amino]-3-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-4-oxobutanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)[C@@H](C)O)C(=O)N[C@H]1CSSC[C@H](NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](Cc5ccccc5)NC(=O)[C@@H](NC1=O)[C@@H](C)CC)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](Cc1cnc[nH]1)NC3=O)C(=O)NCC(=O)N[C@@H](CCSC)C(=O)N2)C(=O)NCC(=O)N4)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XJOTXKZIRSHZQV-RXHOOSIZSA-N 0.000 description 1
- SKWCZPYWFRTSDD-UHFFFAOYSA-N 2,3-bis(azaniumyl)propanoate;chloride Chemical group Cl.NCC(N)C(O)=O SKWCZPYWFRTSDD-UHFFFAOYSA-N 0.000 description 1
- YQNRVGJCPCNMKT-JLPGSUDCSA-N 2-(4-benzylpiperazin-1-yl)-n-[(2-hydroxy-3-prop-2-enyl-phenyl)methylideneamino]acetamide Chemical compound OC1=C(CC=C)C=CC=C1\C=N/NC(=O)CN1CCN(CC=2C=CC=CC=2)CC1 YQNRVGJCPCNMKT-JLPGSUDCSA-N 0.000 description 1
- RUVRGYVESPRHSZ-UHFFFAOYSA-N 2-[2-(2-azaniumylethoxy)ethoxy]acetate Chemical compound NCCOCCOCC(O)=O RUVRGYVESPRHSZ-UHFFFAOYSA-N 0.000 description 1
- VOUAQYXWVJDEQY-QENPJCQMSA-N 33017-11-7 Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)CCC1 VOUAQYXWVJDEQY-QENPJCQMSA-N 0.000 description 1
- XXJWYDDUDKYVKI-UHFFFAOYSA-N 4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-6-methoxy-7-[3-(1-pyrrolidinyl)propoxy]quinazoline Chemical compound COC1=CC2=C(OC=3C(=C4C=C(C)NC4=CC=3)F)N=CN=C2C=C1OCCCN1CCCC1 XXJWYDDUDKYVKI-UHFFFAOYSA-N 0.000 description 1
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 description 1
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- 239000005541 ACE inhibitor Substances 0.000 description 1
- 101150079978 AGRN gene Proteins 0.000 description 1
- 101800004616 Adrenomedullin Proteins 0.000 description 1
- 102400001318 Adrenomedullin Human genes 0.000 description 1
- 102100036601 Aggrecan core protein Human genes 0.000 description 1
- 108010067219 Aggrecans Proteins 0.000 description 1
- 102100040026 Agrin Human genes 0.000 description 1
- 108700019743 Agrin Proteins 0.000 description 1
- USFZMSVCRYTOJT-UHFFFAOYSA-N Ammonium acetate Chemical compound N.CC(O)=O USFZMSVCRYTOJT-UHFFFAOYSA-N 0.000 description 1
- 239000005695 Ammonium acetate Substances 0.000 description 1
- 102100038778 Amphiregulin Human genes 0.000 description 1
- 108010033760 Amphiregulin Proteins 0.000 description 1
- 102000000412 Annexin Human genes 0.000 description 1
- 108050008874 Annexin Proteins 0.000 description 1
- 108010052412 Apelin Proteins 0.000 description 1
- 102000018746 Apelin Human genes 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102400001242 Betacellulin Human genes 0.000 description 1
- 101800001382 Betacellulin Proteins 0.000 description 1
- 229940122361 Bisphosphonate Drugs 0.000 description 1
- 102100024505 Bone morphogenetic protein 4 Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 description 1
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 description 1
- 0 C*(C)NN*PSC Chemical compound C*(C)NN*PSC 0.000 description 1
- NHQDCMMLFZFODO-UHFFFAOYSA-N CCCCCCCC(NC#C)=O Chemical compound CCCCCCCC(NC#C)=O NHQDCMMLFZFODO-UHFFFAOYSA-N 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 102100038518 Calcitonin Human genes 0.000 description 1
- 108090000932 Calcitonin Gene-Related Peptide Proteins 0.000 description 1
- 102000004657 Calcium-Calmodulin-Dependent Protein Kinase Type 2 Human genes 0.000 description 1
- 108010003721 Calcium-Calmodulin-Dependent Protein Kinase Type 2 Proteins 0.000 description 1
- 102000004171 Cathepsin K Human genes 0.000 description 1
- 108090000625 Cathepsin K Proteins 0.000 description 1
- 229920001287 Chondroitin sulfate Polymers 0.000 description 1
- 108010005939 Ciliary Neurotrophic Factor Proteins 0.000 description 1
- 102100031614 Ciliary neurotrophic factor Human genes 0.000 description 1
- 102100022641 Coagulation factor IX Human genes 0.000 description 1
- 102100023804 Coagulation factor VII Human genes 0.000 description 1
- 102000012422 Collagen Type I Human genes 0.000 description 1
- 108010022452 Collagen Type I Proteins 0.000 description 1
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 102000015833 Cystatin Human genes 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- LEVWYRKDKASIDU-QWWZWVQMSA-N D-cystine Chemical compound OC(=O)[C@H](N)CSSC[C@@H](N)C(O)=O LEVWYRKDKASIDU-QWWZWVQMSA-N 0.000 description 1
- JRWZLRBJNMZMFE-UHFFFAOYSA-N Dobutamine Chemical compound C=1C=C(O)C(O)=CC=1CCNC(C)CCC1=CC=C(O)C=C1 JRWZLRBJNMZMFE-UHFFFAOYSA-N 0.000 description 1
- 102100023274 Dual specificity mitogen-activated protein kinase kinase 4 Human genes 0.000 description 1
- 102100023332 Dual specificity mitogen-activated protein kinase kinase 7 Human genes 0.000 description 1
- 108010014258 Elastin Proteins 0.000 description 1
- 102000016942 Elastin Human genes 0.000 description 1
- 102400001368 Epidermal growth factor Human genes 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 102400001329 Epiregulin Human genes 0.000 description 1
- 101800000155 Epiregulin Proteins 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 1
- 229920002444 Exopolysaccharide Polymers 0.000 description 1
- 108050001049 Extracellular proteins Proteins 0.000 description 1
- 229940124602 FDA-approved drug Drugs 0.000 description 1
- 108010076282 Factor IX Proteins 0.000 description 1
- 108010023321 Factor VII Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 108010014173 Factor X Proteins 0.000 description 1
- 206010016454 Femur fracture Diseases 0.000 description 1
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 1
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 208000003790 Foot Ulcer Diseases 0.000 description 1
- 108010076288 Formyl peptide receptors Proteins 0.000 description 1
- 102000011652 Formyl peptide receptors Human genes 0.000 description 1
- 108010088406 Glucagon-Like Peptides Proteins 0.000 description 1
- 102100031132 Glucose-6-phosphate isomerase Human genes 0.000 description 1
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 108090001086 Growth differentiation factor-9 Proteins 0.000 description 1
- 102000004858 Growth differentiation factor-9 Human genes 0.000 description 1
- 102100039939 Growth/differentiation factor 8 Human genes 0.000 description 1
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 1
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 1
- 102100021866 Hepatocyte growth factor Human genes 0.000 description 1
- 102100032813 Hepatocyte growth factor-like protein Human genes 0.000 description 1
- 102100031000 Hepatoma-derived growth factor Human genes 0.000 description 1
- 101000627872 Homo sapiens 72 kDa type IV collagenase Proteins 0.000 description 1
- 101000762379 Homo sapiens Bone morphogenetic protein 4 Proteins 0.000 description 1
- 101001115395 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 4 Proteins 0.000 description 1
- 101000624594 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 7 Proteins 0.000 description 1
- 101001027128 Homo sapiens Fibronectin Proteins 0.000 description 1
- 101000893585 Homo sapiens Growth/differentiation factor 2 Proteins 0.000 description 1
- 101001046870 Homo sapiens Hypoxia-inducible factor 1-alpha Proteins 0.000 description 1
- 101001139126 Homo sapiens Krueppel-like factor 6 Proteins 0.000 description 1
- 101000950669 Homo sapiens Mitogen-activated protein kinase 9 Proteins 0.000 description 1
- 101000896414 Homo sapiens Nuclear nucleic acid-binding protein C1D Proteins 0.000 description 1
- 101000613820 Homo sapiens Osteopontin Proteins 0.000 description 1
- 101001133600 Homo sapiens Pituitary adenylate cyclase-activating polypeptide type I receptor Proteins 0.000 description 1
- 101001043564 Homo sapiens Prolow-density lipoprotein receptor-related protein 1 Proteins 0.000 description 1
- 101001080401 Homo sapiens Proteasome assembly chaperone 1 Proteins 0.000 description 1
- 101000703512 Homo sapiens Sphingosine-1-phosphate phosphatase 1 Proteins 0.000 description 1
- 101000904724 Homo sapiens Transmembrane glycoprotein NMB Proteins 0.000 description 1
- 101000753253 Homo sapiens Tyrosine-protein kinase receptor Tie-1 Proteins 0.000 description 1
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 101000666868 Homo sapiens Vasoactive intestinal polypeptide receptor 2 Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 206010021143 Hypoxia Diseases 0.000 description 1
- 102100022875 Hypoxia-inducible factor 1-alpha Human genes 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102000005755 Intercellular Signaling Peptides and Proteins Human genes 0.000 description 1
- 108010070716 Intercellular Signaling Peptides and Proteins Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102100020873 Interleukin-2 Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000008133 Iron-Binding Proteins Human genes 0.000 description 1
- 108010035210 Iron-Binding Proteins Proteins 0.000 description 1
- 229920000288 Keratan sulfate Polymers 0.000 description 1
- 102100020679 Krueppel-like factor 6 Human genes 0.000 description 1
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 1
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 1
- 101800004361 Lactoferricin-B Proteins 0.000 description 1
- 102000007547 Laminin Human genes 0.000 description 1
- 108010085895 Laminin Proteins 0.000 description 1
- 102000004058 Leukemia inhibitory factor Human genes 0.000 description 1
- 102100032352 Leukemia inhibitory factor Human genes 0.000 description 1
- 108010019598 Liraglutide Proteins 0.000 description 1
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 1
- XVVOERDUTLJJHN-UHFFFAOYSA-N Lixisenatide Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NCC(=O)NCC(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N1C(CCC1)C(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)CC)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCSC)NC(=O)C(CCC(N)=O)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC=1C=CC=CC=1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)CNC(=O)C(N)CC=1NC=NC=1)C(C)O)C(C)O)C(C)C)CC1=CC=CC=C1 XVVOERDUTLJJHN-UHFFFAOYSA-N 0.000 description 1
- 101710172064 Low-density lipoprotein receptor-related protein Proteins 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 108090000744 Mitogen-Activated Protein Kinase Kinases Proteins 0.000 description 1
- 102100024189 Mitogen-activated protein kinase 4 Human genes 0.000 description 1
- 101710166114 Mitogen-activated protein kinase 4 Proteins 0.000 description 1
- 102100037809 Mitogen-activated protein kinase 9 Human genes 0.000 description 1
- 102100025744 Mothers against decapentaplegic homolog 1 Human genes 0.000 description 1
- 101100165560 Mus musculus Bmp7 gene Proteins 0.000 description 1
- 101100236477 Mus musculus Manba gene Proteins 0.000 description 1
- 101000904718 Mus musculus Transmembrane glycoprotein NMB Proteins 0.000 description 1
- 108010056852 Myostatin Proteins 0.000 description 1
- KWYHDKDOAIKMQN-UHFFFAOYSA-N N,N,N',N'-tetramethylethylenediamine Chemical compound CN(C)CCN(C)C KWYHDKDOAIKMQN-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 102000015336 Nerve Growth Factor Human genes 0.000 description 1
- 102000007072 Nerve Growth Factors Human genes 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 102000002002 Neurokinin-1 Receptors Human genes 0.000 description 1
- 108010040718 Neurokinin-1 Receptors Proteins 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- 102000002111 Neuropilin Human genes 0.000 description 1
- 108050009450 Neuropilin Proteins 0.000 description 1
- 108090000742 Neurotrophin 3 Proteins 0.000 description 1
- 102000004230 Neurotrophin 3 Human genes 0.000 description 1
- 108090000099 Neurotrophin-4 Proteins 0.000 description 1
- 102000003683 Neurotrophin-4 Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000004067 Osteocalcin Human genes 0.000 description 1
- 108090000573 Osteocalcin Proteins 0.000 description 1
- 208000001164 Osteoporotic Fractures Diseases 0.000 description 1
- 229960005552 PAC-1 Drugs 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102100036660 Persephin Human genes 0.000 description 1
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000002808 Pituitary adenylate cyclase-activating polypeptide Human genes 0.000 description 1
- 108010004684 Pituitary adenylate cyclase-activating polypeptide Proteins 0.000 description 1
- 102000004211 Platelet factor 4 Human genes 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 101000688200 Prevotella intermedia Alkaline phosphatase Proteins 0.000 description 1
- 102100021923 Prolow-density lipoprotein receptor-related protein 1 Human genes 0.000 description 1
- 108050009310 Protease-activated receptors Proteins 0.000 description 1
- 102000002020 Protease-activated receptors Human genes 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 101001121466 Rattus norvegicus Osteopontin Proteins 0.000 description 1
- 101000703459 Rattus norvegicus Sphingosine-1-phosphate phosphatase 1 Proteins 0.000 description 1
- 108010038036 Receptor Activator of Nuclear Factor-kappa B Proteins 0.000 description 1
- 108091005682 Receptor kinases Proteins 0.000 description 1
- 108010090629 Renalase Proteins 0.000 description 1
- 102000013272 Renalase Human genes 0.000 description 1
- 101700032040 SMAD1 Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 102100034201 Sclerostin Human genes 0.000 description 1
- 108050006698 Sclerostin Proteins 0.000 description 1
- DLSWIYLPEUIQAV-UHFFFAOYSA-N Semaglutide Chemical compound CCC(C)C(NC(=O)C(Cc1ccccc1)NC(=O)C(CCC(O)=O)NC(=O)C(CCCCNC(=O)COCCOCCNC(=O)COCCOCCNC(=O)CCC(NC(=O)CCCCCCCCCCCCCCCCC(O)=O)C(O)=O)NC(=O)C(C)NC(=O)C(C)NC(=O)C(CCC(N)=O)NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(CC(C)C)NC(=O)C(Cc1ccc(O)cc1)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(Cc1ccccc1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)C(C)(C)NC(=O)C(N)Cc1cnc[nH]1)C(C)O)C(C)O)C(C)C)C(=O)NC(C)C(=O)NC(Cc1c[nH]c2ccccc12)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CCCNC(N)=N)C(=O)NCC(O)=O DLSWIYLPEUIQAV-UHFFFAOYSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102000007374 Smad Proteins Human genes 0.000 description 1
- 108010007945 Smad Proteins Proteins 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 108090000054 Syndecan-2 Proteins 0.000 description 1
- 102000003141 Tachykinin Human genes 0.000 description 1
- 108010010056 Terlipressin Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108010041111 Thrombopoietin Proteins 0.000 description 1
- 102000036693 Thrombopoietin Human genes 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 108010009583 Transforming Growth Factors Proteins 0.000 description 1
- 102000009618 Transforming Growth Factors Human genes 0.000 description 1
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 102100028787 Tumor necrosis factor receptor superfamily member 11A Human genes 0.000 description 1
- 102100022007 Tyrosine-protein kinase receptor Tie-1 Human genes 0.000 description 1
- 102000008790 VE-cadherin Human genes 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 102100038388 Vasoactive intestinal polypeptide receptor 1 Human genes 0.000 description 1
- 101710137655 Vasoactive intestinal polypeptide receptor 1 Proteins 0.000 description 1
- 101710137651 Vasoactive intestinal polypeptide receptor 2 Proteins 0.000 description 1
- 102400001284 Vessel dilator Human genes 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 229930003448 Vitamin K Natural products 0.000 description 1
- 239000003875 Wang resin Substances 0.000 description 1
- 108010005601 ZP2307 Proteins 0.000 description 1
- 108010045610 ZT-031 Proteins 0.000 description 1
- NERFNHBZJXXFGY-UHFFFAOYSA-N [4-[(4-methylphenyl)methoxy]phenyl]methanol Chemical compound C1=CC(C)=CC=C1COC1=CC=C(CO)C=C1 NERFNHBZJXXFGY-UHFFFAOYSA-N 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 230000001133 acceleration Effects 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- ULCUCJFASIJEOE-NPECTJMMSA-N adrenomedullin Chemical compound C([C@@H](C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)NCC(=O)N[C@@H]1C(N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CSSC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(N)=O)[C@@H](C)O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 ULCUCJFASIJEOE-NPECTJMMSA-N 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- OGWAVGNOAMXIIM-UHFFFAOYSA-N albiglutide Chemical compound O=C(O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)CNC(=O)C(N)CC=1(N=CNC=1))CCC(=O)O)C(O)C)CC2(=CC=CC=C2))C(O)C)CO)CC(=O)O)C(C)C)CO)CO)CC3(=CC=C(O)C=C3))CC(C)C)CCC(=O)O)CCC(=O)N)C)C)CCCCN)CCC(=O)O)CC4(=CC=CC=C4))C(CC)C)C)CC=6(C5(=C(C=CC=C5)NC=6)))CC(C)C)C(C)C)CCCCN)CCCNC(=N)N OGWAVGNOAMXIIM-UHFFFAOYSA-N 0.000 description 1
- 229960004733 albiglutide Drugs 0.000 description 1
- OBETXYAYXDNJHR-UHFFFAOYSA-N alpha-ethylcaproic acid Natural products CCCCC(CC)C(O)=O OBETXYAYXDNJHR-UHFFFAOYSA-N 0.000 description 1
- 235000019257 ammonium acetate Nutrition 0.000 description 1
- 229940043376 ammonium acetate Drugs 0.000 description 1
- 108010044347 amylin(1-8) Proteins 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 239000002870 angiogenesis inducing agent Substances 0.000 description 1
- 229940044094 angiotensin-converting-enzyme inhibitor Drugs 0.000 description 1
- 210000003423 ankle Anatomy 0.000 description 1
- BWVPHIKGXQBZPV-QKFDDRBGSA-N apelin Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N1[C@H](C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=2NC=NC=2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=2NC=NC=2)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CCSC)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(O)=O)CCC1 BWVPHIKGXQBZPV-QKFDDRBGSA-N 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229910052786 argon Inorganic materials 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-L aspartate group Chemical class N[C@@H](CC(=O)[O-])C(=O)[O-] CKLJMWTZIZZHCS-REOHCLBHSA-L 0.000 description 1
- 108010090012 atrial natriuretic factor prohormone (31-67) Proteins 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000035578 autophosphorylation Effects 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 150000004663 bisphosphonates Chemical class 0.000 description 1
- 239000003114 blood coagulation factor Substances 0.000 description 1
- 230000036770 blood supply Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 101150067309 bmp4 gene Proteins 0.000 description 1
- 230000014461 bone development Effects 0.000 description 1
- 230000004097 bone metabolism Effects 0.000 description 1
- 230000010478 bone regeneration Effects 0.000 description 1
- 230000010072 bone remodeling Effects 0.000 description 1
- 230000008416 bone turnover Effects 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 description 1
- 230000005587 bubbling Effects 0.000 description 1
- RMRJXGBAOAMLHD-IHFGGWKQSA-N buprenorphine Chemical compound C([C@]12[C@H]3OC=4C(O)=CC=C(C2=4)C[C@@H]2[C@]11CC[C@]3([C@H](C1)[C@](C)(O)C(C)(C)C)OC)CN2CC1CC1 RMRJXGBAOAMLHD-IHFGGWKQSA-N 0.000 description 1
- 229960001736 buprenorphine Drugs 0.000 description 1
- 108010018828 cadherin 5 Proteins 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 108060001132 cathelicidin Proteins 0.000 description 1
- 102000014509 cathelicidin Human genes 0.000 description 1
- POIUWJQBRNEFGX-XAMSXPGMSA-N cathelicidin Chemical compound C([C@@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(C)C)C1=CC=CC=C1 POIUWJQBRNEFGX-XAMSXPGMSA-N 0.000 description 1
- 229960002412 cediranib Drugs 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- PRQROPMIIGLWRP-BZSNNMDCSA-N chemotactic peptide Chemical compound CSCC[C@H](NC=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 PRQROPMIIGLWRP-BZSNNMDCSA-N 0.000 description 1
- 230000035605 chemotaxis Effects 0.000 description 1
- 229940059329 chondroitin sulfate Drugs 0.000 description 1
- 229940096422 collagen type i Drugs 0.000 description 1
- 229940047120 colony stimulating factors Drugs 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 108050004038 cystatin Proteins 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 229940042399 direct acting antivirals protease inhibitors Drugs 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 229960001089 dobutamine Drugs 0.000 description 1
- 229960003638 dopamine Drugs 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 108010005794 dulaglutide Proteins 0.000 description 1
- 229960005175 dulaglutide Drugs 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 230000002121 endocytic effect Effects 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 239000006274 endogenous ligand Substances 0.000 description 1
- 210000003038 endothelium Anatomy 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 108700002672 epoxomicin Proteins 0.000 description 1
- DOGIDQKFVLKMLQ-JTHVHQAWSA-N epoxomicin Chemical compound CC[C@H](C)[C@H](N(C)C(C)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)[C@@]1(C)CO1 DOGIDQKFVLKMLQ-JTHVHQAWSA-N 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 230000010222 extracellular calcium influx Effects 0.000 description 1
- 210000003414 extremity Anatomy 0.000 description 1
- 229960004222 factor ix Drugs 0.000 description 1
- 229940012413 factor vii Drugs 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 229940012426 factor x Drugs 0.000 description 1
- 102000013361 fetuin Human genes 0.000 description 1
- 108060002885 fetuin Proteins 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 210000002599 gastric fundus Anatomy 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 150000002306 glutamic acid derivatives Chemical class 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 108010015153 growth hormone releasing hexapeptide Proteins 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 239000013003 healing agent Substances 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 108010052188 hepatoma-derived growth factor Proteins 0.000 description 1
- 102000018511 hepcidin Human genes 0.000 description 1
- 108060003558 hepcidin Proteins 0.000 description 1
- 229940066919 hepcidin Drugs 0.000 description 1
- 108010070965 hexarelin Proteins 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 102000046041 human GDF2 Human genes 0.000 description 1
- 102000051312 human SPP1 Human genes 0.000 description 1
- 102000058223 human VEGFA Human genes 0.000 description 1
- 235000020256 human milk Nutrition 0.000 description 1
- 210000004251 human milk Anatomy 0.000 description 1
- 108091002540 human parathyroid hormone (1-31)amide Proteins 0.000 description 1
- 102000032129 human parathyroid hormone (1-31)amide Human genes 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000002102 hyperpolarization Effects 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 230000006662 intracellular pathway Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 108010027047 ipamorelin Proteins 0.000 description 1
- 229950002987 ipamorelin Drugs 0.000 description 1
- 229960001317 isoprenaline Drugs 0.000 description 1
- KXCLCNHUUKTANI-RBIYJLQWSA-N keratan Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@H](COS(O)(=O)=O)O[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H]([C@@H](COS(O)(=O)=O)O[C@@H](O)[C@@H]3O)O)[C@H](NC(C)=O)[C@H]2O)COS(O)(=O)=O)O[C@H](COS(O)(=O)=O)[C@@H]1O KXCLCNHUUKTANI-RBIYJLQWSA-N 0.000 description 1
- CFFMZOZGXDAXHP-HOKBLYKWSA-N lactoferricin Chemical compound C([C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CSSC[C@@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CO)C(=O)N[C@H](C(N[C@H](C(=O)N1)[C@@H](C)O)=O)[C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CFFMZOZGXDAXHP-HOKBLYKWSA-N 0.000 description 1
- 210000002414 leg Anatomy 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 150000002617 leukotrienes Chemical class 0.000 description 1
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 1
- 229960002701 liraglutide Drugs 0.000 description 1
- 108010004367 lixisenatide Proteins 0.000 description 1
- 229960001093 lixisenatide Drugs 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 108010053292 macrophage stimulating protein Proteins 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- 108020004084 membrane receptors Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 239000003226 mitogen Substances 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 230000003562 morphometric effect Effects 0.000 description 1
- 238000013425 morphometry Methods 0.000 description 1
- 210000002346 musculoskeletal system Anatomy 0.000 description 1
- 210000004898 n-terminal fragment Anatomy 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 229940053128 nerve growth factor Drugs 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 229940032018 neurotrophin 3 Drugs 0.000 description 1
- 229940097998 neurotrophin 4 Drugs 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- OXZNHYPGOAWYLT-FISSOZIDSA-N ostabolin Chemical compound C([C@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1N=CN=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)OC(=O)CC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](N)CCC(O)=O)C(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(N)=N)C(C)C)C1C=NC=N1 OXZNHYPGOAWYLT-FISSOZIDSA-N 0.000 description 1
- 230000004818 osteo-differentiation Effects 0.000 description 1
- 230000010258 osteoblastogenesis Effects 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 229940094443 oxytocics prostaglandins Drugs 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 101150096366 pep7 gene Proteins 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 210000001428 peripheral nervous system Anatomy 0.000 description 1
- 108010070453 persephin Proteins 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 102000036213 phospholipid binding proteins Human genes 0.000 description 1
- 108091011000 phospholipid binding proteins Proteins 0.000 description 1
- SHUZOJHMOBOZST-UHFFFAOYSA-N phylloquinone Natural products CC(C)CCCCC(C)CCC(C)CCCC(=CCC1=C(C)C(=O)c2ccccc2C1=O)C SHUZOJHMOBOZST-UHFFFAOYSA-N 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 238000013105 post hoc analysis Methods 0.000 description 1
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 1
- 108010059571 preptin-(1-16) Proteins 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 description 1
- 238000003762 quantitative reverse transcription PCR Methods 0.000 description 1
- 108700027806 rGLP-1 Proteins 0.000 description 1
- 229960002633 ramucirumab Drugs 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000001172 regenerating effect Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000008458 response to injury Effects 0.000 description 1
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 108010060325 semaglutide Proteins 0.000 description 1
- 229950011186 semaglutide Drugs 0.000 description 1
- 229940076279 serotonin Drugs 0.000 description 1
- 229950005143 sitosterol Drugs 0.000 description 1
- XXSWYTSITMIFFJ-UHFFFAOYSA-N sokotrasterol sulfate Natural products C1C(OS(O)(=O)=O)C2CC(OS(O)(=O)=O)C(OS(O)(=O)=O)CC2(C)C2C1C1CCC(C(C)CC=C(C)C(C)(C)C(C)C)C1(C)CC2 XXSWYTSITMIFFJ-UHFFFAOYSA-N 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- ADNPLDHMAVUMIW-CUZNLEPHSA-N substance P Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(N)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CCCN=C(N)N)C1=CC=CC=C1 ADNPLDHMAVUMIW-CUZNLEPHSA-N 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 108060008037 tachykinin Proteins 0.000 description 1
- 108010048573 taspoglutide Proteins 0.000 description 1
- WRGVLTAWMNZWGT-VQSPYGJZSA-N taspoglutide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NC(C)(C)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 WRGVLTAWMNZWGT-VQSPYGJZSA-N 0.000 description 1
- 229950007151 taspoglutide Drugs 0.000 description 1
- BENFXAYNYRLAIU-QSVFAHTRSA-N terlipressin Chemical compound NCCCC[C@@H](C(=O)NCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)CN)CSSC1 BENFXAYNYRLAIU-QSVFAHTRSA-N 0.000 description 1
- 229960003813 terlipressin Drugs 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940040944 tetracyclines Drugs 0.000 description 1
- DSNBHJFQCNUKMA-SCKDECHMSA-N thromboxane A2 Chemical compound OC(=O)CCC\C=C/C[C@@H]1[C@@H](/C=C/[C@@H](O)CCCCC)O[C@@H]2O[C@H]1C2 DSNBHJFQCNUKMA-SCKDECHMSA-N 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- 238000007492 two-way ANOVA Methods 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 125000005500 uronium group Chemical group 0.000 description 1
- 229960000241 vandetanib Drugs 0.000 description 1
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 1
- 230000006442 vascular tone Effects 0.000 description 1
- 230000003639 vasoconstrictive effect Effects 0.000 description 1
- 230000024883 vasodilation Effects 0.000 description 1
- 230000002883 vasorelaxation effect Effects 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 235000019168 vitamin K Nutrition 0.000 description 1
- 239000011712 vitamin K Substances 0.000 description 1
- 150000003721 vitamin K derivatives Chemical class 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 229940046010 vitamin k Drugs 0.000 description 1
- 108010047303 von Willebrand Factor Proteins 0.000 description 1
- 102100036537 von Willebrand factor Human genes 0.000 description 1
- 229960001134 von willebrand factor Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/645—Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1875—Bone morphogenic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/59—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
- A61K47/60—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6435—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a connective tissue peptide, e.g. collagen, fibronectin or gelatin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4721—Lipocortins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/49—Platelet-derived growth factor [PDGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/51—Bone morphogenetic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/65—Insulin-like growth factors, i.e. somatomedins, e.g. IGF-1, IGF-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/79—Transferrins, e.g. lactoferrins, ovotransferrins
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/52—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea
- C12N9/54—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from bacteria or Archaea bacteria being Bacillus
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
- C12N9/6424—Serine endopeptidases (3.4.21)
- C12N9/6429—Thrombin (3.4.21.5)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- aspects of the present disclosure relate to the materials and methods for treating bone fractures and bone defects.
- Src tyrosine kinase plays a crucial role in bone metabolism: despite its ubiquitous expression profile, the only apparent phenotypical abnormality in a Sarcoma-knockout (Src-KO) mouse strain was osteopetrosis.
- Src inhibitors inhibit both the formation and activity of osteoblasts (OBs) in vitro, the number of osteoclasts (OCs) derived from Src-KO mice were actually elevated in Src-KO mice, measuring more than twice that in wild-type (WT) mice. Also, a marked increase in both osteoblast number and activity was observed in vivo in Src-KO mice.
- osteopetrosis phenotype of Src-KO mice was not a result of reduced osteoclast formation, but rather of boosted osteoblast activity as well as reduced osteoclast function.
- osteoblasts derived from Src-KO mice demonstrated unremarkable morphological features compared to those harvested from WT mice, and were able to fully regulate normal osteoclast differentiation via the receptor activator of nuclear factor kappa-B ligand/receptor activator of nuclear factor kappa-B/osteoprotegerin (RANKL/RANK/OPG) pathway.
- this bone-resorption defect should be easily alleviated by restoring normal Src functionality in osteoclasts, reducing potential risks on the musculoskeletal system involved in long-term use of Src inhibitors for fracture healing.
- peptide anabolic drugs include different categories of protein or the fragments thereof. They are represented by bone morphogenetic protein pathway signaling peptides including P4, bone forming peptide (BFP) and peptide from Bone morphogenetic protein 9 (pBMP9); insulin-like growth factor (IGF) derived peptides including mechano-growth factor (MGF) and Preptin; bone stimulatory neuropeptides including Substance P and vasoactive intestinal peptide (VIP); and peptides enhancing vascular functions, including C-type Natriuretic peptide (CNP), thrombin fragment or targeted prothrombin peptide (TP508) and VIP. Each of these peptides may have its own unique mechanism working to regulate bone growth, as will be outlined in the detailed description.
- BMP-2 bone morphogenic protein
- BMP-7 discontinued
- a first aspect of the present disclosure includes at least one compound of the formula X-Y-Z, or a pharmaceutically acceptable salt thereof, or a metabolite thereof, wherein X is at least one agent that improves bone density, mechanical strength, bone deposition, or quality; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z.
- X is at least one agent that enhances the activity or one agent that improves bone density, mechanical strength, bone deposition or otherwise promotes bone healing and/or growth.
- Z is at least one negatively charged oligopeptide or an equivalent thereof that binds to hydroxyapatite and/or raw bone.
- the second aspect includes the compound according to the first aspect, wherein when X is a polypeptide, any polypeptide having at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and/or 100% identity to X can be used to practice the invention.
- Y is at least one polypeptide comprising at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and/or 100% sequence identity to amino acid residues 35-40, 35-41, 35-42, 35-43, 35-44, 35-45, 35-46, 35-47, 35-48, 35-49, 35-50, 35-51, 35-52, 35-55, 35-84, 41-44, 41-45, 41-46, 41-47, 41-48, 41-49, 41-50, and/or 41-84 of a full length parathyroid hormone related peptide or parathyroid hormone, and/or at least one Cathepsin K sensitive polypeptide.
- Z is at least one polypeptide comprising about 4 or more, from about 4 to about 100, from about 4 to about 50, from 4 to about 20, from about 4 to about 15, from about 4 to about 10 acidic amino acid residues, polyphosphate, 2-aminohexanedioic (aminoadipic) acid or derivatives thereof, and/or alendronate or derivatives thereof.
- Z is at least one polypeptide comprising about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, and/or 30 acidic amino acid residues, polyphosphate, 2-aminohexanedioic acid or derivatives thereof, and/or alendronate or derivatives thereof.
- Z is at least one negatively charged oligopeptide or an equivalent thereof that binds to hydroxyapatite and/or raw bone.
- the targeted delivery strategy recited in some aspects of the invention enable the delivery of Src inhibitors specifically to bone fracture surfaces thereby facilitating fracture healing. This in vivo efficacy is shown by the acceleration of fracture healing observed using the Src inhibitors Dasatinib and E738.
- a group of peptides targeted specifically to the fracture surfaces also demonstrates an enhanced ability to facilitate fracture healing.
- These peptides include osteopontin derived fragments such as osteopontin-derived peptide (ODP), collagen binding motif (CBM); BMP fragments such as P4, BFP, pBMP7; IGF fragments such as MGF and Preptin; neuropeptides such as Substance P and VIP; Vasoconstrictive fragments such as CNP, TP508 and VIP; and other anabolic drugs such as osteogenic growth peptide (OGP).
- ODP osteopontin-derived peptide
- CBM collagen binding motif
- BMP fragments such as P4, BFP, pBMP7
- IGF fragments such as MGF and Preptin
- neuropeptides such as Substance P and VIP
- Vasoconstrictive fragments such as CNP, TP508 and VIP
- other anabolic drugs such as osteogenic growth peptide (OGP).
- Some aspects of this disclosure include compounds comprising: a compound of the formula X-Y-Z, wherein X is at least one agent that modulates bone growth, such as activity of Src tyrosine kinase; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof.
- Z is at least one polypeptide comprising 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and/or 20 acidic amino acid residues.
- X is selected from the group consisting of Dasatinib and E738.
- Y is a releasable linker selected from disulfide; ester; or protease specific amide bond. In some aspects, Y is a nonreleasable bond selected from carbon-carbon bond; or amide bond.
- this disclosure includes a compound of the formula X-Y-Z, wherein X is at least one peptide or a fragment thereof that modulates activity of bone and cartilage formation; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof.
- Y is a releasable linker selected from disulfide; ester; or protease specific amide bond.
- Y is a nonreleasable bond selected from carbon-carbon bond; or amide bond.
- Y is a peptide belonging to the natural sequence of Z.
- Y is a polyethylene glycol (PEG) linker. In some aspects Y is a PEG linker comprised of 2-8 oxyethylene units. In some aspects, Z comprises at least 10 aspartic or glutamic acids conjugated to X. In some aspects, Z comprises at least 20 aspartic or glutamic acids conjugated to X. In some aspects, the compound may be produced by solid phase synthesis.
- PEG polyethylene glycol
- X is a bone anabolic peptide derived from BMP. In some aspects, X is a bone anabolic peptide derived from IGF. In some aspects, X is a bone anabolic peptide derived from a neuropeptide. In some aspects, X is a bone anabolic peptide that improves vascular function and/or vascularization. In some aspects, X is osteogenic growth peptide (OGP). In some aspects, the peptide is BFP, P4, or pBMP9. In some aspects, the peptide is MGF or Preptin. In some aspects, the peptide is Substance P or VIP. In some aspects, the peptide is TP508, VIP, or CNP. Unless indicated otherwise, the invention may be practiced by combining any X with any Z and optionally any suitable linking group Y.
- FIG. 1 depicts the bone volume divided by total volume of the 100 thickest micro computed tomography (CT) slices of the fracture callus bone density (“BV/TV”) using a Dasatinib and targeted Dasatinib conjugate (both 10 ⁇ mol/kg). Both were subcutaneously dosed daily to fracture-bearing Ul Dame breed (ND4) of Swiss Webster mice. Bone density of the fracture callus from the targeted Dasatinib group is twice as dense as the saline group, and 50% denser than the free Dasatinib group.
- CT micro computed tomography
- FIG. 2 depicts BV/TV and Trabecular Thickness using targeted E738 conjugate (1 ⁇ mol/kg), subcutaneously dosed every-other-day to fracture-bearing Charles River's breed (CFW) of Swiss Webster mice.
- Targeted E738 conjugate significantly improved the bone density and trabecular thickness at the fracture callus.
- FIG. 3 depicts structures for Dasatinib and E738.
- FIG. 4 depicts structures for targeted conjugates of Dasatinib and E738.
- FIG. 5 depicts peak load of Fractured Femurs after 2 weeks.
- FIG. 6 depicts BV/TV two weeks after fractured femur received various concentration of Preptin D10 treatment.
- FIG. 7 depicts TbTh (the trabecular thickness of the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of Preptin D10 treatment.
- FIG. 8 depicts BV (the overall bone volume of the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of Preptin D10 treatment.
- FIG. 9 depicts BV/TV two weeks after fractured femur received various concentration of OGP D10.
- FIG. 10 depicts TbTh two weeks after fractured femur received various concentration of OGP D10.
- FIG. 11 depicts TbSp (the spacing between the trabecula in the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of OGP D10.
- FIG. 12 depicts BV/TV two weeks after fractured femur received various concentration of BFP D10.
- FIG. 13 depicts TbSp two weeks after fractured femur received various concentration of BFP D10.
- FIG. 14A depicts BV/TV four weeks after a fractured femur received various concentration of substance P4 mini peg D10 (P4 D10);
- FIG. 14B depicts the max load of substance P4 D10 four weeks after a fractured femur received the max load of substance P4 D10.
- FIG. 15 depicts BV/TV four weeks after fractured femur received various concentration of Ghrelin D10.
- FIG. 16 depicts BV four weeks after fractured femur received various concentration of pBMP9 D10.
- FIG. 17 depicts BV/TV four weeks after fractured femur received various concentration of pBMP9 D10.
- FIG. 18 depicts BV/TV four weeks after fractured femur received various concentration of CNP D10.
- FIG. 19 depicts BV/TV four weeks after fractured femur received 1 nmol/day of ODP D10.
- FIG. 20 depicts BV/TV three weeks after fractured femur received various concentrations of CBM D10 as compared to a fractured femur that received parathyroid hormone 1-34 (PTH).
- PTH parathyroid hormone 1-34
- FIG. 21 depicts BV/TV four weeks after fractured femur received various concentrations of P4 D10.
- FIG. 22 depicts BV four weeks after fractured femur received 1 nmol/day of P4 D10.
- FIG. 23 depicts BV/TV four weeks after fractured femur received various concentrations of MGF D10.
- FIG. 24 depicts BV/TV four weeks after fractured femur received various concentrations of TP508_D10.
- FIG. 25 depicts BV/TV four weeks after fractured femur received 1 nmol/day of VIP_D10.
- FIG. 26 depicts TbTh four weeks after fractured femur received 1 nmol/day of VIP_D10.
- FIG. 27 depicts the structure for BMP9 (SEQ ID NO: 14).
- FIG. 28 depicts the structure for Ghrelin D10 (SEQ ID NO: 15).
- FIG. 29 depicts the structure for Preptin D10 (SEQ ID NO: 3).
- FIG. 30 depicts the structure for CNP-D10 (SEQ ID NO: 16).
- FIG. 31 depicts the structure for VIP D10 (SEQ ID NO: 17).
- FIG. 32 depicts the structure for Substance P with 4 mini PEG conjugated to D10 (SEQ ID NO: 18).
- FIG. 33 depicts the structure for CBM D10 (SEQ ID NO: 9).
- FIG. 34 depicts the structure for ODP D10 (SEQ ID NO: 19).
- FIG. 35 structure of B2A_AHX3_e10 (SEQ ID NO: 27).
- FIG. 36 Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.
- FIG. 37 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.
- FIG. 38 Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.
- FIG. 39 Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10.
- FIG. 40 Structure of F2A_mp4_e10 (SEQ ID NO: 28).
- FIG. 41 Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10
- FIG. 42 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10.
- FIG. 43 Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10
- FIG. 44 Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10.
- FIG. 45 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.
- FIG. 46 Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.
- FIG. 47 Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.
- FIG. 48 Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb.
- FIG. 49 Structure of JNK3_mp4_e10 (SEQ ID NO: 21).
- FIG. 50 Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.
- FIG. 51 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.
- FIG. 52 Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.
- FIG. 53 Work to Fracture (mJ) after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10.
- FIG. 54 Structure of Lactoferrin_mp4_e10 (SEQ ID NO: 22).
- FIG. 55 Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.
- FIG. 56 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.
- FIG. 57 Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.
- FIG. 58 Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb.
- FIG. 59 Structure of Osteostatin_mp4_(D)E 10 (SEQ ID NO: 23).
- FIG. 60 TbTh measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E 10 .
- FIG. 61 Max Load(N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E 10 .
- FIG. 62 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E 10 .
- FIG. 63 Stiffness (N/mm) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E 10 .
- FIG. 64 Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E 10 .
- FIG. 65 Structure of P2A-mp4_e10 (SEQ ID NO: 29).
- FIG. 66 Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10
- FIG. 67 Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10.
- FIG. 68 Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10
- FIG. 69 Work to Fracture (mJ) after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10.
- FIG. 70 Structure of Preptin (1-34)_mp4_e10 (SEQ ID NO: 24).
- FIG. 71 Bone Volume/Total Volume measured after treatment with saline, or Preptin (1-34)_mp4_e10_50 ⁇ .
- FIG. 72 Bone Volume measured after treatment with saline, or Preptin (1-34)_mp4_e10_50 ⁇ .
- FIG. 73 Max Load (N) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50 ⁇ .
- FIG. 74 Post Yield Displacement (mm) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50 ⁇ .
- FIG. 75 Work to Fracture (mJ) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50 ⁇ .
- FIG. 76 Structure of QK_mp4_e10 (SEQ ID NO: 25).
- FIG. 77 Bone Volume measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.
- FIG. 78 Bone Volume/Total Volume measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.
- FIG. 79 Max Load (N) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.
- FIG. 80 Work to Fracture (mJ) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10.
- FIG. 81 depicts the structure for Annexin 1 (SEQ ID NO: 26).
- FIG. 82 Max Load (N) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of Annexin 1.
- FIG. 83 Work to Fracture (mJ) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of Annexin 1.
- FIG. 84 depicts the structure for F119 (SEQ ID NO: 20).
- SEQ ID NO: 1 bone forming peptide conjugated with 10 aspartate acids (BFP D10).
- SEQ ID NO: 2 osteogenic growth peptide conjugated with 10 aspartate acids (OGP D10).
- SEQ ID NO: 3 Preptin conjugated with 10 aspartate acids (Preptin D10).
- SEQ ID NO: 4 substance P with 4 mini PEG linker and conjugated with 10 aspartate acids (substance P 4 mini PEG D10).
- SEQ ID NO: 5 Ghrelin D10 with Ser-3 replaced with diaminopropinoic acid.
- SEQ ID NO: 7 C-type Natriuretic peptide (CNP) conjugated with 10 aspartate acids (CNP 10).
- SEQ ID NO: 8 Vasoactive intestinal peptide (VIP) conjugated with D10.
- SEQ ID NO: 9 collagen binding motif conjugated with 10 aspartate acids (CBM D10).
- SEQ ID NO: 10 P4 conjugated with 10 aspartate acids (P4 D10).
- SEQ ID NO: 11 Mechano-growth factor conjugated with 10 aspartate acids (MGF D10).
- SEQ ID NO: 12 Thrombin fragment TP508 conjugated with 10 aspartate acids (TP 508 D10).
- SEQ ID NO: 13 Osteopontin-derived peptide conjugated with 10 aspartate acids (ODP D10).
- SEQ ID NO: 14 BMP9 with 10 aspartate acids (BMP9).
- SEQ ID NO: 15 Ghrelin with 10 aspartate acids (Ghrelin D10).
- SEQ ID NO: 16 CNP with 10 aspartate acids (CNP-D10).
- SEQ ID NO: 17 VIP with 10 aspartate acids (VIP D10).
- SEQ ID NO: 18 4 mini PEG D10.
- SEQ ID NO: 19 ODP with 10 aspartate acids (ODPD10).
- SEQ ID NO: 20 F119 with 10 glutamic acids (F119).
- SEQ ID NO: 21 JNK with 10 glutamic acids (JNK3_mp4_e10).
- SEQ ID NO: 22 Lactoferrin with 10 glutamic acids (Lactoferrin_mp4_e10).
- SEQ ID NO: 23 Osteostatin with 10 glutamic acids (Osteostatin_mp4_(D)E 10 ).
- SEQ ID NO: 24 Preptin with 10 glutamic acids (Preptin (1-34)_mp4_e10).
- SEQ ID NO: 25 QK with 10 glutamic acids (QK_mp4_e10).
- SEQ ID NO: 26 Annexin 1 with 10 glutamic acids (Annexin 1).
- SEQ ID NO: 27 B2A with 10 glutamic acids (B2A_AHX3_e10).
- SEQ ID NO: 28 F2A with 10 glutamic acids (F2A_mp4_e10).
- SEQ ID NO: 29 P2A with 10 glutamic acids (P2A-mp4_e10).
- SEQ ID NO: 30 Targeting group consisting of a polypeptide, DDDDDDDD.
- SEQ ID NO: 31 Targeting group consisting of a polypeptide, EEEEEEEEEE.
- Bone fractures occur at an annual rate of 2.4 per 100 people and cost the US healthcare system approximately $28 billion per year. Of the 6.3 million bone fractures that occur annually in the US, 300,000 result in delayed union or non-union healing. Approximately 887,679 hospitalizations result each year from fractures. Over half (57%) of fractures resulting in hospitalizations occur in persons aged 65 and over. Estimated health care costs are indicated in Table 1, below.
- Fractured bones are not only an adverse consequence of combat, they also constitute a prominent repercussion of military training exercises.
- a female recruit will have a 3.4-21% chance of suffering a stress fracture, while a male recruit will have a 1-7.9% probability of experiencing the same injury.
- While such maladies may at first seem trivial, statistics reveal that they cost the military ⁇ $34,000 per soldier which totals up to ⁇ $100 million in aggregate per year.
- many affected recruits eventually leave the military as a consequence of their stress fracture, which results in further expenses arising from wasted recruiting and training efforts.
- Therapies for fractured bones both within and outside of the military rely almost exclusively on mechanical stabilization of the damaged bone (i.e.
- bone anabolic agents for example, both bone growth stimulating hormones and cytokines as well as various low molecular weight bone growth-inducing drugs, etc.
- fracture-targeted bone anabolic drugs met all initial requirements for advancement into large animal studies.
- the targeted conjugates were found to: i) reduce the time for fractured femur repair in mice by roughly half, ii) induce no detectable systemic toxicity at its effective dose, iii) cause no ectopic bone formation at either the injection site or elsewhere), iv) lead to regeneration of bone at the fracture site that was biomechanically stronger than the contralateral (unbroken) femur, and v) result in eventual remodeling of the fractured region into normal cortical bone.
- mice All in vivo data included herein are from Swiss Webster mice. All mice received an osteotomy on their right femur and received subcutaneous drug administration daily for either 2, 3 or 4 weeks, as indicated, for each compound. 1 ⁇ concentration represents 1 nmol/day, 10 ⁇ represents 10 nmol/day, 100 ⁇ represents 100 nmol/day most studies have an n of 5.
- conjugates sometimes written in the form of X-Y-Z, wherein each conjugate includes at least one moiety (X) that has the ability to effect bone growth, development, and/or healing, for example, anabolic agents, and a targeting moiety (Z) which has an affinity for bone and helps to direct the conjugate to bone.
- X moiety
- Z targeting moiety
- the X and Z portions are joined together by a linker region (Y).
- Targeting moieties many of which are explicit or implicit disclosed herein, have the potential to target bone anabolic agents to bone fractures, ostectomies, and osteotomy sites.
- the compounds described here are composed of molecules with high affinity towards hydroxyapatite and a bone anabolic agent. Although targeting has been exemplified primarily with acidic oligopeptides, all molecules with affinity towards hydroxyapatite could be attached to a bone anabolic agent to improve fracture repair. These molecules include but are not limited to ranelate, bisphosphonates, tetracyclines, polyphosphates, molecules with multiple carboxylic acids, calcium chelating molecules, metal chelators, acidic amino acid chains of either d or L chirality.
- Each of the previously listed targeting molecules can be single units, polymers, dendrimers or multiple units. Other molecules can also be substituted for the targeting agent. These include peptides, proteins and manmade molecules that intercalate, bind to, adsorb to, or hybridize with: collagen, the extracellular matrix, heparan sulfate, chondroitin sulfate, keratan sulfate, hyaluronic acid, elastin, fibronectin, laminin, proteoglycans, basement membrane, extracellular polymeric substances, integrins, blood clotting factors, fibrinogen, thrombin, fibrin, and other extracellular macromolecules, It is also possible to target using a combination of the listed targeting molecules.
- BV/TV means the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus.
- TbTh means the trabecular thickness of the 100 thickest micro CT slices of the fracture callus.
- BV means the overall bone volume of the 100 thickest micro CT slices of the fracture callus.
- TbSp means the spacing between the trabecula in the 100 thickest micro CT slices of the fracture callus.
- Peak Load means a postmortem 4 point bend of the healed femur. Peak load represents the maximum force the healed femur withstood before it refractured.
- D10 at the end of any name represents that the peptide is targeted to bone by a chain of 10 aspartic acids. D10 can be at the N-terminus or C-terminus of the specified peptide.
- E10 or “(D)E10” at the end of any name represents that the peptide is targeted to bone by a chain of 10 (D) glutamic acids.
- P4 means a fragment that represents the knuckle epitope in hBMP-2.
- BMPs corresponds to residues 73-92 of BMP-2 in which Cys-78, Cys-79, and Met-89 are changed to Serine (Ser), Ser, and Threonine (Thr).
- BMPs are well known regulators of bone and cartilage formation. BMPs bind as dimers to type I and type II Ser/Thr receptor kinases, forming an oligomeric complex that activates intracellular Smad proteins leading to their translocation into the nucleus where they serve as transcription factors to activate different OB differentiation markers (such as Runx2 (transcription factor for osteoblast differentiation)), leading to osteoblastogenesis. BMPs have also been shown to stimulate mesenchymal stem cells (MSC) differentiation to OBs by promoting recruitment of osteoprogenitor cells.
- MSC mesenchymal stem cells
- AHX in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of 6-(amino)hexanoic acid.
- AHX3 in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of (6-(amino)hexanoic acid) 3 .
- mp4 in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of 4 minipegs as known as 8-Amino-3,6-Dioxaoctanoic Acid.
- STB STB at the end of any name represents that the compound represents a chemically more stable version of its natural version.
- growth factors include but are not limited to the following: growth factors, fragments of growth factors, or synthetic peptides or small molecules that mimic the action of growth factors.
- growth factors include but are not limited to: transforming growth factors(alpha or beta), insulin, insulin-like growth factors, fibroblast growth factor (1-23), erythropoietin, epidermal growth factor, colony-stimulating factors (including macrophage colony-stimulating factor, granulocyte colony-stimulating factor, granulocyte macrophage colony-stimulating factor), bone morphogenetic proteins (BMP) (1-8a, 8b, 10, 11, 15), angiopoietin, vascular endothelial growth factor, megakaryocyte growth and development factor, adrenomedullin, autocrine motility factor, ciliary neurotrophic factor, leukemia inhibitory factor, interleukin(1-7), ephrins(A1-5, BMP) (1-8a, 8b, 10, 11, 15), angio
- Still other compounds which effect bone growth and may be used to practice aspects of the present disclosure include but are not limited to an angiogenic factor or a vasoactive compound that either stimulates angiogenesis or hematopoiesis, effects hematopoiesis, is released by or affects cells of a hematopoietic lineage, such as red blood cells, leukocytes, platelets, monocytes, or endothelial cells, or is a protein, peptide or other small molecule release in response to injury to blood vessel, or the full protein, peptide or fragments of such molecules or synthetic or small molecules that mimic their actions.
- a hematopoietic lineage such as red blood cells, leukocytes, platelets, monocytes, or endothelial cells
- a protein, peptide or other small molecule release in response to injury to blood vessel or the full protein, peptide or fragments of such molecules or synthetic or small molecules that mimic their actions.
- VEGF vascular endothelial growth factor
- QK vascular endothelial growth factor
- SPARC 113 adenosine-phosphate
- VIP lipid-proliferative protein
- PACAP PACAP
- Dobutamine dopamine
- isoprenaline endothelin 1, phenylphrine, adrenaline, terlipressin, Angeotensin II, Ace inhibitors, FGF2, PDGF, Angiopoietin, Hypoxia inducable factors, MMP2, metaloproteases, sokotrasterol sulfate, 0-sitosterol, oversulfated exopolysaccharide, IGF-1fumagillin, Vatanib, Axtinib, Placental growth factor, neuropilin, VE-cadherin, Alpha-v beta 3, afibercept, HIF1A, cediranib, Shingosinel-phosphate, 2 methoxyesterdiol
- BFP bone forming Peptide
- a fragment of immature BMP7 is a 15-amino acid peptide corresponding to residues 100-115 of the immature form of BMP-7 which like BMP2 is involved in osteogenic differentiation, proliferation, and formation of new bone. This short peptide also induces osteogenesis calcium content in MSCs.
- BMP-9 is also a potent regulator of osteogenesis and chondrogenesis and is a potent inducer of differentiation of osteoblasts.
- pBMP9 is a 23-residue peptide derived from residues 68-87 of the knuckle epitope of human BMP-9. The mechanism of action of this peptide is likely to involve the small mothers against decapentaplegic (Smad) pathway.
- Smad decapentaplegic
- Ghrelin is a 28-residue peptide hormone synthesized primarily by the gastric fundus in response to fasting, and acts as a ligand of the growth hormone secretagogue (GHS) receptor (GHSR) to promote growth hormone release from the pituitary.
- Ghrelin stimulation at the GHSR leads to the proliferation of osteoblasts and prevents the apoptosis of osteoblasts through mitogen-activated protein kinase/extracellular signal-regulated kinases (MAPK/ERK) and phosphoinositide 3-kinase/protein kinase B (PKB) (PI3K/AKT) pathways.
- MAPK/ERK mitogen-activated protein kinase/extracellular signal-regulated kinases
- PBB phosphoinositide 3-kinase/protein kinase B
- Ghrelin also stimulates osteoprotegerin (OPG) gene expression, which inhibits the coupling between the osteoclasts and osteoblasts, leading to reduced osteoblast-related osteoclast differentiation. Increased OPG also and decreases osteoclast activity. Ghrelin is only active when the Ser-3 is acylated with octanoic acid. Our construct contains a stabilized version of this where Ser-3 was replaced with diaminopropionic acid. The structure of Ghrelin D10 is depicted in FIG. 28 .
- Preptin is a 34-residue peptide hormone that is secreted by the ⁇ -cells of the pancreatic islets. This peptide corresponds to Asp-69 to Leu-102 of the E-peptide of proinsulin-like growth factor-II (pro-IGF-II).
- pro-IGF-II proinsulin-like growth factor-II
- Preptin's anabolic effects on bone are exerted through its ability to stimulating osteoblasts s proliferation, differentiation, and promoting their survival.
- Preptin's proliferative effect is predicted to be facilitated through a G-protein-coupled receptor triggering phosphorylation of p42/44 MAP kinases.
- Preptin D10 is depicted in FIG. 29 .
- CNP-D10 is a C-Type Natriuretic Peptide Targeted with D10
- CNP C-Type Natriuretic Peptide
- CNP contains 22 residues stabilized by an intramolecular disulfide linkage between Cys-6 and Cys-22 it functions as a local regulator of vascular tone, possibly due to its strong vasorelaxant properties.
- CNP also acts on the differentiation and proliferation of OBs, OCs, and chondrocytes via an autocrine/paracrine process through binding to the natriuretic peptide receptor B (NPR-B).
- NPR-B natriuretic peptide receptor B
- Endochondral ossification is another mechanism of bone formation affecting chondrocytes. It involves the conversion of an initial cartilage template into bone such as long bones and vertebrae.
- CNP has been shown to be an important anabolic regulator of endochondral ossification.
- the structure of CNP-D10 is depicted in FIG. 30 .
- VIP D10 is Vasoactive Intestinal Peptide Targeted with D10
- VPAC1 Vasoactive intestinal peptide
- VPAC2 Vasoactive intestinal peptide
- ALP alkaline phosphatase
- VIP also enhances osteoblast proliferation and mineralization through increased gap junction intercellular communication (GJIC) between osteoblasts. VIP also affects the differentiation of osteoclasts thus leading to an increase in bone resorption.
- GJIC gap junction intercellular communication
- Substance P is an 11-amino acid long pro-inflammatory neuropeptide belonging to the tachykinin family.
- Substance P improves mineralization of osteoblasts and the expression of osteogenic markers at late-stage bone formation, by activating neurokinin-1 receptor, a G-protein coupled receptor found in the central and peripheral nervous systems.
- substance P reduces osteoclastogenesis and bone resorption.
- Substance P upregulates the expressions of collagen type 1, ALP, Runx2 and osteocalcin in osteoblasts this effect involves the activation of Wnt/ ⁇ -catenin signaling pathway.
- Substance P promotes differentiation and migration capability of rat bone marrow MSCs and activates BMP-2 expression in osteoblasts.
- CBMD10 is the Collagen Binding Motif of Osteopontin Targeted by D10
- CBM collagen binding motif is the highly conserved 28-residue collagen binding motif (CBM) (residues 150-177) of human osteopontin.
- CBM extracellular matrix
- CBM enhances osteoblast differentiation of human MSC.
- CBM causes osteogenic differentiation of human bone marrow MSCs and increases mineralized of bone.
- CBM works in human MSCs by increasing extracellular Ca 2+ influx, which leads to the activation of CaMKII and the subsequent phosphorylation of ERK1/2, ultimately influencing OB differentiation.
- the structure of VIP D10 is depicted in FIG. 33 .
- Osteopontin-derived peptide a 15-residue peptide derived from rat osteopontin.
- ODP Osteopontin-derived peptide
- CBM Osteopontin-derived peptide
- ODP like CBM is a fragment of extracellular protein involved in the mineralization of collagen. ODP enhanced the differentiation and mineralization of MSCs. ODP improves the attachment via receptor mediated attachment and migration of osteoblasts and fibroblasts to the fracture site. ODP improves the proliferation and migration of osteoblasts. Though the signaling pathways are not completely elucidated for this molecule its believed that it works in a similar mechanism as CBM.
- the structure of ODP D10 is depicted in FIG. 34 .
- OGP-targeted Osteogenic growth peptide is composed of a 14-AA residue identical to the C-terminus of histone 4 conjugated to an acidic oligopeptide at the N-terminus. Systemic administration of free OGP has been shown to improve fracture repair by improving the mineralization of cartilaginous fracture callus.
- Targeted mechano growth factor (MGF) E peptide is a splice variant of insulin-like growth factor I (IGF-I) with a targeting acidic oligopeptide on the N terminus.
- IGF-I insulin-like growth factor I
- MGF causes osteoblast proliferation through the MAPK-ERK signaling pathway.
- Local injections (57 ug/kg) in rabbit bone defects 5 mm demonstrated accelerated healing through osteoblast proliferation.
- Targeted TP-508 is a prothrombin peptide that has been modified on the N-terminus with an acidic oligopeptide.
- the anabolic portion of TP-508 has been used in clinical trials for repairing foot ulcers.
- Free TP-508 has a proliferative effect on osteoblasts. Local injections have demonstrated accelerated fracture repair in older rats.
- B2A is a synthetic, multidomain peptide with two 19 amino acid branches derived from the region which is similar to the TGF-P/BMP-binding region of fetuin, a member of the cystatin family of protease inhibitors.
- the 19 amino acid branch acts as a BMP receptor ligand.
- BMP receptor activation is well known to osteogenic as BMP2 is currently approved to treat bone fractures.
- existing strategies rely on the use of a full recombinant human protein.
- B2A is a dimer peptide that achieves similar levels of BMP receptor activation with a much mass.
- Bone morphogenetic protein receptor (BMPR) activation is canonically associated with activation of the small mothers against decapentaplegic (Smads) pathway
- BMPR ligands can, activate non smad signaling via p38, extracellular signal-regulated kinases 1 and 2 (ERK1/2), stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK), and protein kinase B (Akt/PKB).
- ERK1/2 extracellular signal-regulated kinases 1 and 2
- SAPK/JNK stress-activated protein kinase/c-Jun N-terminal kinase
- Akt/PKB protein kinase B
- non smad signaling is key in cell survival, nutution and metabolism and migration.
- B2A has the ability to bind both type I and II receptors for BMP. In the presence of BMP-2, B2A augments osteo-differentiation.
- B2A-induced proliferation In the absence of BMP-2, B2A-induced proliferation, aggrecan synthesis, and collagen accumulation in mesenchymal stem cells.
- B2A-induced proliferation In the absence of BMP-2, B2A-induced proliferation, aggrecan synthesis, and collagen accumulation in mesenchymal stem cells.
- the osteogenic signal that locally applied BMP2 can be specifically localize to allow a much smaller much less invasive to apply form.
- the structure of B2A is depicted in FIG. 35 .
- F2A_mp4_e10 is made up of two copies of the fibroblast growth factor (FGF) receptor targeting sequence from FGF2 branching from a single lysine then 4 minipegs to act a linker and spacer and 10 D glutamic acids to target to the bone.
- F2A's receptor targeting sequence is YRSRKYSSWYVALKR derived from derived from native FGF-2 (residues from 106 to 120). It has been shown to be nearly as potent as the full native protein at stimulating angiogenesis and osteogenesis in its dimer form.
- FGF2 is an anabolic growth factor heavily involved in wound healing and tissue repair. It Is both angiogenic and osteogenic.
- Fgf2 has shown promise as a protein treatment for wound healing.
- the advantage of F2A e10 is its small size allows for better perfusion and the e10 allows it to chemically home to the damaged tissue site from a noninvasive injection at a distal site.
- the structure of F2A
- F119 is a heparin binding fragment from growth factor fibroblast growth factor 2.
- Fibroblast growth factor (FGF)-2 regulates a variety of cellular functions, such as proliferation and differentiation, by binding to cell surface FGF receptors (FGFRs) in the presence of heparin proteoglycans F119 a heprerin binding site for fgf2 which corresponds to 119-135 of fgf2 (F119, KRTGQYKLGSKTGPGQK).
- F119 interacts with cell-surface heparan sulfate proteoglycans.
- osteoblast differentiation confirmed by ALPase activity and mineralization, is increased by F119.
- the structure of F119 is depicted in FIG. 84 .
- JNK3 c-Jun NH2-terminal Protein Kinases
- JNKs The c-Jun NH2-terminal protein kinases (JNKs) belong to the MAPK family. JNKs regulate normal physiological processes of cell proliferation, apoptosis, differentiation, and migration7. JNKs were also implicated in many diseases, from cancer to neurological and immunological disorders recently they were implicated as one of reasons adults bones don't have the same response to mechanical stimuli. It was found that increasing JNK3 activity stimulated more responsiveness to osteoinductive activity Arrestin-3 facilitates INK activation in cells, and a short 25-residue arrestin-3 peptide was identified as the critical JNK3-binding element 2 .
- JNK3 also binds mitogen-activated protein kinase 4 (MKK4), MKK7, and apoptosis signal-regulating kinase 1 (ASK1), which are upstream JNK3-activating kinases.
- MKK4 mitogen-activated protein kinase 4
- ASK1 apoptosis signal-regulating kinase 1
- Lactoferrin is an iron-binding glycoprotein that belongs to the transferrin family. It is present in breast milk, in epithelial secretions, and in the secondary granules of neutrophils. In healthy subjects lactoferrin circulates at concentrations of 2-7 ⁇ 10-6 g/ml. Lactoferrin is a pleiotropic factor with potent antimicrobial and immunomodulatory activities. It has shown that lactoferrin can also promote bone growth. Lactoferrin is stimulatory towards osteoblasts and prevents osteoclastogensis.
- lactoferrins interactions with osteoblast like cells is primarily through LRP1, a member of the family of low-density lipoprotein receptor-related proteins that are primarily known as endocytic receptors. Lactoferrin also induces activation of p42/44 MAPK signaling in primary osteoblasts, but the two pathways seem to operate independently as activation of MAPK signaling, but not endocytosis, is necessary for the mitogenic effect of lactoferrin. Lactoferrin is too large to act as a good therapeutic. But several active fragments of lactoferrin have been identified. Lactoferricin which is a loop region from the n terminus of Lactoferrin has been shown to have both antimicrobial and osteogenic effects.
- Osteostatin is a fragment of Parathyroid hormone related protein(PTHrP) that has been reported to be more anabolic than 1-34 of PTHrP.
- PTHrP is anabolic on bone both because of an inhibitory effect on osteoclast but mostly a stimulatory effect on osteoblasts. Some of its effect is believed to function like PTHrP though WNT signaling and also through interactions with the vascular endothelial growth factor (VEGF) receptor to increase survival of osteoblasts.
- VEGF vascular endothelial growth factor
- P2A Platinum-Derived Growth Factor (PDGF)
- Platelet-derived growth factors are mitogens for many cells primary of mesenchymal origin and their involvement in wound healing has lead to the therapeutic use of recombinant human PDGF-BB, one of PDGF family.
- PDGF are released by plates at the site of fractures are chemotactic and mitogenic for osteoblast lineage cells and osteoblasts and therefore may enhance fracture healing by attracting osteoprogenitor cells to the fracture by chemotaxis and amplifying their quantity by mitogenesis.
- PDGF-3B upregulates the expression of angiogenic vascular endothelial growth factor (VEGF), a key molecule for bone regeneration.
- VEGF-BB vascular endothelial growth factor
- Arg160, Lys161 and Lys162 in PDGF-BB are required for mitogenic activity and high-affinity receptor. It was shown that a chain containing a branched dimer of VRKIEIVRKK derived from residues 153-162 of PDGF-BB was almost as active as the full PDGF-BB.
- the targeted construct of the present disclosure consists of that cyclized branched dimer of VRKIEIVRKK derived from residues 153-162 of PDGF-BB, with a 4 minipeg spacer and 10 (D) glutamic acid to localize it to the site of the fracture.
- the structure of P2A is depicted in FIG. 65 .
- Preptin is a 34-residue peptide hormone that is secreted by the ⁇ -cells of the pancreatic islets. This peptide corresponds to Asp-69 to Leu-102 of the E-peptide of proinsulin-like growth factor-II (pro-IGF-II).
- pro-IGF-II proinsulin-like growth factor-II
- Preptin's anabolic effects on bone are exerted through its ability to stimulating osteoblasts s proliferation, differentiation, and promoting their survival.
- Preptin's proliferative effect is predicted to be facilitated through a G-protein-coupled receptor triggering phosphorylation of p42/44 MAP kinases.
- Preptin's anabolic effects are believed to be due to it stimulating an increase in a known bone anabolic connective tissue growth factor. While the native peptide effects glucose metabolism the first 16 amino acids are important for its anabolic effects and have no effects on glucose metabolism.
- the structure of Preptin(1-34) is depicted in FIG. 70 .
- VEGF Vascular Endothelial Growth Factor
- VEGF vascular endothelial growth factor
- This mimetic is a 15 amino acid peptide which adopts a very stable helical conformation in aqueous solution that resembles the 17-25 ⁇ -helical region of VEGF165, and binds both VEGFR-1 and 2.
- QK recapitulates all of VEGFs properties of angiogenesis, vasodilation and most importantly wound healing. It is well established that VEGF improves the spread at which a wound heals. The quicker the blood supply is returned to normal the faster the body can repair itself. Full VEGF is difficult to control and use as drug to treat internal damage. But the targeted construct of the present disclosure takes the power of QK and homes it just to the damage site to control the site of angiogenesis to jus the desired region.
- the construct of the present disclosure is made up of the bone targeting ligand of the present disclosure attached to a mini-peg spacer and then to QK on its N terminus. The structure of QK is depicted in FIG. 76 .
- Annexin-1 is a family of phospholipid-binding proteins found in many tissues including bone marrow.363
- the N-terminal fragment of annexin-1, Anx (2-26) is an endogenous ligand agonist of FPR1.
- Anx (2-26) promotes chemotactic migration and OB differentiation of MSCs via FPR1.
- the N-formyl peptide receptor (FPR) is a chemoattractant receptor belonging to the G-protein coupled receptor family. It is expressed in human bone marrow derived MSCs and is functionally involved in promoting MSC adhesion to extracellular matrix protein-coated surfaces as well as migration to sites of fracture for tissue regeneration.
- the structure of Annexin-1 is depicted in FIG. 81 .
- the conjugates of the present disclosure are synthesized using the following synthesis.
- Wang resin (0.39 mmol/g) was loaded at 0.39 mmol/g with the first amino acid overnight in dichloromethane (DCM) and diisopropyl ethyl amine (DIPEA). The resin was then capped with acetic anhydride and pyridine for 30 minutes, followed by three washes of DCM and dimethylformamide (DMF), respectively. Following each amino acid coupling reaction, fluoroenylmethyloxycarbonyl (Fmoc)-groups were removed by three 10 minute incubations with 20% (v/v) piperidine in DMF.
- DCM dichloromethane
- DIPEA diisopropyl ethyl amine
- the resin was filtered and washed 3 times with DMF, 2 times with 2% ascorbic acid in DMF, 5 times with DMF, and 3 times with dichloromethane (DCM). Then, proceeded with normal n terminal fmoc deprotection and cleavage from the resin with normal cleavage solution with no TCEP added to preserve the disulfide bond.
- the peptides were then as all peptides purified using reverse phase chromatography on an HPLC using a 0-50% 20 mM ammonium acetate:acetonitrile gradient. The product was then identified from the appropriate fraction using LCMS and lyophilized to recover it from the water:acetonitrile mixture. All compounds were dissolved in sterile phosphate buffered saline (PBS) at the appropriate dose concentrations for drug delivery.
- PBS sterile phosphate buffered saline
- the targeted conjugates were synthesized using standard Fmoc solid-phase peptide synthesis, as described above.
- mouse pre osteoblast (MCTC3-E1) cells were treated with the targeted and untargeted compounds for three days at concentrations from 1 pM to 100 nM. After three days of treatment, the cells were harvested, and the ribonucleic acid (RNA) was purified from the cells.
- RNA ribonucleic acid
- Expression levels of ALP, RUNx2, OSX, osteopontin (OPN), collagen 1A (Col-1A), OPG, RANKL, sclerostin gene (SOST), and OC were quantified via quantitative reverse transcription polymerase chain reaction (RT-qPCR).
- TbTh Trabecular thickness
- TbSp trabecular spacing
- TV total volume
- BV volume of calcified callus
- Example 1 shows representative Src kinase inhibitors Dasatinib and E738 (structures shown in FIGS. 3-4 respectively) effectively increased the bone density of the fracture callus when they are conjugated with acidic aspartic acids. See FIGS. 1-2 , where bone density of the fracture callus from the targeted Dasatinib group is twice as dense as the saline group, and 50% denser than the free Dasatinib group; targeted E738 conjugate has significantly improved the bone density and trabecular thickness at the fracture callus.
- the structure of CBMD10 is depicted in FIG. 33 .
- Example 2 provides the maximum force a representative anabolic peptide induced healed femur can withstand before it refractured.
- bone morphogenetic protein pathway signaling peptide BFP-D10 with 100 nmol/day (100 ⁇ ) treatment obtained the maximum peak load, followed by IGF derived peptide of Preptin-D10 100 ⁇ , and Osteogenic growth peptide (OGP-D10 100 ⁇ ), as compared to PBS.
- Example 3 indicates Preptin D10 effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1 ⁇ , 10 ⁇ and 100 ⁇ respectively).
- the healing was reflected as BV/TV in FIG. 6 , TbTh in FIG. 7 and bone volume in FIG. 8 , all in a dose dependent manner.
- Example 4 indicates osteogenic growth peptide conjugate (OGP-D10) effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, and 100 nmol/day, referred as 1 ⁇ , and 100 ⁇ respectively).
- the healing was reflected as BV/TV in FIG. 9 , TbTh in FIG. 10 and TbSp in FIG. 11 , all in a dose dependent manner.
- Example 5 indicates bone forming peptide conjugate (BMP-D10) effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1 ⁇ , 10 ⁇ and 100 ⁇ respectively).
- the healing was reflected as BV/TV in FIG. 12 , and TbSp in FIG. 13 in a dose dependent manner.
- Example 6 indicates substance P D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1 ⁇ , 10 ⁇ and 100 ⁇ respectively).
- the healing was reflected as BV/TV in FIG. 14A in dose dependent manner.
- FIG. 14B indicates the peak load of substance P D10 10 ⁇ induced healed femur can withstand between 30-35 Newtons force.
- Example 7 indicates Ghrelin-D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day, 10 nmol/day and 100 nmol/day, referred as 1 ⁇ , 10 ⁇ and 100 ⁇ respectively). The healing was reflected as BV/TV in FIG. 15 in dose dependent manner.
- Example 8 indicates pBMP9 D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1 ⁇ , 10 ⁇ and 100 ⁇ respectively).
- the healing was reflected as bone volume in FIG. 16 and BV/TV in FIG. 17 in a dose dependent manner.
- Example 9 indicates C-Type Natriuretic Peptide conjugate (CNP D10) effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day and 10 nmol/day referred as 1 ⁇ and 10 ⁇ respectively). The healing was reflected as BV/TV in FIG. 18 in a dose dependent manner.
- CNP D10 C-Type Natriuretic Peptide conjugate
- Example 10 indicates osteopontin derived peptide conjugate ODP D10 effect on healing fractured bone after 4 weeks of 1 nmol/day (referred as 1 ⁇ ). The healing was reflected as BV/TV in FIG. 19 .
- Example 11 indicates collagen binding motif of osteopontin conjugate CBM D10 effect on healing fractured bone after 3 weeks of various concentrations application (0.1 nmol/day, 1 nmol/day and 10 nmol/day, referred as 0.1 ⁇ , 1 ⁇ and 10 ⁇ respectively).
- the healing was reflected as BV/TV in FIG. 20 in a dose dependent manner. It is worth noting that the lowest does of CBM D10 has the similar effect of free PTH, an anabolic drug without specific bone targeting.
- Example 12 indicates P4 D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day and 10 nmol/day, referred as 1 ⁇ and 10 ⁇ respectively). The healing was reflected as BV/TV in FIG. 21 in a dose dependent manner and bone volume in FIG. 22 .
- Example 13 indicates mechano growth factor conjugate (MGF D10) effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day and 10 nmol/day, referred as 1 ⁇ and 10 ⁇ respectively). The healing was reflected as BV/TV in FIG. 23 in a dose dependent manner.
- MEF D10 mechano growth factor conjugate
- Example 14 indicates thrombin fragment TP508 conjugate TP508 D10 effect on healing fracture after 4 weeks of various concentrations application (1 nmol/day and 10 nmol/day, referred as 1 ⁇ and 10 ⁇ respectively). The healing was reflected as BV/TV in FIG. 24 in a dose dependent manner.
- Example 15 indicates vasoactive intestinal peptide conjugate VIP D10 effect on healing fracture after 4 weeks of 1 nmol/day application (1 ⁇ ). The healing was reflected as BV/TV in FIG. 25 and TbTh in FIG. 26 .
- Example 16 indicates B2A (D)E 10 effect on fracture healing.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair.
- 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection.
- B2A_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E 10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- Example 17 indicates F2A (D)E 10 effect on fracture healing.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair.
- 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection.
- F2A_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E 10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E 10 conjugate raises bone strength at the fracture calluses three weeks post fracture.
- Example 18 indicates F119 effect on fracture healing.
- BV/TV represents the bone volume of the total volume of 100 thickest micro CT slices of the fracture callus and is a measure of bone density at the site of fracture repair. 1 ⁇ , lx and 100 ⁇ are respectively 1 nmol, 10 nmol, and 100 nmol of the conjugate delivered daily by subcutaneous injection.
- F119_mp4_(D)E 10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 ⁇ , 10 ⁇ and 100 ⁇ are respectively 1 nmol, 10 nmol, and 100 nmol of the conjugate delivered daily by subcutaneous injection. F119_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.
- Example 19 indicates JNK3 effect on fracture healing.
- JNK3_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E 10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E 10 conjugate raises bone strength at the fracture calluses three weeks post fracture.
- JNK3_mp4_(D)E 10 conjugate raises bone strength at the fracture calluses three weeks post fracture.
- Example 20 indicates Lactoferrin effect on fracture healing.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- Example 21 indicates Osteostatin effect of fracture healing.
- Tbth represents the trabecular thickness of the 100 thickest micro CT slices of the fracture callus and is a measure the quality of the bone at the site of fracture repair.
- 0.1 ⁇ , 1 ⁇ and 10 ⁇ are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection.
- the of Osteostatin_mp4_(D)E 10 conjugate raises bone quality at the fracture calluses three weeks post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair.
- 0.1 ⁇ , 1 ⁇ and 10 ⁇ are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection.
- Osteostatin_mp4_(D)E 10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- Stiffness represents the Youngs modulus of the healed femur as it was measured before it refractured in a postmortem 4 point bend analysis. Peak load is a measure of how stiff the bone is at the site of fracture repair.
- 0.1 ⁇ , 1 ⁇ and 10 ⁇ are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection.
- the of Osteostatin_mp4_(D)E 10 conjugate raises bone stiffness at the fracture calluses three weeks post fracture.
- Example 22 indicates P2A effect on fracture healing.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair.
- 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection.
- P2A_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair.
- 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection.
- P2A_mp4_(D)E 10 conjugate raises bone density at the fracture calluses three weeks post fracture.
- Example 23 indicates Preptin (1-34) effect on fracture healing.
- BV/TV represents the bone volume of the total volume of 100 thickest micro CT slices of the fracture callus and is a measure of bone density at the site of fracture repair.
- 50 ⁇ represents 50 nmol of the conjugate delivered daily by subcutaneous injection.
- Preptin(1-34)_mp4_(D)E 10 conjugate significantly raises bone density at the fracture calluses four weeks post fracture.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair 50 ⁇ represents 50 nmol of the conjugate delivered daily by subcutaneous injection.
- Preptin(1-34) mp4_(D)E 10 conjugate significantly raises bone mineralization at the fracture calluses four weeks post fracture.
- Post yield displacement represents the total displacement of the healed femur after the yield point has been reached in a postmortem 4 point bend analysis
- Post yield displacement is a measure of how elastic a material is.
- 50 ⁇ represents 50 nmol of the conjugate delivered daily by subcutaneous injection.
- Preptin(1-34)_mp4_(D)E 10 conjugate significantly reduces the bone brittleness at the fracture calluses four weeks post fracture.
- Example 24 indicates QK effect on fracture healing.
- BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection.
- QK_mp4_(D)E 10 conjugate raises bone mineralization at the fracture calluses 17 days post fracture.
- BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E 10 conjugate raises bone density at the fracture calluses 17 days post fracture.
- Example 22 indicates Annexin-1 effect on fracture healing.
- Max load represents the maximum force the healed femur withstood before it refractured in a postmortem 4 point bend analysis. Max load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection.
- Annexin_mp4_(D)E 10 conjugate raises bone strength at the fracture calluses three weeks post fracture.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Toxicology (AREA)
- Wood Science & Technology (AREA)
- Biomedical Technology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Endocrinology (AREA)
- Diabetes (AREA)
- Immunology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
- This application claims priority to U.S. Provisional Patent Application No. 62/678,016, filed on May 30, 2018. This application is incorporated herein by reference in its entirety for all purposes.
- Aspects of the present disclosure relate to the materials and methods for treating bone fractures and bone defects.
- Src tyrosine kinase plays a crucial role in bone metabolism: despite its ubiquitous expression profile, the only apparent phenotypical abnormality in a Sarcoma-knockout (Src-KO) mouse strain was osteopetrosis. Although Src inhibitors inhibit both the formation and activity of osteoblasts (OBs) in vitro, the number of osteoclasts (OCs) derived from Src-KO mice were actually elevated in Src-KO mice, measuring more than twice that in wild-type (WT) mice. Also, a marked increase in both osteoblast number and activity was observed in vivo in Src-KO mice. These results confirm that the osteopetrosis phenotype of Src-KO mice was not a result of reduced osteoclast formation, but rather of boosted osteoblast activity as well as reduced osteoclast function. Moreover, osteoblasts derived from Src-KO mice demonstrated unremarkable morphological features compared to those harvested from WT mice, and were able to fully regulate normal osteoclast differentiation via the receptor activator of nuclear factor kappa-B ligand/receptor activator of nuclear factor kappa-B/osteoprotegerin (RANKL/RANK/OPG) pathway. Thus, this bone-resorption defect should be easily alleviated by restoring normal Src functionality in osteoclasts, reducing potential risks on the musculoskeletal system involved in long-term use of Src inhibitors for fracture healing.
- Broadly, peptide anabolic drugs include different categories of protein or the fragments thereof. They are represented by bone morphogenetic protein pathway signaling peptides including P4, bone forming peptide (BFP) and peptide from Bone morphogenetic protein 9 (pBMP9); insulin-like growth factor (IGF) derived peptides including mechano-growth factor (MGF) and Preptin; bone stimulatory neuropeptides including Substance P and vasoactive intestinal peptide (VIP); and peptides enhancing vascular functions, including C-type Natriuretic peptide (CNP), thrombin fragment or targeted prothrombin peptide (TP508) and VIP. Each of these peptides may have its own unique mechanism working to regulate bone growth, as will be outlined in the detailed description.
- Current clinical treatment of fractures generally does not include the use of site-specific anabolic drugs. In fact, the only drugs approved for clinical use on such fractures are bone morphogenic protein (BMP)-2 (approved for use only in tibial trauma) and BMP-7 (discontinued), which are applied locally and generally used in the treatment of open long bone fractures and spinal fusions. The need for broader application of anabolic drugs to treat bone maladies such as osteoporotic fractures with efficacy is evident.
- Therefore, it is desirable to have a fracture treatment drug that is administered systemically yet targets the fracture site with evident efficacy.
- A first aspect of the present disclosure includes at least one compound of the formula X-Y-Z, or a pharmaceutically acceptable salt thereof, or a metabolite thereof, wherein X is at least one agent that improves bone density, mechanical strength, bone deposition, or quality; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z. In some aspects, X is at least one agent that enhances the activity or one agent that improves bone density, mechanical strength, bone deposition or otherwise promotes bone healing and/or growth. Consistent with some of these aspects, Z is at least one negatively charged oligopeptide or an equivalent thereof that binds to hydroxyapatite and/or raw bone.
- The second aspect includes the compound according to the first aspect, wherein when X is a polypeptide, any polypeptide having at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and/or 100% identity to X can be used to practice the invention.
- In some aspects, Y is at least one polypeptide comprising at least about 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and/or 100% sequence identity to amino acid residues 35-40, 35-41, 35-42, 35-43, 35-44, 35-45, 35-46, 35-47, 35-48, 35-49, 35-50, 35-51, 35-52, 35-55, 35-84, 41-44, 41-45, 41-46, 41-47, 41-48, 41-49, 41-50, and/or 41-84 of a full length parathyroid hormone related peptide or parathyroid hormone, and/or at least one Cathepsin K sensitive polypeptide.
- In some aspects, Z is at least one polypeptide comprising about 4 or more, from about 4 to about 100, from about 4 to about 50, from 4 to about 20, from about 4 to about 15, from about 4 to about 10 acidic amino acid residues, polyphosphate, 2-aminohexanedioic (aminoadipic) acid or derivatives thereof, and/or alendronate or derivatives thereof. In some aspects, Z is at least one polypeptide comprising about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, and/or 30 acidic amino acid residues, polyphosphate, 2-aminohexanedioic acid or derivatives thereof, and/or alendronate or derivatives thereof. In some aspects, Z is at least one negatively charged oligopeptide or an equivalent thereof that binds to hydroxyapatite and/or raw bone.
- The targeted delivery strategy recited in some aspects of the invention enable the delivery of Src inhibitors specifically to bone fracture surfaces thereby facilitating fracture healing. This in vivo efficacy is shown by the acceleration of fracture healing observed using the Src inhibitors Dasatinib and E738.
- In addition to Src inhibitors, a group of peptides targeted specifically to the fracture surfaces also demonstrates an enhanced ability to facilitate fracture healing. These peptides include osteopontin derived fragments such as osteopontin-derived peptide (ODP), collagen binding motif (CBM); BMP fragments such as P4, BFP, pBMP7; IGF fragments such as MGF and Preptin; neuropeptides such as Substance P and VIP; Vasoconstrictive fragments such as CNP, TP508 and VIP; and other anabolic drugs such as osteogenic growth peptide (OGP).
- The in vivo efficacy of these peptides for accelerated fracture healing are demonstrated herein. All peptide conjugates are produced by solid phase synthesis.
- Some aspects of this disclosure include compounds comprising: a compound of the formula X-Y-Z, wherein X is at least one agent that modulates bone growth, such as activity of Src tyrosine kinase; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof. In some aspects, Z is at least one polypeptide comprising 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and/or 20 acidic amino acid residues. In some aspects, X is selected from the group consisting of Dasatinib and E738. In some aspects, Y is a releasable linker selected from disulfide; ester; or protease specific amide bond. In some aspects, Y is a nonreleasable bond selected from carbon-carbon bond; or amide bond.
- In some aspects, this disclosure includes a compound of the formula X-Y-Z, wherein X is at least one peptide or a fragment thereof that modulates activity of bone and cartilage formation; Z is at least one bone-targeting molecule; and Y is a linker that joins and/or links X and Z; or a pharmaceutically acceptable salt thereof, or a metabolite thereof. In some aspects, Y is a releasable linker selected from disulfide; ester; or protease specific amide bond. In some aspects, Y is a nonreleasable bond selected from carbon-carbon bond; or amide bond. In some aspects, Y is a peptide belonging to the natural sequence of Z. In some aspects, Y is a polyethylene glycol (PEG) linker. In some aspects Y is a PEG linker comprised of 2-8 oxyethylene units. In some aspects, Z comprises at least 10 aspartic or glutamic acids conjugated to X. In some aspects, Z comprises at least 20 aspartic or glutamic acids conjugated to X. In some aspects, the compound may be produced by solid phase synthesis.
- In some aspects, X is a bone anabolic peptide derived from BMP. In some aspects, X is a bone anabolic peptide derived from IGF. In some aspects, X is a bone anabolic peptide derived from a neuropeptide. In some aspects, X is a bone anabolic peptide that improves vascular function and/or vascularization. In some aspects, X is osteogenic growth peptide (OGP). In some aspects, the peptide is BFP, P4, or pBMP9. In some aspects, the peptide is MGF or Preptin. In some aspects, the peptide is Substance P or VIP. In some aspects, the peptide is TP508, VIP, or CNP. Unless indicated otherwise, the invention may be practiced by combining any X with any Z and optionally any suitable linking group Y.
-
- 1. A compound comprising:
- a compound of the formula X-Y-Z, wherein
- X is at least one agent that modulates activity selected from the group consisting of: Bone Morphogenic Protein(s) (BMP), Insulin Like Growth Factors (IGF), fibroblast growth factors, peptide, hormones, hormone releasing agents, lactoferrin, Ghrelin, c-Jun N-
terminal kinase 3 agonists (JNK3 agonists), vasoactive peptide(s), any growth factor, and any active portion of any growth factor; - Z is at least one bone-targeting molecule; and
- Y is an optional linker that joins and/or links X and Z;
- or a pharmaceutically acceptable salt thereof, or a metabolite thereof.
- 2. The compound according to
claim 1, wherein- Z is at least one polypeptide comprising 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 and/or 20 acidic amino acid residues.
- 3. The compound according to claims, 1-2 wherein Z includes multiple aspartates and/or multiple glutamates.
- 4. The compound according to
claim 3, wherein Z is comprised of at least one polypeptide selected from the group consisting of: at least 5 aspartic acids, at least 5 glutamic acids, at least 10 aspartic acids, at least 10 glutamic acids, at least 20 aspartic acids, at least 20 glutamic acids. - 5. The compounds according to claims 1-4, wherein Z is selected from the group consisting of: a polypeptide comprising 10 aspartic acid residues (SEQ ID NO. 23) and a polypeptide comprising 10 glutamic acid residues (SEQ ID NO. 24).
- 6. The compound according to claims 1-4, wherein Z is selected from the group consisting of: 4 or more acidic amino acid residues, polyphosphate, aminohexanedioic acid or derivatives thereof, and/or alendronate or derivatives thereof.
- 7. The compound according to claims 1-6, wherein Y is selected from the group consisting of: releasable linkers and non-releasable linkers.
- 8. The compound according to
claim 7, wherein the releasable linker includes at least one of the following groups: a disulphide, an ester, or a Protease specific amide bond. - 9. The compound according to
claim 7, the non-releasable linker includes at least one of the following groups; a carbon-carbon bond, or an amide. - 10. The compound according to claims 1-6, wherein Y is polyethylene glycol (PEG).
- 11. The compound according to
claim 10, wherein the PEG linker is comprised of 2-8 oxyethylene units. - 12. The compound according to claims 1-6, wherein Y is a peptide belonging to the natural sequence of Z.
- 13. The compound according to claims, 1-9, wherein the BMP is at least one compound selected from the group consisting of: P4 (BMP2), BFP (BMP7), pBMP9 (BMP9), and B2A (BMP2/TGF beta).
- 14. The compound according to claims, 1-9, wherein the Insulin Like Growth Factor is at least one compound selected from the group consisting of: Preptin (IGF-II), and Mechano Growth Factor (MGF) (IGF-1).
- 15. The compound according to claims, 1-9, wherein the Fibroblast Growth Factor, is at least one compound selected from the group consisting of: Fibroblast Growth Factor 2 (F119) and F2A.
- 16. The compound according to claims, 1-9, wherein the Osteogenic peptide is histone h4.
- 17. The compound according to claims, 1-9, wherein X is selected from the group consisting of: parathyroid hormone-related protein (PTHrP) [107-139], and Osteogenic peptide.
- 18. The compound according to claims, 1-9, wherein the JNK3 agonist is, JNK3, or
Annexin 1. - 19. The compound according to claims, 1-9, wherein the Vasoactive peptide is at least one compound selected from the group consisting of: C-Type Natriuretic peptide (CNP), Thrombin peptide (TP508), VEGF mimetic (QK) and platelet derived growth factor 2A (P2A).
- 20. Use of a compound according to any of claims 1-19, for the manufacture of a medicament for therapeutic application.
- 21. A method of treating a patient, comprising the step of administering at least one dose of a compound according to claims 1-9.
- 1. A compound comprising:
- These and other features, aspects and advantages of the present disclosure will become better understood with reference to the following figures, associated descriptions and claims.
-
FIG. 1 depicts the bone volume divided by total volume of the 100 thickest micro computed tomography (CT) slices of the fracture callus bone density (“BV/TV”) using a Dasatinib and targeted Dasatinib conjugate (both 10 μmol/kg). Both were subcutaneously dosed daily to fracture-bearing Notre Dame breed (ND4) of Swiss Webster mice. Bone density of the fracture callus from the targeted Dasatinib group is twice as dense as the saline group, and 50% denser than the free Dasatinib group. -
FIG. 2 depicts BV/TV and Trabecular Thickness using targeted E738 conjugate (1 μmol/kg), subcutaneously dosed every-other-day to fracture-bearing Charles River's breed (CFW) of Swiss Webster mice. Targeted E738 conjugate significantly improved the bone density and trabecular thickness at the fracture callus. -
FIG. 3 depicts structures for Dasatinib and E738. -
FIG. 4 depicts structures for targeted conjugates of Dasatinib and E738. -
FIG. 5 depicts peak load of Fractured Femurs after 2 weeks. -
FIG. 6 depicts BV/TV two weeks after fractured femur received various concentration of Preptin D10 treatment. -
FIG. 7 depicts TbTh (the trabecular thickness of the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of Preptin D10 treatment. -
FIG. 8 depicts BV (the overall bone volume of the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of Preptin D10 treatment. -
FIG. 9 depicts BV/TV two weeks after fractured femur received various concentration of OGP D10. -
FIG. 10 depicts TbTh two weeks after fractured femur received various concentration of OGP D10. -
FIG. 11 depicts TbSp (the spacing between the trabecula in the 100 thickest micro CT slices of the fracture callus) two weeks after fractured femur received various concentration of OGP D10. -
FIG. 12 depicts BV/TV two weeks after fractured femur received various concentration of BFP D10. -
FIG. 13 depicts TbSp two weeks after fractured femur received various concentration of BFP D10. -
FIG. 14A depicts BV/TV four weeks after a fractured femur received various concentration of substance P4 mini peg D10 (P4 D10);FIG. 14B depicts the max load of substance P4 D10 four weeks after a fractured femur received the max load of substance P4 D10. -
FIG. 15 depicts BV/TV four weeks after fractured femur received various concentration of Ghrelin D10. -
FIG. 16 depicts BV four weeks after fractured femur received various concentration of pBMP9 D10. -
FIG. 17 depicts BV/TV four weeks after fractured femur received various concentration of pBMP9 D10. -
FIG. 18 depicts BV/TV four weeks after fractured femur received various concentration of CNP D10. -
FIG. 19 depicts BV/TV four weeks after fractured femur received 1 nmol/day of ODP D10. -
FIG. 20 depicts BV/TV three weeks after fractured femur received various concentrations of CBM D10 as compared to a fractured femur that received parathyroid hormone 1-34 (PTH). -
FIG. 21 depicts BV/TV four weeks after fractured femur received various concentrations of P4 D10. -
FIG. 22 depicts BV four weeks after fractured femur received 1 nmol/day of P4 D10. -
FIG. 23 depicts BV/TV four weeks after fractured femur received various concentrations of MGF D10. -
FIG. 24 depicts BV/TV four weeks after fractured femur received various concentrations of TP508_D10. -
FIG. 25 depicts BV/TV four weeks after fractured femur received 1 nmol/day of VIP_D10. -
FIG. 26 depicts TbTh four weeks after fractured femur received 1 nmol/day of VIP_D10. -
FIG. 27 depicts the structure for BMP9 (SEQ ID NO: 14). -
FIG. 28 depicts the structure for Ghrelin D10 (SEQ ID NO: 15). -
FIG. 29 depicts the structure for Preptin D10 (SEQ ID NO: 3). -
FIG. 30 depicts the structure for CNP-D10 (SEQ ID NO: 16). -
FIG. 31 depicts the structure for VIP D10 (SEQ ID NO: 17). -
FIG. 32 depicts the structure for Substance P with 4 mini PEG conjugated to D10 (SEQ ID NO: 18). -
FIG. 33 depicts the structure for CBM D10 (SEQ ID NO: 9). -
FIG. 34 depicts the structure for ODP D10 (SEQ ID NO: 19). -
FIG. 35 structure of B2A_AHX3_e10 (SEQ ID NO: 27). -
FIG. 36 . Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10. -
FIG. 37 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10. -
FIG. 38 . Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10. -
FIG. 39 . Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of B2A_AHX_e10. -
FIG. 40 . Structure of F2A_mp4_e10 (SEQ ID NO: 28). -
FIG. 41 . Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10 -
FIG. 42 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10. -
FIG. 43 . Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10 -
FIG. 44 . Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F2A_mp4_e10. -
FIG. 45 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb. -
FIG. 46 . Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb. -
FIG. 47 . Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb. -
FIG. 48 . Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of F119_mp4_e10_stb. -
FIG. 49 . Structure of JNK3_mp4_e10 (SEQ ID NO: 21). -
FIG. 50 . Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10. -
FIG. 51 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10. -
FIG. 52 . Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10. -
FIG. 53 . Work to Fracture (mJ) after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of JNK3_mp4_e10. -
FIG. 54 . Structure of Lactoferrin_mp4_e10 (SEQ ID NO: 22). -
FIG. 55 . Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb. -
FIG. 56 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb. -
FIG. 57 . Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb. -
FIG. 58 . Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Lactoferrin_mp4_e10_stb. -
FIG. 59 . Structure of Osteostatin_mp4_(D)E10 (SEQ ID NO: 23). -
FIG. 60 . TbTh measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E10. -
FIG. 61 . Max Load(N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E10. -
FIG. 62 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E10. -
FIG. 63 . Stiffness (N/mm) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E10. -
FIG. 64 . Work to Fracture (mJ) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of Osteostatin_mp4_(D)E10. -
FIG. 65 . Structure of P2A-mp4_e10 (SEQ ID NO: 29). -
FIG. 66 . Bone Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10 -
FIG. 67 . Bone Volume/Total Volume measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10. -
FIG. 68 . Max Load (N) measured after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10 -
FIG. 69 . Work to Fracture (mJ) after treatment with saline, or 0.1 nmol/day, 1 nmol/day or 10 nmol/day of P2A-mp4-e10. -
FIG. 70 . Structure of Preptin (1-34)_mp4_e10 (SEQ ID NO: 24). -
FIG. 71 . Bone Volume/Total Volume measured after treatment with saline, or Preptin (1-34)_mp4_e10_50×. -
FIG. 72 . Bone Volume measured after treatment with saline, or Preptin (1-34)_mp4_e10_50×. -
FIG. 73 . Max Load (N) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50×. -
FIG. 74 . Post Yield Displacement (mm) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50×. -
FIG. 75 . Work to Fracture (mJ) measured after treatment with saline, or Preptin (1-34)_mp4_e10_50×. -
FIG. 76 . Structure of QK_mp4_e10 (SEQ ID NO: 25). -
FIG. 77 . Bone Volume measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10. -
FIG. 78 . Bone Volume/Total Volume measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10. -
FIG. 79 . Max Load (N) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10. -
FIG. 80 . Work to Fracture (mJ) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day of QK_mp4_e10. -
FIG. 81 depicts the structure for Annexin 1 (SEQ ID NO: 26). -
FIG. 82 Max Load (N) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day ofAnnexin 1. -
FIG. 83 Work to Fracture (mJ) measured after treatment with saline, or 1.0 nmol/day, 10 nmol/day or 100 nmol/day ofAnnexin 1. -
FIG. 84 depicts the structure for F119 (SEQ ID NO: 20). - SEQ ID NO: 1: bone forming peptide conjugated with 10 aspartate acids (BFP D10).
- SEQ ID NO: 2: osteogenic growth peptide conjugated with 10 aspartate acids (OGP D10).
- SEQ ID NO: 3: Preptin conjugated with 10 aspartate acids (Preptin D10).
- SEQ ID NO: 4: substance P with 4 mini PEG linker and conjugated with 10 aspartate acids (
substance P 4 mini PEG D10). - SEQ ID NO: 5: Ghrelin D10 with Ser-3 replaced with diaminopropinoic acid.
- SEQ ID NO: 6: BMP9 D10.
- SEQ ID NO: 7: C-type Natriuretic peptide (CNP) conjugated with 10 aspartate acids (CNP 10).
- SEQ ID NO: 8: Vasoactive intestinal peptide (VIP) conjugated with D10.
- SEQ ID NO: 9: collagen binding motif conjugated with 10 aspartate acids (CBM D10).
- SEQ ID NO: 10: P4 conjugated with 10 aspartate acids (P4 D10).
- SEQ ID NO: 11: Mechano-growth factor conjugated with 10 aspartate acids (MGF D10).
- SEQ ID NO: 12: Thrombin fragment TP508 conjugated with 10 aspartate acids (TP 508 D10).
- SEQ ID NO: 13: Osteopontin-derived peptide conjugated with 10 aspartate acids (ODP D10).
- SEQ ID NO: 14: BMP9 with 10 aspartate acids (BMP9).
- SEQ ID NO: 15: Ghrelin with 10 aspartate acids (Ghrelin D10).
- SEQ ID NO: 16: CNP with 10 aspartate acids (CNP-D10).
- SEQ ID NO: 17: VIP with 10 aspartate acids (VIP D10).
- SEQ ID NO: 18: 4 mini PEG D10.
- SEQ ID NO: 19: ODP with 10 aspartate acids (ODPD10).
- SEQ ID NO: 20: F119 with 10 glutamic acids (F119).
- SEQ ID NO: 21: JNK with 10 glutamic acids (JNK3_mp4_e10).
- SEQ ID NO: 22: Lactoferrin with 10 glutamic acids (Lactoferrin_mp4_e10).
- SEQ ID NO: 23: Osteostatin with 10 glutamic acids (Osteostatin_mp4_(D)E10).
- SEQ ID NO: 24: Preptin with 10 glutamic acids (Preptin (1-34)_mp4_e10).
- SEQ ID NO: 25: QK with 10 glutamic acids (QK_mp4_e10).
- SEQ ID NO: 26:
Annexin 1 with 10 glutamic acids (Annexin 1). - SEQ ID NO: 27: B2A with 10 glutamic acids (B2A_AHX3_e10).
- SEQ ID NO: 28: F2A with 10 glutamic acids (F2A_mp4_e10).
- SEQ ID NO: 29: P2A with 10 glutamic acids (P2A-mp4_e10).
- SEQ ID NO: 30: Targeting group consisting of a polypeptide, DDDDDDDDDD.
- SEQ ID NO: 31: Targeting group consisting of a polypeptide, EEEEEEEEEE.
- While the concepts of the present disclosure are illustrated and described in detail in the figures and the description herein, results in the figures and their description are to be considered as examples and not restrictive in character; it being understood that only the illustrative aspects are shown and described and that all changes and modifications that come within the spirit of the disclosure are desired to be protected.
- Unless defined otherwise, the scientific and technology nomenclatures have the same meaning as commonly understood by a person in the ordinary skill in the art pertaining to this disclosure.
- Aspects of the fracture targeted technology disclosed herein can help both civilians and military personnel. Bone fractures occur at an annual rate of 2.4 per 100 people and cost the US healthcare system approximately $28 billion per year. Of the 6.3 million bone fractures that occur annually in the US, 300,000 result in delayed union or non-union healing. Approximately 887,679 hospitalizations result each year from fractures. Over half (57%) of fractures resulting in hospitalizations occur in persons aged 65 and over. Estimated health care costs are indicated in Table 1, below.
-
TABLE 1 Cost without Cost with Fracture Healing time surgery surgery Leg 10-12 weeks) $2,500 $16,000 Hip 12+ weeks $11,500 $66,500 Vertebral (8+ weeks) $5,000-15,000 $50,000-150,000 Arm 6-10 weeks $2,500 $16,000 - Currently, a substantial fraction of national defense outlays is devoted to combat-related medical expenditures, with a significant proportion of these costs devoted to treatment of orthopedic injuries. Indeed, ˜65% of all wounds associated with military conflicts since World War I (WWI) have included orthopedic injuries, and 26% of all injuries to an extremity have involved one or more broken bones. Treatment of bone fractures not only removes a soldier from service for an extended period of time, but also requires the attention of multiple additional personnel to treat, monitor and rehabilitate the injured soldier. Unfortunately, some orthopedic injuries are so severe that resolution of the damage never occurs, and the armed services are then obligated to care for the damaged combatant in perpetuity.
- Fractured bones are not only an adverse consequence of combat, they also constitute a prominent repercussion of military training exercises. During the course of a soldier's schooling, a female recruit will have a 3.4-21% chance of suffering a stress fracture, while a male recruit will have a 1-7.9% probability of experiencing the same injury. While such maladies may at first seem trivial, statistics reveal that they cost the military ˜$34,000 per soldier which totals up to ˜$100 million in aggregate per year. Not surprisingly, many affected recruits eventually leave the military as a consequence of their stress fracture, which results in further expenses arising from wasted recruiting and training efforts. Therapies for fractured bones both within and outside of the military rely almost exclusively on mechanical stabilization of the damaged bone (i.e. use of a cast, pin, rod, or plate, etc.). In fact, the only FDA-approved drug for enhancing fracture repair is a bone anabolic agent that must be applied topically to the fracture surface during surgery. Needless to say, such a therapy is inappropriate when the surgery is not otherwise indicated, can only be administered once (i.e. during the brief period when the fracture surface is exposed), cannot be easily adapted for treatment of multiple fractures, and is never used for therapy of stress fractures. What is critically needed is obviously a systemically administered bone anabolic agent (i.e. as drug that can stimulate rapid bone fracture healing) that will concentrate selectively on the bone fracture surface and induce accelerated bone formation only at the damaged site. Surprisingly, nothing of this sort has ever been described in the literature.
- Recognizing the enormous need for a systemically administered bone fracture-targeted healing agent, peptides and other molecules with structures that home specifically to bone fracture surfaces following intravenous or subcutaneous administration were identified. A second group of bone anabolic agents (for example, both bone growth stimulating hormones and cytokines as well as various low molecular weight bone growth-inducing drugs, etc.), that when linked to one of our bone fracture-homing peptides, would promote accelerated fracture repair, were also identified. Fortunately, several fracture-targeted bone anabolic drugs met all initial requirements for advancement into large animal studies. That is, the targeted conjugates were found to: i) reduce the time for fractured femur repair in mice by roughly half, ii) induce no detectable systemic toxicity at its effective dose, iii) cause no ectopic bone formation at either the injection site or elsewhere), iv) lead to regeneration of bone at the fracture site that was biomechanically stronger than the contralateral (unbroken) femur, and v) result in eventual remodeling of the fractured region into normal cortical bone.
- All in vivo data included herein are from Swiss Webster mice. All mice received an osteotomy on their right femur and received subcutaneous drug administration daily for either 2, 3 or 4 weeks, as indicated, for each compound. 1× concentration represents 1 nmol/day, 10× represents 10 nmol/day, 100× represents 100 nmol/day most studies have an n of 5.
- Aspects of the disclosure include conjugates sometimes written in the form of X-Y-Z, wherein each conjugate includes at least one moiety (X) that has the ability to effect bone growth, development, and/or healing, for example, anabolic agents, and a targeting moiety (Z) which has an affinity for bone and helps to direct the conjugate to bone. In some of these conjugates, the X and Z portions are joined together by a linker region (Y).
- Targeting moieties (Z), many of which are explicit or implicit disclosed herein, have the potential to target bone anabolic agents to bone fractures, ostectomies, and osteotomy sites. The compounds described here are composed of molecules with high affinity towards hydroxyapatite and a bone anabolic agent. Although targeting has been exemplified primarily with acidic oligopeptides, all molecules with affinity towards hydroxyapatite could be attached to a bone anabolic agent to improve fracture repair. These molecules include but are not limited to ranelate, bisphosphonates, tetracyclines, polyphosphates, molecules with multiple carboxylic acids, calcium chelating molecules, metal chelators, acidic amino acid chains of either d or L chirality. Each of the previously listed targeting molecules can be single units, polymers, dendrimers or multiple units. Other molecules can also be substituted for the targeting agent. These include peptides, proteins and manmade molecules that intercalate, bind to, adsorb to, or hybridize with: collagen, the extracellular matrix, heparan sulfate, chondroitin sulfate, keratan sulfate, hyaluronic acid, elastin, fibronectin, laminin, proteoglycans, basement membrane, extracellular polymeric substances, integrins, blood clotting factors, fibrinogen, thrombin, fibrin, and other extracellular macromolecules, It is also possible to target using a combination of the listed targeting molecules.
- Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art to which this disclosure pertains.
- The term “BV/TV” means the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus.
- The term “TbTh” means the trabecular thickness of the 100 thickest micro CT slices of the fracture callus.
- The term “BV” means the overall bone volume of the 100 thickest micro CT slices of the fracture callus.
- The term “TbSp” means the spacing between the trabecula in the 100 thickest micro CT slices of the fracture callus.
- The term “Peak Load” means a
postmortem 4 point bend of the healed femur. Peak load represents the maximum force the healed femur withstood before it refractured. - The term “D10” at the end of any name represents that the peptide is targeted to bone by a chain of 10 aspartic acids. D10 can be at the N-terminus or C-terminus of the specified peptide.
- The term “E10” or “(D)E10” at the end of any name represents that the peptide is targeted to bone by a chain of 10 (D) glutamic acids.
- The term “P4” means a fragment that represents the knuckle epitope in hBMP-2.
- The term “P-4” corresponds to residues 73-92 of BMP-2 in which Cys-78, Cys-79, and Met-89 are changed to Serine (Ser), Ser, and Threonine (Thr). BMPs are well known regulators of bone and cartilage formation. BMPs bind as dimers to type I and type II Ser/Thr receptor kinases, forming an oligomeric complex that activates intracellular Smad proteins leading to their translocation into the nucleus where they serve as transcription factors to activate different OB differentiation markers (such as Runx2 (transcription factor for osteoblast differentiation)), leading to osteoblastogenesis. BMPs have also been shown to stimulate mesenchymal stem cells (MSC) differentiation to OBs by promoting recruitment of osteoprogenitor cells.
- The term “AHX” in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of 6-(amino)hexanoic acid.
- The term “AHX3” in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of (6-(amino)hexanoic acid)3.
- The term “mp4” in the middle of any name represents that the therapeutic is linked to the targeting peptide via a polymer of 4 minipegs as known as 8-Amino-3,6-Dioxaoctanoic Acid.
- The term “STB” at the end of any name represents that the compound represents a chemically more stable version of its natural version.
- Compounds which effect bone growth and may be used to practice aspects of the present disclosure include but are not limited to the following: growth factors, fragments of growth factors, or synthetic peptides or small molecules that mimic the action of growth factors. Examples of which may include but are not limited to: transforming growth factors(alpha or beta), insulin, insulin-like growth factors, fibroblast growth factor (1-23), erythropoietin, epidermal growth factor, colony-stimulating factors (including macrophage colony-stimulating factor, granulocyte colony-stimulating factor, granulocyte macrophage colony-stimulating factor), bone morphogenetic proteins (BMP) (1-8a, 8b, 10, 11, 15), angiopoietin, vascular endothelial growth factor, megakaryocyte growth and development factor, adrenomedullin, autocrine motility factor, ciliary neurotrophic factor, leukemia inhibitory factor, interleukin(1-7), ephrins(A1-5, B1-3), Foetal Bovine Somatotrophin, glial cell line-derived neurotrophic factor, neurturin, persephin, artemin, growth differentiation factor-9, hepatocyte growth factor, hepatoma-derived growth factor, keratinocyte growth factor, migration-stimulating factor, macrophage-stimulating protein, myostatin, neuregulins(1-4), neurotrophins, brain-derived neurotrophic factor, nerve growth factor, neurotrophin-3, neurotrophin-4, placental growth factor, platelet-derived growth factor, renalase, T-cell growth factor, tumor necrosis factor-alpha, Wnt signaling activators, parathyroid hormone-related peptide, parathyroid hormone, growth differentiation factor, Growth Hormone (GH), thyroid hormone, calcitonin, vitamin D, Apelin, Annexin, Bmp fragments including: OPD (BMP2), P-1(Bmp2), P24(bmp2), P4(BMP) HBD(bmp4), Bone Forming Peptide (BFP), BFP-1(BMP-7), BFP-2(BMP-7), BFP-4(BMP-7), BFP-7 derived peptide, (bmp7), peptide b(BMP-7), BMP-9-derived peptide(bmp-9), pBMP-9(BMP-9), SpBMP-9(BMP-9), BMP2-L51P(BMP2), BMP2 108(BMP2), mBMP (BMP2), osteopromotive domain (OPD) (BMP2), PEP7 (BMP2), AB204(BMP2/ACTIVIN A), AB204-1103Y(BMP2/ACTIVIN A), AB211(BMP2/ACTIVIN A), AB215((BMP2/ACTIVIN A), BMP2/BMP9 chimera BB29, BMP6/BMP7 chimera 80, BMP7-E60K BMP6, THR-123 (BMP7), MB109 (BMP9), GDF5-S94N, GDF5-N445K, GDF5-N445T, GDF5-V453/V456, BMP2/6, BMP2/7, BMP4/7, Casein kinase 2 (CK2), CK2.1, CK2.2, CK2.3; Fibroblast growth factor 2 fragments: F105, F119, F36, F77; Glucagon like peptide, Exendin 4, exenatide, liraglutide, lixisenatide, albiglutide, dulaglutide, semaglutide, taspoglutide, Preptin, E peptide, mechano growth factor, Cathelicidin, Endothelin-1, OGP (osteogenic growth peptide), cyclic OGP10-14, OGP10-14, Ostabolin, Ostabolin-C, ZP2307, TP-508 Chrysalin, PBA2-1c, QK, Amylin, ghrelin, GHRP-6, hexarelin, ipamorelin, amylin, human c peptide, vessel dilator, CNP, BMN 11, Osteoblast activating peptide, fMLF, hepcidin, PSI, Epoxomicin, bortezomib, Carfizmib, oprzomib, Epiregulin, Betacellulin, amphiregulin, Neuregulin, Stem cell factor, Agrin, Ephrin, Glial cell line-derived neurotrophic factor, neurturin, artemin, Angiopoietins SPARC-113, SPARC-118, Osteoactivin, or a molecule stimulates JNK3 upregulation: such as JNK3, and arrestin 3 fragments, or annexin1.
- Still other compounds which effect bone growth and may be used to practice aspects of the present disclosure include but are not limited to an angiogenic factor or a vasoactive compound that either stimulates angiogenesis or hematopoiesis, effects hematopoiesis, is released by or affects cells of a hematopoietic lineage, such as red blood cells, leukocytes, platelets, monocytes, or endothelial cells, or is a protein, peptide or other small molecule release in response to injury to blood vessel, or the full protein, peptide or fragments of such molecules or synthetic or small molecules that mimic their actions. Examples of which may include but are not limited to: VEGF, QK, SPARC 113, VIP, PACAP, Dobutamine, dopamine, isoprenaline,
endothelin 1, phenylphrine, adrenaline, terlipressin, Angeotensin II, Ace inhibitors, FGF2, PDGF, Angiopoietin, Hypoxia inducable factors, MMP2, metaloproteases, sokotrasterol sulfate, 0-sitosterol, oversulfated exopolysaccharide, IGF-1fumagillin, Vatanib, Axtinib, Placental growth factor, neuropilin, VE-cadherin, Alpha-v beta 3, afibercept, HIF1A, cediranib, Shingosinel-phosphate, 2 methoxyesterdiol, vandetanib, semanib, ephrin, ramucirumab, TIE1, Platelet activating vactor, Thrombin, TP508, fibrin, fibrinogen, von Willebrand factor, protease-activated receptor, serotonin, platlet activating factor, ATP, ADP, Thromboxane A2, factor X, factor VII, Factor IX, Hangeman factor, factor I, Factor VIII, Vitamin K,platelet factor 4, endothelium derived hyperpolarizing factor, prostaglandins, leukotrienes, notchagonists, LIF, Jagged, and memaquinone. -
-
(SEQ ID NO: 1) BFP1D10 DDDDDDDDDDGQGFSYPYKAVFSTQ - BFP (bone forming Peptide) a fragment of immature BMP7 is a 15-amino acid peptide corresponding to residues 100-115 of the immature form of BMP-7 which like BMP2 is involved in osteogenic differentiation, proliferation, and formation of new bone. This short peptide also induces osteogenesis calcium content in MSCs.
- BMP-9 is also a potent regulator of osteogenesis and chondrogenesis and is a potent inducer of differentiation of osteoblasts. pBMP9 is a 23-residue peptide derived from residues 68-87 of the knuckle epitope of human BMP-9. The mechanism of action of this peptide is likely to involve the small mothers against decapentaplegic (Smad) pathway. The structure of BMP9 is depicted in
FIG. 27 . - Ghrelin is a 28-residue peptide hormone synthesized primarily by the gastric fundus in response to fasting, and acts as a ligand of the growth hormone secretagogue (GHS) receptor (GHSR) to promote growth hormone release from the pituitary. Ghrelin stimulation at the GHSR leads to the proliferation of osteoblasts and prevents the apoptosis of osteoblasts through mitogen-activated protein kinase/extracellular signal-regulated kinases (MAPK/ERK) and phosphoinositide 3-kinase/protein kinase B (PKB) (PI3K/AKT) pathways. Ghrelin also stimulates osteoprotegerin (OPG) gene expression, which inhibits the coupling between the osteoclasts and osteoblasts, leading to reduced osteoblast-related osteoclast differentiation. Increased OPG also and decreases osteoclast activity. Ghrelin is only active when the Ser-3 is acylated with octanoic acid. Our construct contains a stabilized version of this where Ser-3 was replaced with diaminopropionic acid. The structure of Ghrelin D10 is depicted in
FIG. 28 . - Preptin is a 34-residue peptide hormone that is secreted by the β-cells of the pancreatic islets. This peptide corresponds to Asp-69 to Leu-102 of the E-peptide of proinsulin-like growth factor-II (pro-IGF-II). Preptin's anabolic effects on bone are exerted through its ability to stimulating osteoblasts s proliferation, differentiation, and promoting their survival. Preptin's proliferative effect is predicted to be facilitated through a G-protein-coupled receptor triggering phosphorylation of p42/44 MAP kinases. Some of preptin's anabolic effects are believed to be due to it stimulating an increase in a known bone anabolic connective tissue growth factor. While the native peptide effects glucose metabolism the first 16 amino acids are important for its anabolic effects and have no effects on glucose metabolism. The structure of Preptin D10 is depicted in
FIG. 29 . - C-Type Natriuretic Peptide (CNP) contains 22 residues stabilized by an intramolecular disulfide linkage between Cys-6 and Cys-22 it functions as a local regulator of vascular tone, possibly due to its strong vasorelaxant properties. CNP also acts on the differentiation and proliferation of OBs, OCs, and chondrocytes via an autocrine/paracrine process through binding to the natriuretic peptide receptor B (NPR-B). CNP activates bone turnover and remodeling. Endochondral ossification is another mechanism of bone formation affecting chondrocytes. It involves the conversion of an initial cartilage template into bone such as long bones and vertebrae. CNP has been shown to be an important anabolic regulator of endochondral ossification. The structure of CNP-D10 is depicted in
FIG. 30 . - Vasoactive intestinal peptide (VIP), a neuropeptide that consists of 28 amino acids and originally isolated from porcine intestine. VIP has several effects however its receptors are present on the nerves that rapidly innervate the fracture callus. It has been shown to be an important regulator of bone formation. VIP exerts its biological effects through the G-protein-coupled receptors (VPAC1, VPAC2, and PAC1). Signaling through these receptors also enhanced cell osteoblast differentiation and proliferation. It also increases expressions of collagen type I, osterix (OSX), and alkaline phosphatase (ALP) through signaling at the VPAC2 receptor by triggering an increase in intracellular calcium. VIP also increases the expressions of BMPs and the nuclear presence of Smad1 transcription factor, which can activate various bone-specific genes. VIP also enhances osteoblast proliferation and mineralization through increased gap junction intercellular communication (GJIC) between osteoblasts. VIP also affects the differentiation of osteoclasts thus leading to an increase in bone resorption. The structure of VIP D10 is depicted in
FIG. 31 . - Substance P is an 11-amino acid long pro-inflammatory neuropeptide belonging to the tachykinin family. Substance P improves mineralization of osteoblasts and the expression of osteogenic markers at late-stage bone formation, by activating neurokinin-1 receptor, a G-protein coupled receptor found in the central and peripheral nervous systems. Also, substance P reduces osteoclastogenesis and bone resorption. Substance P upregulates the expressions of
collagen type 1, ALP, Runx2 and osteocalcin in osteoblasts this effect involves the activation of Wnt/β-catenin signaling pathway. Substance P promotes differentiation and migration capability of rat bone marrow MSCs and activates BMP-2 expression in osteoblasts. Some of substance p's anabolic effects are attributed to in human to increases in osteoblast proliferation and mineralization through increased gap junction intercellular communication between osteoblasts. Gap junction intercellular communication has important roles in conveying the anabolic effects of hormones and growth factors and regulating transcription of osteogenic markers. The structure of Substance P with 4 mini PEG conjugated to D10 is depicted inFIG. 32 . - CBM collagen binding motif is the highly conserved 28-residue collagen binding motif (CBM) (residues 150-177) of human osteopontin. Osteopontin, a glycosylated phosphoprotein prominently localized in the extracellular matrix (ECM) of mineralized bone tissue to form a complex with collagen in bone tissue, thereby inducing mineralization of collagen fibrils. CBM enhances osteoblast differentiation of human MSC. CBM causes osteogenic differentiation of human bone marrow MSCs and increases mineralized of bone. CBM works in human MSCs by increasing extracellular Ca2+ influx, which leads to the activation of CaMKII and the subsequent phosphorylation of ERK1/2, ultimately influencing OB differentiation. The structure of VIP D10 is depicted in
FIG. 33 . - Osteopontin-derived peptide (ODP), a 15-residue peptide derived from rat osteopontin. ODP like CBM is a fragment of extracellular protein involved in the mineralization of collagen. ODP enhanced the differentiation and mineralization of MSCs. ODP improves the attachment via receptor mediated attachment and migration of osteoblasts and fibroblasts to the fracture site. ODP improves the proliferation and migration of osteoblasts. Though the signaling pathways are not completely elucidated for this molecule its believed that it works in a similar mechanism as CBM. The structure of ODP D10 is depicted in
FIG. 34 . -
(SEQ ID NO: 2) OGP-D10 DDDDDDDDDDALKRQGRTLYGFGG - OGP-targeted Osteogenic growth peptide (OGP) is composed of a 14-AA residue identical to the C-terminus of
histone 4 conjugated to an acidic oligopeptide at the N-terminus. Systemic administration of free OGP has been shown to improve fracture repair by improving the mineralization of cartilaginous fracture callus. -
(SEQ ID NO: 11) MGF-DDDDDDDDDDYQPPSTNKNTKSQRRKGSTFEEHK - Targeted mechano growth factor (MGF) E peptide is a splice variant of insulin-like growth factor I (IGF-I) with a targeting acidic oligopeptide on the N terminus. MGF causes osteoblast proliferation through the MAPK-ERK signaling pathway. Local injections (57 ug/kg) in
rabbit bone defects 5 mm demonstrated accelerated healing through osteoblast proliferation. -
(SEQ ID NO: 12) TP508- DDDDDDDDDDAGYKPDEGKRGDACEGDSGGPFV - Targeted TP-508 is a prothrombin peptide that has been modified on the N-terminus with an acidic oligopeptide. The anabolic portion of TP-508 has been used in clinical trials for repairing foot ulcers. Free TP-508 has a proliferative effect on osteoblasts. Local injections have demonstrated accelerated fracture repair in older rats.
- B2A is a synthetic, multidomain peptide with two 19 amino acid branches derived from the region which is similar to the TGF-P/BMP-binding region of fetuin, a member of the cystatin family of protease inhibitors. The 19 amino acid branch acts as a BMP receptor ligand. BMP receptor activation is well known to osteogenic as BMP2 is currently approved to treat bone fractures. However existing strategies rely on the use of a full recombinant human protein. B2A is a dimer peptide that achieves similar levels of BMP receptor activation with a much mass. Bone morphogenetic protein receptor (BMPR) activation is canonically associated with activation of the small mothers against decapentaplegic (Smads) pathway BMPR ligands can, activate non smad signaling via p38, extracellular signal-regulated
kinases 1 and 2 (ERK1/2), stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK), and protein kinase B (Akt/PKB). non smad signaling is key in cell survival, nutution and metabolism and migration. B2A has the ability to bind both type I and II receptors for BMP. In the presence of BMP-2, B2A augments osteo-differentiation. In the absence of BMP-2, B2A-induced proliferation, aggrecan synthesis, and collagen accumulation in mesenchymal stem cells. Here by targeting B2A to the fracture, the osteogenic signal that locally applied BMP2 can be specifically localize to allow a much smaller much less invasive to apply form. The structure of B2A is depicted inFIG. 35 . - F2A_mp4_e10 is made up of two copies of the fibroblast growth factor (FGF) receptor targeting sequence from FGF2 branching from a single lysine then 4 minipegs to act a linker and spacer and 10 D glutamic acids to target to the bone. F2A's receptor targeting sequence is YRSRKYSSWYVALKR derived from derived from native FGF-2 (residues from 106 to 120). It has been shown to be nearly as potent as the full native protein at stimulating angiogenesis and osteogenesis in its dimer form. FGF2 is an anabolic growth factor heavily involved in wound healing and tissue repair. It Is both angiogenic and osteogenic. Fgf2 has shown promise as a protein treatment for wound healing. The advantage of F2A e10 is its small size allows for better perfusion and the e10 allows it to chemically home to the damaged tissue site from a noninvasive injection at a distal site. The structure of F2A is depicted in
FIG. 40 . - F119 is a heparin binding fragment from growth factor
fibroblast growth factor 2. Fibroblast growth factor (FGF)-2 regulates a variety of cellular functions, such as proliferation and differentiation, by binding to cell surface FGF receptors (FGFRs) in the presence of heparin proteoglycans F119 a heprerin binding site for fgf2 which corresponds to 119-135 of fgf2 (F119, KRTGQYKLGSKTGPGQK). F119 interacts with cell-surface heparan sulfate proteoglycans. In addition, osteoblast differentiation, confirmed by ALPase activity and mineralization, is increased by F119. The structure of F119 is depicted inFIG. 84 . - The c-Jun NH2-terminal protein kinases (JNKs) belong to the MAPK family. JNKs regulate normal physiological processes of cell proliferation, apoptosis, differentiation, and migration7. JNKs were also implicated in many diseases, from cancer to neurological and immunological disorders recently they were implicated as one of reasons adults bones don't have the same response to mechanical stimuli. It was found that increasing JNK3 activity stimulated more responsiveness to osteoinductive activity Arrestin-3 facilitates INK activation in cells, and a short 25-residue arrestin-3 peptide was identified as the critical JNK3-binding element2. It was demonstrated that this 25 residue peptide, JNK3, also binds mitogen-activated protein kinase 4 (MKK4), MKK7, and apoptosis signal-regulating kinase 1 (ASK1), which are upstream JNK3-activating kinases. This peptide is sufficient to enhance JNK3 activity in cells. The increases the responsiveness osteogenic signals that occur during bone fracture repair. Thus restoring the regenerative abilities of youth to adults. The structure of JNK3 is depicted in
FIG. 49 . - Lactoferrin is an iron-binding glycoprotein that belongs to the transferrin family. It is present in breast milk, in epithelial secretions, and in the secondary granules of neutrophils. In healthy subjects lactoferrin circulates at concentrations of 2-7×10-6 g/ml. Lactoferrin is a pleiotropic factor with potent antimicrobial and immunomodulatory activities. It has shown that lactoferrin can also promote bone growth. Lactoferrin is stimulatory towards osteoblasts and prevents osteoclastogensis. It has been shown that that lactoferrins interactions with osteoblast like cells is primarily through LRP1, a member of the family of low-density lipoprotein receptor-related proteins that are primarily known as endocytic receptors. Lactoferrin also induces activation of p42/44 MAPK signaling in primary osteoblasts, but the two pathways seem to operate independently as activation of MAPK signaling, but not endocytosis, is necessary for the mitogenic effect of lactoferrin. Lactoferrin is too large to act as a good therapeutic. But several active fragments of lactoferrin have been identified. Lactoferricin which is a loop region from the n terminus of Lactoferrin has been shown to have both antimicrobial and osteogenic effects.4,5, Our targeted compound comes from residues 17-31 from the n terminus followed by a 4 minipeg spacer and linker and 10 D glutamic acids to home it to bone. The structure of lactoferrin is depicted in
FIG. 54 . - Osteostatin (PTHrP[107-139]) is a fragment of Parathyroid hormone related protein(PTHrP) that has been reported to be more anabolic than 1-34 of PTHrP. PTHrP is anabolic on bone both because of an inhibitory effect on osteoclast but mostly a stimulatory effect on osteoblasts. Some of its effect is believed to function like PTHrP though WNT signaling and also through interactions with the vascular endothelial growth factor (VEGF) receptor to increase survival of osteoblasts. The structure of osteostatin (PTHrP[107-139]) is depicted in
FIG. 59 . - Platelet-derived growth factors (PDGFs) are mitogens for many cells primary of mesenchymal origin and their involvement in wound healing has lead to the therapeutic use of recombinant human PDGF-BB, one of PDGF family. PDGF are released by plates at the site of fractures are chemotactic and mitogenic for osteoblast lineage cells and osteoblasts and therefore may enhance fracture healing by attracting osteoprogenitor cells to the fracture by chemotaxis and amplifying their quantity by mitogenesis. Further, PDGF-3B upregulates the expression of angiogenic vascular endothelial growth factor (VEGF), a key molecule for bone regeneration. PDGF-BB is approved to accelerate ankle fusion. It was found that a Arg160, Lys161 and Lys162 in PDGF-BB are required for mitogenic activity and high-affinity receptor. It was shown that a chain containing a branched dimer of VRKIEIVRKK derived from residues 153-162 of PDGF-BB was almost as active as the full PDGF-BB. The targeted construct of the present disclosure consists of that cyclized branched dimer of VRKIEIVRKK derived from residues 153-162 of PDGF-BB, with a 4 minipeg spacer and 10 (D) glutamic acid to localize it to the site of the fracture. The structure of P2A is depicted in
FIG. 65 . - Preptin is a 34-residue peptide hormone that is secreted by the β-cells of the pancreatic islets. This peptide corresponds to Asp-69 to Leu-102 of the E-peptide of proinsulin-like growth factor-II (pro-IGF-II). Preptin's anabolic effects on bone are exerted through its ability to stimulating osteoblasts s proliferation, differentiation, and promoting their survival. Preptin's proliferative effect is predicted to be facilitated through a G-protein-coupled receptor triggering phosphorylation of p42/44 MAP kinases. Some of Preptin's anabolic effects are believed to be due to it stimulating an increase in a known bone anabolic connective tissue growth factor. While the native peptide effects glucose metabolism the first 16 amino acids are important for its anabolic effects and have no effects on glucose metabolism. The structure of Preptin(1-34) is depicted in
FIG. 70 . - The vascular endothelial growth factor (VEGF) is the main regulator of angiogenesis. It elicits its proangiogenic activity by binding to two membrane receptors (VEGFR1 and VEGFR2) on the surface of endothelial cells (ECs). The binding of the natural ligand to VEGFR2 induces receptor dimerization and autophosphorylation of the intracellular kinase domain, which activates intracellular pathways ending in proliferation, migration, survival, and definitively triggering of the proangiogenic cellular response. Recently a de novo synthesized VEGF mimetic, named QK that shares the same properties as VEGF. This mimetic is a 15 amino acid peptide which adopts a very stable helical conformation in aqueous solution that resembles the 17-25 α-helical region of VEGF165, and binds both VEGFR-1 and 2. QK recapitulates all of VEGFs properties of angiogenesis, vasodilation and most importantly wound healing. It is well established that VEGF improves the spread at which a wound heals. The quicker the blood supply is returned to normal the faster the body can repair itself. Full VEGF is difficult to control and use as drug to treat internal damage. But the targeted construct of the present disclosure takes the power of QK and homes it just to the damage site to control the site of angiogenesis to jus the desired region. The construct of the present disclosure is made up of the bone targeting ligand of the present disclosure attached to a mini-peg spacer and then to QK on its N terminus. The structure of QK is depicted in
FIG. 76 . - Annexin-1 is a family of phospholipid-binding proteins found in many tissues including bone marrow.363 The N-terminal fragment of annexin-1, Anx (2-26) is an endogenous ligand agonist of FPR1. Anx (2-26) promotes chemotactic migration and OB differentiation of MSCs via FPR1. The N-formyl peptide receptor (FPR) is a chemoattractant receptor belonging to the G-protein coupled receptor family. It is expressed in human bone marrow derived MSCs and is functionally involved in promoting MSC adhesion to extracellular matrix protein-coated surfaces as well as migration to sites of fracture for tissue regeneration. The structure of Annexin-1 is depicted in
FIG. 81 . - Unless noted otherwise, the conjugates of the present disclosure are synthesized using the following synthesis. In a solid phase peptide synthesis vial capable of bubbling nitrogen, Wang resin (0.39 mmol/g) was loaded at 0.39 mmol/g with the first amino acid overnight in dichloromethane (DCM) and diisopropyl ethyl amine (DIPEA). The resin was then capped with acetic anhydride and pyridine for 30 minutes, followed by three washes of DCM and dimethylformamide (DMF), respectively. Following each amino acid coupling reaction, fluoroenylmethyloxycarbonyl (Fmoc)-groups were removed by three 10 minute incubations with 20% (v/v) piperidine in DMF. The resin was then washed 3× with DMF prior to the next amino acid being added. Each amino acid was added in a 5-fold excess with N,N,N′N′-Tetramethyl-O-(1H-benzotriazol-1-yl)uronium hexafluorophosphate (HBTU) in DIPEA. Upon completion of the synthesis, peptides were cleaved using 95:2.5:2.5 trifluoroacetic acid:water:triisopropylsilane. Cysteine containing peptides were cleaved using 95:2.5:2.5 trifluoroacetic acid:triisopropylsilane:water: and 10 fold tris(2-carboxyethyl)phosphine (TCEP).
- For Amylin(1-8) and CGRP, the standard synthesis of the linear form of the cyclic peptides Fmoc Cystine with Acetamidomethyl protecting group on the sulfur was used. Then, to cyclize the peptide, the Cys(Acm) On-Resin was suspended the linear peptide resin in N,N-dimethylformamide (DMF) (approximately 1 mL/gram of resin). Then, the resin was treated with 10 equiv. of iodine (I2) in DMF/H2O 4:1 (v/v), approximately 1 mL/gram of resin). Then, argon gas was bubbled through the reaction mixture at room temperature for 40 minutes. Then, the resin was filtered and washed 3 times with DMF, 2 times with 2% ascorbic acid in DMF, 5 times with DMF, and 3 times with dichloromethane (DCM). Then, proceeded with normal n terminal fmoc deprotection and cleavage from the resin with normal cleavage solution with no TCEP added to preserve the disulfide bond. The peptides were then as all peptides purified using reverse phase chromatography on an HPLC using a 0-50% 20 mM ammonium acetate:acetonitrile gradient. The product was then identified from the appropriate fraction using LCMS and lyophilized to recover it from the water:acetonitrile mixture. All compounds were dissolved in sterile phosphate buffered saline (PBS) at the appropriate dose concentrations for drug delivery.
- The targeted conjugates were synthesized using standard Fmoc solid-phase peptide synthesis, as described above. To ensure the conjugates' activity, mouse pre osteoblast (MCTC3-E1) cells were treated with the targeted and untargeted compounds for three days at concentrations from 1 pM to 100 nM. After three days of treatment, the cells were harvested, and the ribonucleic acid (RNA) was purified from the cells. Expression levels of ALP, RUNx2, OSX, osteopontin (OPN), collagen 1A (Col-1A), OPG, RANKL, sclerostin gene (SOST), and OC were quantified via quantitative reverse transcription polymerase chain reaction (RT-qPCR). Once the biological activity of the conjugates was confirmed, they were tested in vivo in a fracture model. Aseptic surgical techniques were used to place a 23-gage needle as in intramedullary nail in the femur of anesthetized, 12-week-old Swiss Webster mice for internal fixation before fracture. Femur fractures were induced using a drop weight fracture device from RISystem. The mice received buprenorphine for three days post fracture. The mice were dosed subcutaneously each day for two weeks, three weeks, 4 weeks, or 17 days. Fracture healing was assessed using microCT (Scanco Medical Ag). Morphometric parameters were quantified in the 100 widest slices of the fracture callus. Trabecular thickness (TbTh), trabecular spacing (TbSp), total volume (TV), and volume of calcified callus (BV) were calculated. Fractured femurs were tested for strength in a four-point bend to failure using an Electro Force TestBench (TA Instruments). Lower supports were 10 mm apart on the anterior face of the femur in contact with the proximal and distal diaphysis. Upper supports were 4 mm apart and spanned the entire fracture callus on the diaphysis. Force was applied from the posterior face of the femur with a displacement rate of 0.3 mm/sec. Peak load, yield load, stiffness, displacement post yield, work to fracture, and deformation data were generated. Statistical analysis was performed using a two-way analysis of variance (ANOVA) and a Tukey post-hoc analysis with significance reported at the 95% confidence level. All animal experiments were performed in accordance with protocols approved by Purdue University's Institutional Animal Care and Use Committee (IACUC).
- Example 1 shows representative Src kinase inhibitors Dasatinib and E738 (structures shown in
FIGS. 3-4 respectively) effectively increased the bone density of the fracture callus when they are conjugated with acidic aspartic acids. SeeFIGS. 1-2 , where bone density of the fracture callus from the targeted Dasatinib group is twice as dense as the saline group, and 50% denser than the free Dasatinib group; targeted E738 conjugate has significantly improved the bone density and trabecular thickness at the fracture callus. The structure of CBMD10 is depicted inFIG. 33 . - Example 2 provides the maximum force a representative anabolic peptide induced healed femur can withstand before it refractured. As shown in
FIG. 5 , bone morphogenetic protein pathway signaling peptide BFP-D10 with 100 nmol/day (100×) treatment obtained the maximum peak load, followed by IGF derived peptide of Preptin-D10 100×, and Osteogenic growth peptide (OGP-D10 100×), as compared to PBS. - Example 3 indicates Preptin D10 effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1×, 10× and 100× respectively). The healing was reflected as BV/TV in
FIG. 6 , TbTh inFIG. 7 and bone volume inFIG. 8 , all in a dose dependent manner. - Example 4 indicates osteogenic growth peptide conjugate (OGP-D10) effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, and 100 nmol/day, referred as 1×, and 100× respectively). The healing was reflected as BV/TV in
FIG. 9 , TbTh inFIG. 10 and TbSp inFIG. 11 , all in a dose dependent manner. - Example 5 indicates bone forming peptide conjugate (BMP-D10) effect on healing fractured bone after 2 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1×, 10× and 100× respectively). The healing was reflected as BV/TV in
FIG. 12 , and TbSp inFIG. 13 in a dose dependent manner. - Example 6 indicates substance P D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1×, 10× and 100× respectively). The healing was reflected as BV/TV in
FIG. 14A in dose dependent manner.FIG. 14B indicates the peak load ofsubstance P D10 10× induced healed femur can withstand between 30-35 Newtons force. - Example 7 indicates Ghrelin-D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day, 10 nmol/day and 100 nmol/day, referred as 1×, 10× and 100× respectively). The healing was reflected as BV/TV in
FIG. 15 in dose dependent manner. - Example 8 indicates pBMP9 D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day, 10 nmol/day and 100 nmol/day, referred as 1×, 10× and 100× respectively). The healing was reflected as bone volume in
FIG. 16 and BV/TV inFIG. 17 in a dose dependent manner. - Example 9 indicates C-Type Natriuretic Peptide conjugate (CNP D10) effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day and 10 nmol/day referred as 1× and 10× respectively). The healing was reflected as BV/TV in
FIG. 18 in a dose dependent manner. - Example 10 indicates osteopontin derived peptide conjugate ODP D10 effect on healing fractured bone after 4 weeks of 1 nmol/day (referred as 1×). The healing was reflected as BV/TV in
FIG. 19 . - Example 11 indicates collagen binding motif of osteopontin conjugate CBM D10 effect on healing fractured bone after 3 weeks of various concentrations application (0.1 nmol/day, 1 nmol/day and 10 nmol/day, referred as 0.1×, 1× and 10× respectively). The healing was reflected as BV/TV in
FIG. 20 in a dose dependent manner. It is worth noting that the lowest does of CBM D10 has the similar effect of free PTH, an anabolic drug without specific bone targeting. - Example 12 indicates P4 D10 conjugate effect on healing fractured bone after 4 weeks of various concentrations application (nmol/day and 10 nmol/day, referred as 1× and 10× respectively). The healing was reflected as BV/TV in
FIG. 21 in a dose dependent manner and bone volume inFIG. 22 . - Example 13 indicates mechano growth factor conjugate (MGF D10) effect on healing fractured bone after 4 weeks of various concentrations application (1 nmol/day and 10 nmol/day, referred as 1× and 10× respectively). The healing was reflected as BV/TV in
FIG. 23 in a dose dependent manner. - Example 14 indicates thrombin fragment TP508 conjugate TP508 D10 effect on healing fracture after 4 weeks of various concentrations application (1 nmol/day and 10 nmol/day, referred as 1× and 10× respectively). The healing was reflected as BV/TV in
FIG. 24 in a dose dependent manner. - Example 15 indicates vasoactive intestinal peptide conjugate VIP D10 effect on healing fracture after 4 weeks of 1 nmol/day application (1×). The healing was reflected as BV/TV in
FIG. 25 and TbTh inFIG. 26 . - Example 16 indicates B2A (D)E10 effect on fracture healing. Referring now to
FIG. 36 , In vivo fracture healing efficacy of B2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture. - Referring now to
FIG. 37 , in vivo fracture healing efficacy of B2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV/TV—represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 38 , in vivo fracture healing efficacy of B2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 39 , in vivo fracture healing efficacy of B2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. B2A_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 17 indicates F2A (D)E10 effect on fracture healing. Referring now to
FIG. 41 , In vivo fracture healing efficacy of F2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture. - Referring now to
FIG. 42 , in vivo fracture healing efficacy of F2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV/TV—represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 43 , in vivo fracture healing efficacy of F2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 44 , in vivo fracture healing efficacy of F2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. F2A_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 18 indicates F119 effect on fracture healing. Referring now to
FIG. 45 , in vivo fracture healing efficacy of F119_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV/TV. BV/TV represents the bone volume of the total volume of 100 thickest micro CT slices of the fracture callus and is a measure of bone density at the site of fracture repair. 1×, lx and 100× are respectively 1 nmol, 10 nmol, and 100 nmol of the conjugate delivered daily by subcutaneous injection. F119_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 46 , in vivo fracture healing efficacy of F119_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1×, 10× and 100× are respectively 1 nmol, 10 nmol, and 100 nmol of the conjugate delivered daily by subcutaneous injection. F119_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture. - Referring now to
FIG. 47 , in vivo fracture healing efficacy of F119_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. F119_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 48 , in vivo fracture healing efficacy of F119_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. F119_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 19 indicates JNK3 effect on fracture healing. Referring now to
FIG. 50 , in vivo fracture healing efficacy of JNK3_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture. - Referring now to
FIG. 51 , in vivo fracture healing efficacy of JNK3_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV/TV. BV/TV—represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 52 , in vivo fracture healing efficacy of JNK3_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 53 , in vivo fracture healing efficacy of JNK3_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. JNK3_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 20 indicates Lactoferrin effect on fracture healing. Referring now to
FIG. 55 , in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture. - Referring now to
FIG. 56 , in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as BV/TV. BV/TV represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 57 , in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 58 , in vivo fracture healing efficacy of Lactoferrin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. Lactoferrin_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 21 indicates Osteostatin effect of fracture healing. Referring now to
FIG. 60 , in vivo fracture healing efficacy of Osteostatin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 3 weeks is reflected as Tbth. Tbth represents the trabecular thickness of the 100 thickest micro CT slices of the fracture callus and is a measure the quality of the bone at the site of fracture repair. 0.1×, 1× and 10× are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. The of Osteostatin_mp4_(D)E10 conjugate raises bone quality at the fracture calluses three weeks post fracture. - Referring now to
FIG. 61 , in vivo fracture healing efficacy of Osteostatin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1×, 1× and 10× are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. Osteostatin_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 62 , in vivo fracture healing efficacy of Osteostatin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as BV/TV. BV/TV—represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1×, 1× and 10× are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. Osteostatin_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 63 , in vivo fracture healing efficacy of Osteostatin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as stiffness. Stiffness represents the Youngs modulus of the healed femur as it was measured before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how stiff the bone is at the site of fracture repair. 0.1×, 1× and 10× are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. The of Osteostatin_mp4_(D)E10 conjugate raises bone stiffness at the fracture calluses three weeks post fracture. - Referring now to
FIG. 64 , in vivo fracture healing efficacy of Osteostatin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1×, 1× and 10× are respectively 0.1 nmol, 1 nmol, and 10 nmol of the conjugate delivered daily by subcutaneous injection. Osteostatin_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 22 indicates P2A effect on fracture healing. Referring now to
FIG. 66 , In vivo fracture healing efficacy of P2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses three weeks post fracture. - Referring now to
FIG. 67 , in vivo fracture healing efficacy of P2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. BV/TV—represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E10 conjugate raises bone density at the fracture calluses three weeks post fracture. - Referring now to
FIG. 68 , in vivo fracture healing efficacy of P2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 69 , in vivo fracture healing efficacy of P2A_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 3 weeks. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. P2A_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Example 23 indicates Preptin (1-34) effect on fracture healing. Referring now to
FIG. 71 , in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E10 conjugate on cluster of differentiation-1 (CD-1) male mice fracture-bearing mice (n=10) after 4 weeks is reflected as BV/TV. BV/TV represents the bone volume of the total volume of 100 thickest micro CT slices of the fracture callus and is a measure of bone density at the site of fracture repair. 50× represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E10 conjugate significantly raises bone density at the fracture calluses four weeks post fracture. - Referring now to
FIG. 72 , in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E10 conjugate on CD-1 male mice fracture-bearing mice (n=10) after 4 weeks is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site offracture repair 50× represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34) mp4_(D)E10 conjugate significantly raises bone mineralization at the fracture calluses four weeks post fracture. - Referring now to
FIG. 73 , in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E10 conjugate on CD-1 Male mice fracture-bearing mice(n=10) after 4 weeks is reflected as max load. Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 50× represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E10 conjugate significantly raises bone strength at the fracture calluses four weeks post fracture. - Referring now to
FIG. 74 , in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E10 conjugate on CD-1 Male mice fracture-bearing mice(n=10) after 4 weeks is reflected as post yield displacement. Post yield displacement represents the total displacement of the healed femur after the yield point has been reached in apostmortem 4 point bend analysis Post yield displacement is a measure of how elastic a material is. 50× represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E10 conjugate significantly reduces the bone brittleness at the fracture calluses four weeks post fracture. - Referring now to
FIG. 75 , in vivo fracture healing efficacy of Preptin(1-34)_mp4_(D)E10 conjugate on CD-1 Male mice fracture-bearing mice(n=10) after 4 weeks is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 50× represents 50 nmol of the conjugate delivered daily by subcutaneous injection. Preptin(1-34)_mp4_(D)E10 conjugate significantly raises bone strength at the fracture calluses four weeks post fracture. - Example 24 indicates QK effect on fracture healing. Referring now to
FIG. 77 , in vivo fracture healing efficacy of QK_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 17 days is reflected as BV. BV represents the bone volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how much bone has mineralized at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E10 conjugate raises bone mineralization at the fracture calluses 17 days post fracture. - Referring now to
FIG. 78 , in vivo fracture healing efficacy of QK_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 17 days is reflected as BV/TV. BV/TV—represents the bone volume divided by total volume of the 100 thickest micro CT slices of the fracture callus and is a measure of how dense the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E10 conjugate raises bone density at the fracture calluses 17 days post fracture. - Referring now to
FIG. 79 , in vivo fracture healing efficacy of QK_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice(n=5) after 17 days is reflected as max load (N). Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Peak load is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E10 conjugate raises bone strength at the fracture calluses 17 days post fracture. - Referring now to
FIG. 80 , in vivo fracture healing efficacy of QK_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 17 days is reflected as work to fracture. Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 1 nmol, 10 nmol, and 100 nmol of the conjugate were delivered daily by subcutaneous injection. QK_mp4_(D)E10 conjugate raises bone strength at the fracture calluses 17 days post fracture. - Example 22 indicates Annexin-1 effect on fracture healing. Referring now to
FIG. 82 , in vivo fracture healing efficacy of Annexin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 16 days is reflected as max load (N). Max load represents the maximum force the healed femur withstood before it refractured in apostmortem 4 point bend analysis. Max load is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. Annexin_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture. - Referring now to
FIG. 83 , in vivo fracture healing efficacy of Annexin_mp4_(D)E10 conjugate on Swiss Webster fracture-bearing mice (n=5) after 16 days is reflected as work to fracture (mJ). Work to fracture represents the total amount of energy absorbed by the healed femur before it refractured in apostmortem 4 point bend analysis. Work to fracture is a measure of how strong the bone is at the site of fracture repair. 0.1 nmol, 1 nmol, and 10 nmol of the conjugate were delivered daily by subcutaneous injection. Annexin_mp4_(D)E10 conjugate raises bone strength at the fracture calluses three weeks post fracture.
Claims (21)
X-Y-Z
X-Y-Z
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17/058,884 US20210214408A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201862678016P | 2018-05-30 | 2018-05-30 | |
PCT/US2019/034759 WO2019232280A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
US17/058,884 US20210214408A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
Publications (1)
Publication Number | Publication Date |
---|---|
US20210214408A1 true US20210214408A1 (en) | 2021-07-15 |
Family
ID=68696764
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/058,891 Pending US20210213135A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
US17/058,884 Abandoned US20210214408A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
US17/058,887 Pending US20210206820A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
US18/074,275 Pending US20230279068A1 (en) | 2018-05-30 | 2022-12-02 | Targeting anabolic drugs for accelerated fracture repair |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/058,891 Pending US20210213135A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
Family Applications After (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/058,887 Pending US20210206820A1 (en) | 2018-05-30 | 2019-05-30 | Targeting anabolic drugs for accelerated fracture repair |
US18/074,275 Pending US20230279068A1 (en) | 2018-05-30 | 2022-12-02 | Targeting anabolic drugs for accelerated fracture repair |
Country Status (3)
Country | Link |
---|---|
US (4) | US20210213135A1 (en) |
EP (2) | EP3790574A4 (en) |
WO (3) | WO2019232280A1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11773138B2 (en) | 2018-10-12 | 2023-10-03 | Theradaptive, Inc. | Polypeptides including a beta-tricalcium phosphate-binding sequence and uses thereof |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20240156973A1 (en) * | 2021-02-24 | 2024-05-16 | Purdue Research Foundation | Osteotropic compositions and uses thereof |
WO2023136866A1 (en) * | 2022-01-14 | 2023-07-20 | Novosteo Llc | Bone targeted treatment in osteogenesis imperfecta |
WO2024050602A1 (en) * | 2022-09-09 | 2024-03-14 | The University Of Sydney | Novel platelet derived growth factor peptide mimetic |
Family Cites Families (23)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU662155B2 (en) * | 1991-05-10 | 1995-08-24 | Celtrix Pharmaceuticals, Inc. | Targeted delivery of bone growth factors |
EP0950417A3 (en) * | 1998-02-23 | 2000-02-23 | Pfizer Products Inc. | Treatment of skeletal disorders |
WO2001044257A1 (en) * | 1999-12-17 | 2001-06-21 | Ariad Pharmaceuticals, Inc. | Proton pump inhibitors |
IL139380A0 (en) * | 2000-10-31 | 2001-11-25 | Prochon Biotech Ltd | Active variants of fibroblast growth factor |
DK1578771T3 (en) * | 2001-10-10 | 2013-06-10 | Novo Nordisk As | Remodeling and glycoconjugation of peptides |
WO2005095443A1 (en) * | 2004-03-31 | 2005-10-13 | Cardio Incorporated | Drug delivery system using peptide modification |
ES2887039T3 (en) * | 2004-04-21 | 2021-12-21 | Alexion Pharma Inc | Conjugates for bone delivery and method of using them to target proteins to bone |
US7648965B2 (en) * | 2004-05-14 | 2010-01-19 | Unigene Laboratories Inc. | Method for fostering bone formation and preservation |
JP2007537297A (en) * | 2004-05-14 | 2007-12-20 | ベイラー カレッジ オブ メディスン | Beta-adrenergic drugs conjugated with a bone-targeting moiety to regulate bone mass |
EP2255832A3 (en) * | 2004-06-16 | 2011-02-09 | Affinergy, Inc. | IFBM's to promote attachment of target analytes |
DK2084183T3 (en) * | 2006-10-13 | 2010-08-16 | Lilly Co Eli | Pegylated PTH as PTH receptor modulators and applications thereof |
EP1961765A1 (en) * | 2006-12-08 | 2008-08-27 | Zealand Pharma A/S | Truncated PTH peptides with a cyclic conformation |
EP2114415A4 (en) * | 2007-02-23 | 2012-10-17 | Univ Louisville Res Found | Methods and compounds for the targeted delivery of agents to bone for interaction therewith |
AU2008317383B2 (en) * | 2007-10-23 | 2013-11-14 | Nektar Therapeutics | Hydroxyapatite-targeting multiarm polymers and conjugates made therefrom |
WO2010015938A2 (en) * | 2008-08-05 | 2010-02-11 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Use of agonists of integrin alpha 5 for inducing the osteogenic differentiation of mesenchymal stem cells |
EP2488208B1 (en) * | 2009-10-14 | 2018-11-21 | The Governors of the University of Alberta | Compounds having peptides conjugated to bone targeting moieties and methods of making and using thereof |
WO2014033540A2 (en) * | 2012-08-28 | 2014-03-06 | The Governors Of The University Of Alberta | Parathyroid hormone, insulin, and related peptides conjugated to bone targeting moieties and methods of making and using thereof |
WO2014081864A1 (en) * | 2012-11-20 | 2014-05-30 | Eumederis Pharmaceuticals, Inc. | Improved peptide pharmaceuticals |
US9700633B2 (en) * | 2013-01-28 | 2017-07-11 | Jenkem Technology Co., Ltd., Tianjin Branch | Conjugates of water soluble polymer-amino acid oligopeptide-drug, preparation method and use thereof |
TR201907389T4 (en) * | 2013-10-09 | 2019-06-21 | Fundacio Inst De Recerca Biomedica Irb Barcelona | Method for the prognosis and treatment of bone cancer with metastases caused by breast cancer. |
WO2016196400A1 (en) * | 2015-05-29 | 2016-12-08 | Purdue Research Foundation | Bone fracture repair by targeting of agents that promote bone healing |
WO2017160855A1 (en) * | 2016-03-15 | 2017-09-21 | The Regents Of The University Of California | Bone-targeting therapeutic conjugate and methods of making and using the same |
WO2018102616A1 (en) * | 2016-11-30 | 2018-06-07 | Purdue Research Foundation | Fracture targeted bone regeneration through parathyroid hormone receptor stimulation |
-
2019
- 2019-05-30 WO PCT/US2019/034759 patent/WO2019232280A1/en unknown
- 2019-05-30 US US17/058,891 patent/US20210213135A1/en active Pending
- 2019-05-30 US US17/058,884 patent/US20210214408A1/en not_active Abandoned
- 2019-05-30 WO PCT/US2019/034764 patent/WO2019232283A1/en active Application Filing
- 2019-05-30 EP EP19812242.6A patent/EP3790574A4/en active Pending
- 2019-05-30 US US17/058,887 patent/US20210206820A1/en active Pending
- 2019-05-30 EP EP19812319.2A patent/EP3796941A4/en active Pending
- 2019-05-30 WO PCT/US2019/034767 patent/WO2019232285A1/en unknown
-
2022
- 2022-12-02 US US18/074,275 patent/US20230279068A1/en active Pending
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11773138B2 (en) | 2018-10-12 | 2023-10-03 | Theradaptive, Inc. | Polypeptides including a beta-tricalcium phosphate-binding sequence and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
EP3790574A4 (en) | 2022-07-13 |
US20230279068A1 (en) | 2023-09-07 |
EP3796941A1 (en) | 2021-03-31 |
US20210206820A1 (en) | 2021-07-08 |
WO2019232285A1 (en) | 2019-12-05 |
EP3796941A4 (en) | 2022-12-28 |
WO2019232280A1 (en) | 2019-12-05 |
EP3790574A1 (en) | 2021-03-17 |
WO2019232283A1 (en) | 2019-12-05 |
US20210213135A1 (en) | 2021-07-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230279068A1 (en) | Targeting anabolic drugs for accelerated fracture repair | |
EP0512844B1 (en) | Targeted delivery of bone growth factors | |
US9670258B2 (en) | Positive modulator of bone morphogenic protein-2 | |
US5118667A (en) | Bone growth factors and inhibitors of bone resorption for promoting bone formation | |
Lee | Cytokine delivery and tissue engineering | |
US9333237B2 (en) | Bone morphogenic protein binding peptide | |
US20110034373A1 (en) | Use of an fgf-21 compound and a glp-1 compound for the treatment of obesity | |
US8975231B2 (en) | Bone morphogenic protein binding peptide | |
US6232288B1 (en) | Composition for improving pancreatic function | |
WO2001068125A2 (en) | Methods and compositions for the treatment and prevention of erectile dysfunction | |
Amso et al. | Short anabolic peptides for bone growth | |
JPH07501340A (en) | Drugs that promote nerve growth in mammals | |
JP3945846B2 (en) | Pancreatic function improving agent | |
Javed et al. | Growth factors and guided bone regeneration | |
WO2024053721A1 (en) | Spinal cord injury therapeutic targeting from acute phase to subacute phase | |
WO2021087561A1 (en) | Cytokine or growth factor fusion proteins | |
KR100490817B1 (en) | MP-52 Derived Protein Consisting of 119 Amino Acids and Process for Producting the Same | |
Yoshikawa et al. | The effect of MS-818, newly synthesized pyrimidine compound, on fracture repair |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: PURDUE RESEARCH FOUNDATION, INDIANA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:LOW, PHILIP STEWART;LOW, STEWART A.;NIELSEN, JEFFERY JAY HOWARD;SIGNING DATES FROM 20190516 TO 20190520;REEL/FRAME:054461/0859 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |