US20200399344A1 - Nk cell-directed chimeric proteins - Google Patents
Nk cell-directed chimeric proteins Download PDFInfo
- Publication number
- US20200399344A1 US20200399344A1 US17/017,117 US202017017117A US2020399344A1 US 20200399344 A1 US20200399344 A1 US 20200399344A1 US 202017017117 A US202017017117 A US 202017017117A US 2020399344 A1 US2020399344 A1 US 2020399344A1
- Authority
- US
- United States
- Prior art keywords
- chimeric protein
- domain
- nkg2a
- seq
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108020001507 fusion proteins Proteins 0.000 title claims abstract description 790
- 102000037865 fusion proteins Human genes 0.000 title claims abstract description 790
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 171
- 201000011510 cancer Diseases 0.000 claims abstract description 63
- 238000000034 method Methods 0.000 claims abstract description 50
- 210000004027 cell Anatomy 0.000 claims description 346
- 230000027455 binding Effects 0.000 claims description 250
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 158
- 239000003446 ligand Substances 0.000 claims description 153
- 241000282414 Homo sapiens Species 0.000 claims description 103
- 238000005304 joining Methods 0.000 claims description 66
- 229940045513 CTLA4 antagonist Drugs 0.000 claims description 37
- 239000008194 pharmaceutical composition Substances 0.000 claims description 36
- 210000000822 natural killer cell Anatomy 0.000 claims description 35
- 230000004913 activation Effects 0.000 claims description 31
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 26
- 230000002401 inhibitory effect Effects 0.000 claims description 25
- 230000003993 interaction Effects 0.000 claims description 20
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 19
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 19
- 210000004881 tumor cell Anatomy 0.000 claims description 18
- 230000001506 immunosuppresive effect Effects 0.000 claims description 17
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 15
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 15
- 230000004936 stimulating effect Effects 0.000 claims description 15
- 229920001184 polypeptide Polymers 0.000 claims description 13
- 102100022682 NKG2-A/NKG2-B type II integral membrane protein Human genes 0.000 claims description 12
- 230000000259 anti-tumor effect Effects 0.000 claims description 11
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 claims description 9
- 230000002459 sustained effect Effects 0.000 claims description 9
- 102000004127 Cytokines Human genes 0.000 claims description 8
- 108090000695 Cytokines Proteins 0.000 claims description 8
- 230000005540 biological transmission Effects 0.000 claims description 8
- 230000009467 reduction Effects 0.000 claims description 6
- 210000000225 synapse Anatomy 0.000 claims description 6
- 230000005764 inhibitory process Effects 0.000 claims description 5
- 230000008054 signal transmission Effects 0.000 claims description 5
- 230000004663 cell proliferation Effects 0.000 claims description 4
- 230000002147 killing effect Effects 0.000 claims description 4
- 102100028970 HLA class I histocompatibility antigen, alpha chain E Human genes 0.000 claims description 2
- 230000000873 masking effect Effects 0.000 claims description 2
- 101150069255 KLRC1 gene Proteins 0.000 claims 5
- 101100404845 Macaca mulatta NKG2A gene Proteins 0.000 claims 5
- 102000008203 CTLA-4 Antigen Human genes 0.000 claims 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 claims 1
- 101000986085 Homo sapiens HLA class I histocompatibility antigen, alpha chain E Proteins 0.000 claims 1
- 208000027866 inflammatory disease Diseases 0.000 claims 1
- 238000011282 treatment Methods 0.000 abstract description 77
- 108050001049 Extracellular proteins Proteins 0.000 abstract description 35
- 108091005906 Type I transmembrane proteins Proteins 0.000 abstract description 34
- 108091005956 Type II transmembrane proteins Proteins 0.000 abstract description 32
- 208000036142 Viral infection Diseases 0.000 abstract description 26
- 230000009385 viral infection Effects 0.000 abstract description 26
- 239000000203 mixture Substances 0.000 abstract description 24
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 11
- 201000010099 disease Diseases 0.000 abstract description 9
- 125000005647 linker group Chemical group 0.000 description 229
- 239000003795 chemical substances by application Substances 0.000 description 126
- 108090000623 proteins and genes Proteins 0.000 description 97
- 102000005962 receptors Human genes 0.000 description 92
- 108020003175 receptors Proteins 0.000 description 92
- 235000018102 proteins Nutrition 0.000 description 90
- 102000004169 proteins and genes Human genes 0.000 description 90
- 241000699666 Mus <mouse, genus> Species 0.000 description 89
- 239000003638 chemical reducing agent Substances 0.000 description 85
- 230000022811 deglycosylation Effects 0.000 description 70
- 231100000673 dose–response relationship Toxicity 0.000 description 70
- 241000699670 Mus sp. Species 0.000 description 63
- 230000002829 reductive effect Effects 0.000 description 59
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 54
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 53
- 230000001965 increasing effect Effects 0.000 description 52
- 238000001262 western blot Methods 0.000 description 52
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 46
- 235000001014 amino acid Nutrition 0.000 description 44
- 230000014509 gene expression Effects 0.000 description 44
- 210000001744 T-lymphocyte Anatomy 0.000 description 41
- 238000006467 substitution reaction Methods 0.000 description 39
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 description 38
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 37
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 37
- 239000013642 negative control Substances 0.000 description 36
- 210000003289 regulatory T cell Anatomy 0.000 description 36
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 35
- 230000035772 mutation Effects 0.000 description 35
- 238000012512 characterization method Methods 0.000 description 34
- 102100036008 CD48 antigen Human genes 0.000 description 33
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 33
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 32
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 32
- 238000000684 flow cytometry Methods 0.000 description 30
- 238000012286 ELISA Assay Methods 0.000 description 29
- 229940024606 amino acid Drugs 0.000 description 29
- 150000001413 amino acids Chemical class 0.000 description 27
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 26
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 26
- 239000000539 dimer Substances 0.000 description 25
- 239000012636 effector Substances 0.000 description 25
- 150000007523 nucleic acids Chemical class 0.000 description 25
- 101001109508 Homo sapiens NKG2-A/NKG2-B type II integral membrane protein Proteins 0.000 description 23
- 241001529936 Murinae Species 0.000 description 23
- 125000000539 amino acid group Chemical group 0.000 description 23
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 22
- 230000006870 function Effects 0.000 description 22
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 22
- 108020004707 nucleic acids Proteins 0.000 description 22
- 102000039446 nucleic acids Human genes 0.000 description 22
- FRGKKTITADJNOE-UHFFFAOYSA-N sulfanyloxyethane Chemical compound CCOS FRGKKTITADJNOE-UHFFFAOYSA-N 0.000 description 22
- -1 CD86 Proteins 0.000 description 21
- 102100029197 SLAM family member 6 Human genes 0.000 description 21
- 210000003162 effector t lymphocyte Anatomy 0.000 description 20
- 230000000694 effects Effects 0.000 description 20
- 102000004060 Transforming Growth Factor-beta Type II Receptor Human genes 0.000 description 19
- 108010082684 Transforming Growth Factor-beta Type II Receptor Proteins 0.000 description 19
- 230000011664 signaling Effects 0.000 description 19
- 238000003556 assay Methods 0.000 description 18
- 239000013604 expression vector Substances 0.000 description 17
- 239000000499 gel Substances 0.000 description 17
- 102000057310 human KLRC1 Human genes 0.000 description 16
- 102000035160 transmembrane proteins Human genes 0.000 description 16
- 108091005703 transmembrane proteins Proteins 0.000 description 16
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 15
- 239000000427 antigen Substances 0.000 description 15
- 108091007433 antigens Proteins 0.000 description 15
- 102000036639 antigens Human genes 0.000 description 15
- 239000003814 drug Substances 0.000 description 15
- 238000004519 manufacturing process Methods 0.000 description 15
- 229960003301 nivolumab Drugs 0.000 description 15
- 101000884270 Homo sapiens Natural killer cell receptor 2B4 Proteins 0.000 description 14
- 238000010276 construction Methods 0.000 description 14
- 239000000178 monomer Substances 0.000 description 14
- 238000002965 ELISA Methods 0.000 description 13
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 13
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 13
- 101100166600 Homo sapiens CD28 gene Proteins 0.000 description 12
- 230000007423 decrease Effects 0.000 description 12
- 210000002865 immune cell Anatomy 0.000 description 12
- 210000003071 memory t lymphocyte Anatomy 0.000 description 12
- 239000005089 Luciferase Substances 0.000 description 11
- 241001465754 Metazoa Species 0.000 description 11
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 11
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 11
- 239000012528 membrane Substances 0.000 description 11
- 238000012809 post-inoculation Methods 0.000 description 11
- 235000002639 sodium chloride Nutrition 0.000 description 11
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 10
- 210000004899 c-terminal region Anatomy 0.000 description 10
- 210000000170 cell membrane Anatomy 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 208000015181 infectious disease Diseases 0.000 description 10
- 230000003834 intracellular effect Effects 0.000 description 10
- 210000004379 membrane Anatomy 0.000 description 10
- 230000004044 response Effects 0.000 description 10
- 235000004400 serine Nutrition 0.000 description 10
- 230000000638 stimulation Effects 0.000 description 10
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 9
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 9
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 9
- 210000003719 b-lymphocyte Anatomy 0.000 description 9
- 229960002621 pembrolizumab Drugs 0.000 description 9
- 239000000546 pharmaceutical excipient Substances 0.000 description 9
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 9
- 210000000952 spleen Anatomy 0.000 description 9
- 108010074708 B7-H1 Antigen Proteins 0.000 description 8
- 102000008096 B7-H1 Antigen Human genes 0.000 description 8
- 206010009944 Colon cancer Diseases 0.000 description 8
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 8
- 101000946850 Homo sapiens T-lymphocyte activation antigen CD86 Proteins 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 8
- 239000002202 Polyethylene glycol Substances 0.000 description 8
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 8
- 241000700605 Viruses Species 0.000 description 8
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 8
- 230000006907 apoptotic process Effects 0.000 description 8
- 230000000139 costimulatory effect Effects 0.000 description 8
- 230000028993 immune response Effects 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 238000000338 in vitro Methods 0.000 description 8
- 230000001404 mediated effect Effects 0.000 description 8
- 229920001223 polyethylene glycol Polymers 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 239000013603 viral vector Substances 0.000 description 8
- 101000971513 Homo sapiens Natural killer cells antigen CD94 Proteins 0.000 description 7
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 description 7
- 102100021462 Natural killer cells antigen CD94 Human genes 0.000 description 7
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Chemical group CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 7
- 239000004473 Threonine Chemical group 0.000 description 7
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 7
- 238000013270 controlled release Methods 0.000 description 7
- 230000016396 cytokine production Effects 0.000 description 7
- 230000001419 dependent effect Effects 0.000 description 7
- 208000032839 leukemia Diseases 0.000 description 7
- 230000037361 pathway Effects 0.000 description 7
- 239000013641 positive control Substances 0.000 description 7
- 230000035755 proliferation Effects 0.000 description 7
- 235000013930 proline Nutrition 0.000 description 7
- 150000003839 salts Chemical class 0.000 description 7
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 7
- 235000008521 threonine Nutrition 0.000 description 7
- 239000013598 vector Substances 0.000 description 7
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 6
- 102000018697 Membrane Proteins Human genes 0.000 description 6
- 108010052285 Membrane Proteins Proteins 0.000 description 6
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 6
- 210000000612 antigen-presenting cell Anatomy 0.000 description 6
- 230000008901 benefit Effects 0.000 description 6
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 239000013078 crystal Substances 0.000 description 6
- 210000004443 dendritic cell Anatomy 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 239000002552 dosage form Substances 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 230000002708 enhancing effect Effects 0.000 description 6
- 238000009169 immunotherapy Methods 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 210000001165 lymph node Anatomy 0.000 description 6
- 210000004698 lymphocyte Anatomy 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 239000004475 Arginine Chemical group 0.000 description 5
- 102100036301 C-C chemokine receptor type 7 Human genes 0.000 description 5
- 102100027207 CD27 antigen Human genes 0.000 description 5
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 5
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 5
- 101000716065 Homo sapiens C-C chemokine receptor type 7 Proteins 0.000 description 5
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 5
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 5
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 5
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 5
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 5
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 5
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 238000000692 Student's t-test Methods 0.000 description 5
- 230000002159 abnormal effect Effects 0.000 description 5
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Chemical group OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 5
- 235000009697 arginine Nutrition 0.000 description 5
- 230000000903 blocking effect Effects 0.000 description 5
- 201000010989 colorectal carcinoma Diseases 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 210000002950 fibroblast Anatomy 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000002496 gastric effect Effects 0.000 description 5
- 230000013595 glycosylation Effects 0.000 description 5
- 238000006206 glycosylation reaction Methods 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 102000046571 human SLAMF6 Human genes 0.000 description 5
- 210000005260 human cell Anatomy 0.000 description 5
- 230000002519 immonomodulatory effect Effects 0.000 description 5
- 210000000987 immune system Anatomy 0.000 description 5
- 230000001939 inductive effect Effects 0.000 description 5
- 230000008595 infiltration Effects 0.000 description 5
- 238000001764 infiltration Methods 0.000 description 5
- 210000003292 kidney cell Anatomy 0.000 description 5
- 210000000265 leukocyte Anatomy 0.000 description 5
- 230000000670 limiting effect Effects 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 210000004185 liver Anatomy 0.000 description 5
- 229920002521 macromolecule Polymers 0.000 description 5
- 210000004962 mammalian cell Anatomy 0.000 description 5
- 230000001105 regulatory effect Effects 0.000 description 5
- 238000007619 statistical method Methods 0.000 description 5
- 210000000130 stem cell Anatomy 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- 241000701161 unidentified adenovirus Species 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- 238000011144 upstream manufacturing Methods 0.000 description 5
- 108010084313 CD58 Antigens Proteins 0.000 description 4
- 102000047934 Caspase-3/7 Human genes 0.000 description 4
- 108700037887 Caspase-3/7 Proteins 0.000 description 4
- 241000282693 Cercopithecidae Species 0.000 description 4
- 101000609767 Dromaius novaehollandiae Ovalbumin Proteins 0.000 description 4
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 4
- 101000712669 Homo sapiens TGF-beta receptor type-2 Proteins 0.000 description 4
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- 102100033467 L-selectin Human genes 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 206010025323 Lymphomas Diseases 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 101100519207 Mus musculus Pdcd1 gene Proteins 0.000 description 4
- 230000006052 T cell proliferation Effects 0.000 description 4
- 102100034924 T-lymphocyte activation antigen CD86 Human genes 0.000 description 4
- 238000004873 anchoring Methods 0.000 description 4
- 229960005395 cetuximab Drugs 0.000 description 4
- 210000001072 colon Anatomy 0.000 description 4
- 229940127089 cytotoxic agent Drugs 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- 102000046585 human CD48 Human genes 0.000 description 4
- 102000054189 human CD80 Human genes 0.000 description 4
- 102000049849 human CD86 Human genes 0.000 description 4
- 102000048362 human PDCD1 Human genes 0.000 description 4
- 102000054783 human TGFBR2 Human genes 0.000 description 4
- 230000001900 immune effect Effects 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 230000010354 integration Effects 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 210000001616 monocyte Anatomy 0.000 description 4
- 229960003347 obinutuzumab Drugs 0.000 description 4
- 229940124531 pharmaceutical excipient Drugs 0.000 description 4
- 230000003248 secreting effect Effects 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 210000004988 splenocyte Anatomy 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 238000013268 sustained release Methods 0.000 description 4
- 239000012730 sustained-release form Substances 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 3
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 3
- ALYNCZNDIQEVRV-UHFFFAOYSA-N 4-aminobenzoic acid Chemical compound NC1=CC=C(C(O)=O)C=C1 ALYNCZNDIQEVRV-UHFFFAOYSA-N 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 101710149863 C-C chemokine receptor type 4 Proteins 0.000 description 3
- 108090000342 C-Type Lectins Proteins 0.000 description 3
- 102000003930 C-Type Lectins Human genes 0.000 description 3
- 102100032976 CCR4-NOT transcription complex subunit 6 Human genes 0.000 description 3
- 102100032912 CD44 antigen Human genes 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- 241000699802 Cricetulus griseus Species 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 101100273713 Homo sapiens CD2 gene Proteins 0.000 description 3
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 206010062016 Immunosuppression Diseases 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 108090000174 Interleukin-10 Proteins 0.000 description 3
- 108050003558 Interleukin-17 Proteins 0.000 description 3
- 102000013691 Interleukin-17 Human genes 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 108090000978 Interleukin-4 Proteins 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 3
- 102100031778 SH2 domain-containing protein 1B Human genes 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- 206010041067 Small cell lung cancer Diseases 0.000 description 3
- 108700026226 TATA Box Proteins 0.000 description 3
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 3
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 3
- 101710116241 Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 3
- 102100033019 Tyrosine-protein phosphatase non-receptor type 11 Human genes 0.000 description 3
- 101710183617 Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 3
- 230000001093 anti-cancer Effects 0.000 description 3
- 230000000840 anti-viral effect Effects 0.000 description 3
- 230000002155 anti-virotic effect Effects 0.000 description 3
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Chemical group OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 210000000481 breast Anatomy 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 238000011161 development Methods 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 238000006471 dimerization reaction Methods 0.000 description 3
- 230000004064 dysfunction Effects 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000004554 glutamine Nutrition 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Chemical group OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 235000014304 histidine Nutrition 0.000 description 3
- 108091008042 inhibitory receptors Proteins 0.000 description 3
- 239000007928 intraperitoneal injection Substances 0.000 description 3
- 208000002551 irritable bowel syndrome Diseases 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 210000005229 liver cell Anatomy 0.000 description 3
- 210000003563 lymphoid tissue Anatomy 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 208000037819 metastatic cancer Diseases 0.000 description 3
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 3
- 210000000581 natural killer T-cell Anatomy 0.000 description 3
- 210000000440 neutrophil Anatomy 0.000 description 3
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 229950010773 pidilizumab Drugs 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 125000001500 prolyl group Chemical class [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 3
- 230000001737 promoting effect Effects 0.000 description 3
- 230000005180 public health Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- JARGNLJYKBUKSJ-KGZKBUQUSA-N (2r)-2-amino-5-[[(2r)-1-(carboxymethylamino)-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid;hydrobromide Chemical compound Br.OC(=O)[C@H](N)CCC(=O)N[C@H](CO)C(=O)NCC(O)=O JARGNLJYKBUKSJ-KGZKBUQUSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- WLKSPGHQGFFKGE-UHFFFAOYSA-N 1-chloropropan-2-yl n-(3-chlorophenyl)carbamate Chemical compound ClCC(C)OC(=O)NC1=CC=CC(Cl)=C1 WLKSPGHQGFFKGE-UHFFFAOYSA-N 0.000 description 2
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 2
- 108010082808 4-1BB Ligand Proteins 0.000 description 2
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical class NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 2
- 108090000672 Annexin A5 Proteins 0.000 description 2
- 102000004121 Annexin A5 Human genes 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 102100036305 C-C chemokine receptor type 8 Human genes 0.000 description 2
- 102100028990 C-X-C chemokine receptor type 3 Human genes 0.000 description 2
- 102000010910 CD28 Antigens Human genes 0.000 description 2
- 108010062433 CD28 Antigens Proteins 0.000 description 2
- 108091033409 CRISPR Proteins 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 241000557626 Corvus corax Species 0.000 description 2
- 206010012735 Diarrhoea Diseases 0.000 description 2
- 206010014611 Encephalitis venezuelan equine Diseases 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 206010014759 Endometrial neoplasm Diseases 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 241000710781 Flaviviridae Species 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 101000716063 Homo sapiens C-C chemokine receptor type 8 Proteins 0.000 description 2
- 101000916050 Homo sapiens C-X-C chemokine receptor type 3 Proteins 0.000 description 2
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 2
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 2
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 2
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 2
- 101000707218 Homo sapiens SH2 domain-containing protein 1B Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 2
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102100022338 Integrin alpha-M Human genes 0.000 description 2
- 108090000176 Interleukin-13 Proteins 0.000 description 2
- 108010002616 Interleukin-5 Proteins 0.000 description 2
- 101150074862 KLRC3 gene Proteins 0.000 description 2
- 101150018199 KLRC4 gene Proteins 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical group C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical group NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical group OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- 241000713666 Lentivirus Species 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 2
- 239000004472 Lysine Chemical group 0.000 description 2
- 210000004322 M2 macrophage Anatomy 0.000 description 2
- 108091054437 MHC class I family Proteins 0.000 description 2
- 102000043129 MHC class I family Human genes 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 241000713333 Mouse mammary tumor virus Species 0.000 description 2
- 101100260263 Mus musculus Tgfbr2 gene Proteins 0.000 description 2
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 2
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 2
- 102100022701 NKG2-E type II integral membrane protein Human genes 0.000 description 2
- 102100022700 NKG2-F type II integral membrane protein Human genes 0.000 description 2
- 102000004473 OX40 Ligand Human genes 0.000 description 2
- 108010042215 OX40 Ligand Proteins 0.000 description 2
- 102000038030 PI3Ks Human genes 0.000 description 2
- 108091007960 PI3Ks Proteins 0.000 description 2
- 208000002193 Pain Diseases 0.000 description 2
- 101710161551 Pectate lyase 3 Proteins 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 241000710961 Semliki Forest virus Species 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 230000006044 T cell activation Effects 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 102100025946 Transforming growth factor beta activator LRRC32 Human genes 0.000 description 2
- 102000008579 Transposases Human genes 0.000 description 2
- 108010020764 Transposases Proteins 0.000 description 2
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 2
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 208000002687 Venezuelan Equine Encephalomyelitis Diseases 0.000 description 2
- 201000009145 Venezuelan equine encephalitis Diseases 0.000 description 2
- 108700005077 Viral Genes Proteins 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 239000002269 analeptic agent Substances 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 229960003852 atezolizumab Drugs 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 229940000635 beta-alanine Drugs 0.000 description 2
- 238000012575 bio-layer interferometry Methods 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000002981 blocking agent Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 210000001185 bone marrow Anatomy 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 210000003690 classically activated macrophage Anatomy 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 238000002648 combination therapy Methods 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- XVOYSCVBGLVSOL-UHFFFAOYSA-N cysteic acid Chemical class OC(=O)C(N)CS(O)(=O)=O XVOYSCVBGLVSOL-UHFFFAOYSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 229960002204 daratumumab Drugs 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 2
- 210000002744 extracellular matrix Anatomy 0.000 description 2
- 210000000887 face Anatomy 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000003325 follicular Effects 0.000 description 2
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 2
- 108010044804 gamma-glutamyl-seryl-glycine Proteins 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 229940057296 gatipotuzumab Drugs 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 150000002333 glycines Chemical class 0.000 description 2
- 210000003714 granulocyte Anatomy 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 239000000833 heterodimer Substances 0.000 description 2
- 229940126546 immune checkpoint molecule Drugs 0.000 description 2
- 210000005008 immunosuppressive cell Anatomy 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 229950005015 inebilizumab Drugs 0.000 description 2
- 229940050282 inebilizumab-cdon Drugs 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 238000011081 inoculation Methods 0.000 description 2
- 108040002039 interleukin-15 receptor activity proteins Proteins 0.000 description 2
- 102000008616 interleukin-15 receptor activity proteins Human genes 0.000 description 2
- 108010074109 interleukin-22 Proteins 0.000 description 2
- 230000000968 intestinal effect Effects 0.000 description 2
- 229960005386 ipilimumab Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Chemical group CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 235000014705 isoleucine Nutrition 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000001926 lymphatic effect Effects 0.000 description 2
- 235000018977 lysine Nutrition 0.000 description 2
- 229950003135 margetuximab Drugs 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 229950007699 mogamulizumab Drugs 0.000 description 2
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 2
- 229950009090 ocaratuzumab Drugs 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000003285 pharmacodynamic effect Effects 0.000 description 2
- 230000002974 pharmacogenomic effect Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Chemical group OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 108010026466 polyproline Proteins 0.000 description 2
- 208000017805 post-transplant lymphoproliferative disease Diseases 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000000770 proinflammatory effect Effects 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 239000012857 radioactive material Substances 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 229960004641 rituximab Drugs 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 208000011581 secondary neoplasm Diseases 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 238000009097 single-agent therapy Methods 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 210000002536 stromal cell Anatomy 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 229940121503 tafasitamab Drugs 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 229940066453 tecentriq Drugs 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 210000001541 thymus gland Anatomy 0.000 description 2
- 229940060960 tomuzotuximab Drugs 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 229960000575 trastuzumab Drugs 0.000 description 2
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 2
- 210000004981 tumor-associated macrophage Anatomy 0.000 description 2
- 229950004593 ublituximab Drugs 0.000 description 2
- 229950005972 urelumab Drugs 0.000 description 2
- 229940055760 yervoy Drugs 0.000 description 2
- FDKWRPBBCBCIGA-REOHCLBHSA-N (2r)-2-azaniumyl-3-$l^{1}-selanylpropanoate Chemical compound [Se]C[C@H](N)C(O)=O FDKWRPBBCBCIGA-REOHCLBHSA-N 0.000 description 1
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical class OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 1
- MRTPISKDZDHEQI-YFKPBYRVSA-N (2s)-2-(tert-butylamino)propanoic acid Chemical class OC(=O)[C@H](C)NC(C)(C)C MRTPISKDZDHEQI-YFKPBYRVSA-N 0.000 description 1
- NPDBDJFLKKQMCM-SCSAIBSYSA-N (2s)-2-amino-3,3-dimethylbutanoic acid Chemical class CC(C)(C)[C@H](N)C(O)=O NPDBDJFLKKQMCM-SCSAIBSYSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- 208000002008 AIDS-Related Lymphoma Diseases 0.000 description 1
- 102100031315 AP-2 complex subunit mu Human genes 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 235000006491 Acacia senegal Nutrition 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 101001094887 Ambrosia artemisiifolia Pectate lyase 1 Proteins 0.000 description 1
- 101001123576 Ambrosia artemisiifolia Pectate lyase 2 Proteins 0.000 description 1
- 101001123572 Ambrosia artemisiifolia Pectate lyase 3 Proteins 0.000 description 1
- 101000573177 Ambrosia artemisiifolia Pectate lyase 5 Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Chemical group OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010055113 Breast cancer metastatic Diseases 0.000 description 1
- 102100024167 C-C chemokine receptor type 3 Human genes 0.000 description 1
- 101710149862 C-C chemokine receptor type 3 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101710149870 C-C chemokine receptor type 5 Proteins 0.000 description 1
- 102100025074 C-C chemokine receptor-like 2 Human genes 0.000 description 1
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 1
- 102100025618 C-X-C chemokine receptor type 6 Human genes 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 229940123189 CD40 agonist Drugs 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 208000009458 Carcinoma in Situ Diseases 0.000 description 1
- 206010007559 Cardiac failure congestive Diseases 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102100023321 Ceruloplasmin Human genes 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 208000006332 Choriocarcinoma Diseases 0.000 description 1
- 208000005443 Circulating Neoplastic Cells Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 206010055114 Colon cancer metastatic Diseases 0.000 description 1
- 206010056370 Congestive cardiomyopathy Diseases 0.000 description 1
- 206010010774 Constipation Diseases 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 101710093674 Cyclic nucleotide-gated cation channel beta-1 Proteins 0.000 description 1
- 101710112752 Cytotoxin Proteins 0.000 description 1
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000252212 Danio rerio Species 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- 201000010046 Dilated cardiomyopathy Diseases 0.000 description 1
- 208000027244 Dysbiosis Diseases 0.000 description 1
- 102100029722 Ectonucleoside triphosphate diphosphohydrolase 1 Human genes 0.000 description 1
- 241000709661 Enterovirus Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 1
- 108010001498 Galectin 1 Proteins 0.000 description 1
- 102100021736 Galectin-1 Human genes 0.000 description 1
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000001398 Granzyme Human genes 0.000 description 1
- 108060005986 Granzyme Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 101710197873 HLA class I histocompatibility antigen, alpha chain E Proteins 0.000 description 1
- 101150031823 HSP70 gene Proteins 0.000 description 1
- 206010066476 Haematological malignancy Diseases 0.000 description 1
- 101100508941 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) ppa gene Proteins 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 101710083479 Hepatitis A virus cellular receptor 2 homolog Proteins 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000796047 Homo sapiens AP-2 complex subunit mu Proteins 0.000 description 1
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000716068 Homo sapiens C-C chemokine receptor type 6 Proteins 0.000 description 1
- 101000856683 Homo sapiens C-X-C chemokine receptor type 6 Proteins 0.000 description 1
- 101001012447 Homo sapiens Ectonucleoside triphosphate diphosphohydrolase 1 Proteins 0.000 description 1
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 1
- 101000916628 Homo sapiens Macrophage colony-stimulating factor 1 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000785887 Homo sapiens Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform Proteins 0.000 description 1
- 101000652359 Homo sapiens Spermatogenesis-associated protein 2 Proteins 0.000 description 1
- 101001004924 Homo sapiens Transforming growth factor beta activator LRRC32 Proteins 0.000 description 1
- 101000679903 Homo sapiens Tumor necrosis factor receptor superfamily member 25 Proteins 0.000 description 1
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000342334 Human metapneumovirus Species 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical class O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102100026214 Indian hedgehog protein Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 102100021244 Integral membrane protein GPR180 Human genes 0.000 description 1
- 208000005045 Interdigitating dendritic cell sarcoma Diseases 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102100036672 Interleukin-23 receptor Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical class CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical class NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical class OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical class NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- XIGSAGMEBXLVJJ-YFKPBYRVSA-N L-homocitrulline Chemical class NC(=O)NCCCC[C@H]([NH3+])C([O-])=O XIGSAGMEBXLVJJ-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical group CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Chemical class CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical class CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- ZFOMKMMPBOQKMC-KXUCPTDWSA-N L-pyrrolysine Chemical compound C[C@@H]1CC=N[C@H]1C(=O)NCCCC[C@H]([NH3+])C([O-])=O ZFOMKMMPBOQKMC-KXUCPTDWSA-N 0.000 description 1
- 102000016551 L-selectin Human genes 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical group C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 239000002177 L01XE27 - Ibrutinib Substances 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 208000006552 Lewis Lung Carcinoma Diseases 0.000 description 1
- NNJVILVZKWQKPM-UHFFFAOYSA-N Lidocaine Chemical compound CCN(CC)CC(=O)NC1=C(C)C=CC=C1C NNJVILVZKWQKPM-UHFFFAOYSA-N 0.000 description 1
- 206010025312 Lymphoma AIDS related Diseases 0.000 description 1
- 208000030289 Lymphoproliferative disease Diseases 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 101710091439 Major capsid protein 1 Proteins 0.000 description 1
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 1
- 208000001826 Marfan syndrome Diseases 0.000 description 1
- 108091027974 Mature messenger RNA Proteins 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 208000006395 Meigs Syndrome Diseases 0.000 description 1
- 206010027139 Meigs' syndrome Diseases 0.000 description 1
- 102000012750 Membrane Glycoproteins Human genes 0.000 description 1
- 108010090054 Membrane Glycoproteins Proteins 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 1
- 206010028116 Mucosal inflammation Diseases 0.000 description 1
- 201000010927 Mucositis Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 101100153533 Mus musculus Ltbr gene Proteins 0.000 description 1
- 101001117316 Mus musculus Programmed cell death 1 ligand 1 Proteins 0.000 description 1
- 101100042691 Mus musculus Slamf6 gene Proteins 0.000 description 1
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 101000863875 Mus musculus Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- PYUSHNKNPOHWEZ-YFKPBYRVSA-N N-formyl-L-methionine Chemical compound CSCC[C@@H](C(O)=O)NC=O PYUSHNKNPOHWEZ-YFKPBYRVSA-N 0.000 description 1
- 102000015223 NK Cell Lectin-Like Receptors Human genes 0.000 description 1
- 108010039435 NK Cell Lectin-Like Receptors Proteins 0.000 description 1
- 230000006051 NK cell activation Effects 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 208000003788 Neoplasm Micrometastasis Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 102100028762 Neuropilin-1 Human genes 0.000 description 1
- 108090000772 Neuropilin-1 Proteins 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Chemical class NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Chemical class OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 241000150452 Orthohantavirus Species 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 240000007019 Oxalis corniculata Species 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 208000009608 Papillomavirus Infections Diseases 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 241000711504 Paramyxoviridae Species 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 241000150350 Peribunyaviridae Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 206010048734 Phakomatosis Diseases 0.000 description 1
- 108090000430 Phosphatidylinositol 3-kinases Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 208000037062 Polyps Diseases 0.000 description 1
- 108050000258 Prostaglandin D receptors Proteins 0.000 description 1
- 102100024218 Prostaglandin D2 receptor 2 Human genes 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 1
- 102000012515 Protein kinase domains Human genes 0.000 description 1
- 108050002122 Protein kinase domains Proteins 0.000 description 1
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 1
- 102000009572 RNA Polymerase II Human genes 0.000 description 1
- 108010009460 RNA Polymerase II Proteins 0.000 description 1
- 230000006819 RNA synthesis Effects 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 206010070308 Refractory cancer Diseases 0.000 description 1
- 241000702247 Reoviridae Species 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 241000712907 Retroviridae Species 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 241001533467 Rubulavirus Species 0.000 description 1
- 101710097986 SH2 domain-containing protein 1B Proteins 0.000 description 1
- 102000014400 SH2 domains Human genes 0.000 description 1
- 108050003452 SH2 domains Proteins 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 102100026282 Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform Human genes 0.000 description 1
- 102000010841 Signaling Lymphocytic Activation Molecule Family Human genes 0.000 description 1
- 108010062314 Signaling Lymphocytic Activation Molecule Family Proteins 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 241000710888 St. Louis encephalitis virus Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 230000005867 T cell response Effects 0.000 description 1
- 229940126547 T-cell immunoglobulin mucin-3 Drugs 0.000 description 1
- 210000000662 T-lymphocyte subset Anatomy 0.000 description 1
- 238000010459 TALEN Methods 0.000 description 1
- 102100033456 TGF-beta receptor type-1 Human genes 0.000 description 1
- 101710084191 TGF-beta receptor type-1 Proteins 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 210000000068 Th17 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 description 1
- 101710169732 Transforming growth factor beta activator LRRC32 Proteins 0.000 description 1
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Chemical group C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 1
- 108090000138 Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 description 1
- 102100022203 Tumor necrosis factor receptor superfamily member 25 Human genes 0.000 description 1
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 244000000188 Vaccinium ovalifolium Species 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000021017 Weight Gain Diseases 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- 208000033779 X-linked lymphoproliferative disease Diseases 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 229960004050 aminobenzoic acid Drugs 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- 230000003444 anaesthetic effect Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000005809 anti-tumor immunity Effects 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 208000007474 aortic aneurysm Diseases 0.000 description 1
- 230000004596 appetite loss Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 230000010455 autoregulation Effects 0.000 description 1
- 239000012752 auxiliary agent Substances 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- XMQFTWRPUQYINF-UHFFFAOYSA-N bensulfuron-methyl Chemical compound COC(=O)C1=CC=CC=C1CS(=O)(=O)NC(=O)NC1=NC(OC)=CC(OC)=N1 XMQFTWRPUQYINF-UHFFFAOYSA-N 0.000 description 1
- 230000002457 bidirectional effect Effects 0.000 description 1
- 201000009036 biliary tract cancer Diseases 0.000 description 1
- 208000020790 biliary tract neoplasm Diseases 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 201000000220 brain stem cancer Diseases 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000025084 cell cycle arrest Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 230000010001 cellular homeostasis Effects 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229940121420 cemiplimab Drugs 0.000 description 1
- 201000007455 central nervous system cancer Diseases 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000012539 chromatography resin Substances 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- 239000012459 cleaning agent Substances 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 239000008119 colloidal silica Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 201000010918 connective tissue cancer Diseases 0.000 description 1
- 239000000599 controlled substance Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- NKLPQNGYXWVELD-UHFFFAOYSA-M coomassie brilliant blue Chemical compound [Na+].C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=2C=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S([O-])(=O)=O)C=C1 NKLPQNGYXWVELD-UHFFFAOYSA-M 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 238000012866 crystallographic experiment Methods 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 230000006240 deamidation Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Chemical class OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 229940126534 drug product Drugs 0.000 description 1
- 238000007908 dry granulation Methods 0.000 description 1
- 230000007140 dysbiosis Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 210000003979 eosinophil Anatomy 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000001400 expression cloning Methods 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 206010016766 flatulence Diseases 0.000 description 1
- 235000013312 flour Nutrition 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 238000001298 force spectroscopy Methods 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 238000003881 globally optimized alternating phase rectangular pulse Methods 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Chemical group 0.000 description 1
- 125000000404 glutamine group Chemical group N[C@@H](CCC(N)=O)C(=O)* 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 201000009277 hairy cell leukemia Diseases 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 102000048338 human CD244 Human genes 0.000 description 1
- 102000053925 human CSF1 Human genes 0.000 description 1
- 102000043321 human CTLA4 Human genes 0.000 description 1
- 210000003917 human chromosome Anatomy 0.000 description 1
- 230000004727 humoral immunity Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 229960001507 ibrutinib Drugs 0.000 description 1
- XYFPWWZEPKGCCK-GOSISDBHSA-N ibrutinib Chemical compound C1=2C(N)=NC=NC=2N([C@H]2CN(CCC2)C(=O)C=C)N=C1C(C=C1)=CC=C1OC1=CC=CC=C1 XYFPWWZEPKGCCK-GOSISDBHSA-N 0.000 description 1
- 230000008102 immune modulation Effects 0.000 description 1
- 230000008073 immune recognition Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000005917 in vivo anti-tumor Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 108091005434 innate immune receptors Proteins 0.000 description 1
- 150000007529 inorganic bases Chemical class 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 108040006732 interleukin-1 receptor activity proteins Proteins 0.000 description 1
- 102000014909 interleukin-1 receptor activity proteins Human genes 0.000 description 1
- 108040003610 interleukin-12 receptor activity proteins Proteins 0.000 description 1
- 108040001844 interleukin-23 receptor activity proteins Proteins 0.000 description 1
- 108040007659 interleukin-33 receptor activity proteins Proteins 0.000 description 1
- 108040006852 interleukin-4 receptor activity proteins Proteins 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 201000004962 larynx cancer Diseases 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 229960004194 lidocaine Drugs 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 210000000088 lip Anatomy 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 239000003589 local anesthetic agent Substances 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 230000001050 lubricating effect Effects 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 201000005202 lung cancer Diseases 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000001365 lymphatic vessel Anatomy 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 230000001589 lymphoproliferative effect Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 201000006512 mast cell neoplasm Diseases 0.000 description 1
- 208000006971 mastocytoma Diseases 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 210000003593 megakaryocyte Anatomy 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- 108020004084 membrane receptors Proteins 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 229930182817 methionine Chemical group 0.000 description 1
- 125000000250 methylamino group Chemical group [H]N(*)C([H])([H])[H] 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 108091005763 multidomain proteins Proteins 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 210000003643 myeloid progenitor cell Anatomy 0.000 description 1
- 238000001426 native polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920005615 natural polymer Polymers 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 230000006654 negative regulation of apoptotic process Effects 0.000 description 1
- 108010068617 neonatal Fc receptor Proteins 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 201000001119 neuropathy Diseases 0.000 description 1
- 230000007823 neuropathy Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 210000004882 non-tumor cell Anatomy 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 201000005443 oral cavity cancer Diseases 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000003668 pericyte Anatomy 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 210000003800 pharynx Anatomy 0.000 description 1
- 101150009573 phoA gene Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 229940071643 prefilled syringe Drugs 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000001686 pro-survival effect Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000009465 prokaryotic expression Effects 0.000 description 1
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 1
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 101150079601 recA gene Proteins 0.000 description 1
- 239000000018 receptor agonist Substances 0.000 description 1
- 229940044601 receptor agonist Drugs 0.000 description 1
- 230000010837 receptor-mediated endocytosis Effects 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 230000009711 regulatory function Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 210000002955 secretory cell Anatomy 0.000 description 1
- 235000016491 selenocysteine Nutrition 0.000 description 1
- 229940055619 selenocysteine Drugs 0.000 description 1
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- 239000004017 serum-free culture medium Substances 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 102000035087 single-pass transmembrane proteins Human genes 0.000 description 1
- 108091005496 single-pass transmembrane proteins Proteins 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 208000017572 squamous cell neoplasm Diseases 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 231100000617 superantigen Toxicity 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 231100000440 toxicity profile Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Chemical class ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 229940099456 transforming growth factor beta 1 Drugs 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000004222 uncontrolled growth Effects 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 210000001835 viscera Anatomy 0.000 description 1
- 230000008673 vomiting Effects 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000005550 wet granulation Methods 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70539—MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- sequence listing This application contains a sequence listing. It has been submitted electronically via EFS-Web as an ASCII text file entitled “SHK-016PC_SequenceListing_ST25”. The sequence listing is 128,123 bytes in size, and was prepared on or about May 15, 2020. The sequence listing is hereby incorporated by reference in its entirety.
- the present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and viral infection.
- NK cells Natural killer cells.
- NK cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation.
- NK cells There remains an unmet need for therapeutics that block immune inhibitory signals originating from a cancer cell or a virus-infected cell and/or prevent reception of inhibitory signals by an NK cell.
- the present invention provides for compositions and methods that are useful for cancer and antiviral immunotherapy.
- the present invention in part, relates to specific chimeric proteins that simultaneously block immune inhibitory signals originating from a cancer cell or a virus-infected cell and preventing reception of inhibitory signals by an NK cell. Accordingly, the present compositions and methods overcome various deficiencies in the field of cancer and antiviral immunotherapy.
- the present invention is based, in part, on the discovery that chimeric proteins can be engineered comprising a portion of the extracellular domain of a Type I transmembrane protein or a portion of a membrane-anchored extracellular protein and the extracellular domain of a Type II transmembrane protein in which the Type II transmembrane protein is naturally expressed on the surface of a Natural Killer (NK) cell.
- chimeric proteins can inhibit transmission and/or reception of immunosuppressive signals.
- the Type I transmembrane protein end of a chimeric protein disrupts, blocks, reduces, inhibits and/or sequesters the transmission of immune inhibitory signals, e.g., originating from a cancer cell or a virus-infected cell that is attempting to avoid its detection and/or destruction.
- the Type I transmembrane protein may provide an immune-stimulatory signal that increases the activity of another immune cell.
- the Type II transmembrane protein end of a chimeric protein disrupts, blocks, reduces, inhibits and/or sequesters the inhibitory signals thereby preventing their reception by an NK cell. Together, these two actions allow for an anti-cancer attack or an attack of a virus-infected cell by the NK cell.
- An aspect of the present invention is a chimeric protein of a general structure of: N terminus-(a)-(b)-(c)-C terminus, where (a) is a first domain comprising a portion of the extracellular domain of a Type I transmembrane protein or a portion of a membrane-anchored extracellular protein, (b) is a linker adjoining the first and second domains, and (c) is a second domain comprising a portion of the extracellular domain of a Type II transmembrane protein, wherein the Type II transmembrane protein is naturally expressed on the surface of a Natural Killer (NK) cell.
- NK Natural Killer
- Another aspect of the present invention is a chimeric protein of a general structure of: N terminus-(a)-(b)-(c)-C terminus, where (c) comprises a portion of NKG2A that is capable of binding an NKG2A ligand.
- the present invention provides a chimeric protein of a general structure of: N terminus-(a)-(b)-(c)-C terminus, where (a) is a first domain comprising a portion of the extracellular domain of a Type I transmembrane protein or a portion of a membrane-anchored extracellular protein, (b) is a linker adjoining the first and second domains, and (c) is a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand.
- Another aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of CD80 that is capable of binding a CD80 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- Yet another aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of CD86 that is capable of binding a CD86 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the present invention provides a chimeric protein comprising: (a) a first domain comprising a portion of CD48 that is capable of binding a CD48 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the present invention provides a chimeric protein comprising: (a) a first domain comprising a portion of CD58 that is capable of binding a CD58 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the present invention provides a chimeric protein comprising: (a) a first domain comprising a portion of PD-1 that is capable of binding a PD-1 ligand, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- An aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of SLAMF6 that is capable of binding a SLAMF6 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- An aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of SIRP ⁇ that is capable of binding a SIRP ⁇ ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- Another aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of TGFBR2 that is capable of binding a TGFBR2 ligand, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- An aspect of the present invention is the use of a herein-disclosed chimeric protein as a medicament in the treatment of a cancer or a viral infection.
- Another aspect of the present invention is the use of a herein-disclosed chimeric protein, in the manufacture of a medicament.
- Yet another aspect of the present invention is an expression vector comprising a nucleic acid that encodes a herein-disclosed chimeric protein.
- the present invention provides a host cell comprising an expression vector that comprises a nucleic acid that encodes a herein-disclosed chimeric protein.
- the present invention provides a pharmaceutical composition comprising a therapeutically effective amount of a herein-disclosed chimeric protein.
- the present invention provides a method of treating a cancer or treating a viral infection, comprising administering to a subject in need thereof an effective amount of a pharmaceutical composition comprising a therapeutically effective amount of a herein-disclosed chimeric protein.
- FIG. 1A shows schematic illustrations of Type I transmembrane proteins (left protein) and Type II transmembrane proteins (right protein).
- FIG. 1B shows two membrane-anchored extracellular proteins, with the curved lines represents the anchoring domains; the left protein has its carboxy terminus anchored to the cell membrane and the right protein has its amino terminus anchored to the cell membrane.
- FIG. 1C and FIG. 1D show illustrations of chimeric proteins of the present invention; there, linkers connect the two extracellular binding domains.
- FIG. 2A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse CD86-Fc-NKG2A (mCD86-Fc-NKG2A).
- FIG. 2B are Western blots showing characterization of the mCD86-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mCD86-Fc-NKG2A chimeric protein, were loaded into lane 2 in all the blots.
- Samples in lane 3 were treated with a reducing agent, 3-mercaptoethanol, and were boiled.
- Samples in lane 4 were treated with a deglycosylation agent, the reducing agent, and were boiled.
- Each lane 1 included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-NKG2A antibody (left blot), an anti-Fc antibody (center blot), or an anti-CD86 antibody (right blot).
- FIG. 3A to FIG. 3C show ELISA assays demonstrating the binding affinity of the Fc domain of mCD86-Fc-NKG2A ( FIG. 3A ), the NKG2A domain mCD86-Fc-NKG2A ( FIG. 3B ), and the CD86 domain of mCD86-Fc-NKG2A ( FIG. 3C ) for their respective binding partners.
- FIG. 4A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse CD80-Fc-NKG2A (mCD80-Fc-NKG2A).
- FIG. 4B are Western blots showing characterization of the mCD80-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mCD80-Fc-NKG2A chimeric protein, were loaded into lane 2 in all the blots.
- Samples in lane 3 were treated with a reducing agent, 3-mercaptoethanol, and were boiled.
- Samples in lane 4 were treated with a deglycosylation agent, the reducing agent, and were boiled.
- Each lane 1 included the protein size ladder.
- the two ECD domains of the chimeric protein was probed using an anti-NKG2A antibody (left blot) or an anti-CD80 antibody (right blot).
- FIG. 5A to FIG. 5D show ELISA assays demonstrating the binding affinity of the Fc domain of mCD80-Fc-NKG2A ( FIG. 5A ), the NKG2A domain mCD80-Fc-NKG2A ( FIG. 5B ), and the CD80 domain of mCD80-Fc-NKG2A (FIG. 5 C and FIG. 5D ) for their respective binding partners.
- FIG. 5C the CD80 domain of mCD80-Fc-NKG2A chimeric protein was bound to CD28 and in FIG. 5D , the CD80 domain of mCD80-Fc-NKG2A chimeric protein was bound to CTLA-4.
- FIG. 6A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse CD48-Fc-NKG2A (mCD48-Fc-NKG2A).
- FIG. 6B are Western blots showing characterization of the mCD48-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mCD48-Fc-NKG2A chimeric protein, were loaded into lane 2 in all the blots.
- Samples in lane 3 were treated with a reducing agent, 3-mercaptoethanol, and were boiled.
- Samples in lane 4 were treated with a deglycosylation agent, the reducing agent, and were boiled.
- Each lane 1 included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-NKG2A antibody (left blot), an anti-Fc antibody (center blot), or an anti-CD48 antibody (right blot).
- FIG. 7A to FIG. 7D show ELISA assays demonstrating the binding affinity of the Fc domain of mCD48-Fc-NKG2A ( FIG. 7A ), the NKG2A domain mCD48-Fc-NKG2A ( FIG. 7B ), and the CD48 domain of mCD48-Fc-NKG2A ( FIG. 7C and FIG. 7D ) for their respective binding partners.
- FIG. 7C the CD48 domain of mCD48-Fc-NKG2A chimeric protein was bound to CD2 and in FIG. 7D , the CD48 domain of mCD48-Fc-NKG2A chimeric protein was bound to 2B4.
- FIG. 8A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: human PD-1-Fc-hNKG2A (hPD-1-Fc-hNKG2A).
- FIG. 8B are Western blots showing characterization of the hPD-1-Fc-hNKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the hPD-1-Fc-hNKG2A chimeric protein, were loaded into lane 2 in all the blots.
- Samples in lane 3 were treated with a reducing agent, 3-mercaptoethanol, and were boiled.
- Samples in lane 4 were treated with a deglycosylation agent, the reducing agent, and were boiled.
- Each lane 1 included the protein size ladder.
- the two ECD domains the chimeric protein was probed using an anti-NKG2A antibody (left blot) or an anti-PD-1 antibody (right blot).
- FIG. 9A to FIG. 9D show ELISA assays demonstrating the binding affinity of the Fc domain of hPD-1-Fc-hNKG2A ( FIG. 9A ), the PD-1 domain of hPD-1-Fc-hNKG2A ( FIG. 9B ), and the hNKG2A domain hPD-1-Fc-hNKG2A ( FIG. 9C and FIG. 9D ) for their respective binding partners.
- FIG. 10A and FIG. 10B shows images of native, non-denaturing (non-SDS) Polyacrylamide gel electrophoresis (PAGE) for illustrative chimeric proteins of the present invention. Proteins in the gel images of FIG. 10A , were not stained with Coomassie Brilliant Blue whereas the proteins in the gel image of FIG. 10B were Coomassie stained.
- FIG. 11A to FIG. 11E shows in vivo reductions in tumor volume size resulting from methods of cancer treatments according to the present invention.
- FIG. 12A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: human CD86-Fc-hNKG2A (hCD86-Fc-NKG2A).
- FIG. 12B are Western blots showing characterization of the hCD86-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the hCD86-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-CD86 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 13A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: human CD48-Fc-hNKG2A (hCD48-Fc-NKG2A).
- FIG. 13B are Western blots showing characterization of the hCD48-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the hCD48-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-CD48 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 14A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: human CD58-Fc-hNKG2A (hCD58-Fc-NKG2A).
- FIG. 14B are Western blots showing characterization of the hCD58-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the hCD58-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-hCD58 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 15A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: human CD80-Fc-hNKG2A (hCD80-Fc-NKG2A).
- FIG. 15B are Western blots showing characterization of the hCD80-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the hCD80-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-CD80 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 16A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: human SLAMF6-Fc-hNKG2A (hSLAMF6-Fc-NKG2A).
- FIG. 16B are Western blots showing characterization of the hSLAMF6-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the hSLAMF6-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-hSLAMF6 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 17A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse CD80-Fc-hNKG2A (mCD80-Fc-NKG2A).
- FIG. 17B are Western blots showing characterization of the mCD80-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mCD80-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-mCD80 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 18A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse CD86-Fc-hNKG2A (mCD86-Fc-NKG2A).
- FIG. 18B are Western blots showing characterization of the mCD86-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mCD86-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-mCD86 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 19A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse PD-1-Fc-hNKG2A (mPD-1-Fc-NKG2A).
- FIG. 19B are Western blots showing characterization of the mPD-1-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mPD-1-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-mPD-1 antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 20A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse mSIRP ⁇ -Fc-hNKG2A (mSIRP ⁇ -Fc-NKG2A).
- FIG. 20B are Western blots showing characterization of the mSIRP ⁇ -Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mSIRP ⁇ -Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-mSIRP ⁇ antibody (left blot), an anti-Fc antibody (center blot), or an anti-NKG2A antibody (right blot).
- FIG. 21A is a cartoon showing the structure of an illustrative chimeric protein of the present invention: mouse TGFBR2-Fc-hNKG2A (mTGFBR2-Fc-NKG2A).
- FIG. 21B are Western blots showing characterization of the mTGFBR2-Fc-NKG2A chimeric protein. The Western blots demonstrate the chimeric protein's native state and tendency to form a multimer. Untreated samples (i.e., without a reducing agent or a deglycosylation agent, yet boiled) of the mTGFBR2-Fc-NKG2A chimeric protein, were loaded into the lane marked as NR of each of the blots.
- Samples in the lane marked as R were treated with a reducing agent, ⁇ -mercaptoethanol, and were boiled.
- Samples in the lane marked as DG were treated with a deglycosylation agent, the reducing agent, and were boiled.
- the lane marked as L included the protein size ladder.
- Each individual domain of the chimeric protein was probed using an anti-mSIRP ⁇ antibody (left blot), an anti-Fc antibody (center blot), or an anti-mTGFBR2 antibody (right blot).
- FIG. 22 shows the results of ELISA assays demonstrating the dose-dependent binding of the Fc domain of the mSLAMF6-Fc-NKG2A and mPD-1-Fc-NKG2A chimeric proteins to anti-Fc antibody.
- Anti-mFc was coated on plates and increasing amounts of the indicated chimeric proteins were added to the plates. The binding was detected using an anti-mFc HRP.
- mFc IgG was used as a positive control.
- FIG. 23 shows the results of ELISA assays demonstrating the dose-dependent binding of the Fc domain of the hCD86-Fc-NKG2A and hTGFBR2-Fc-NKG2A chimeric proteins to anti-human Fc antibody.
- Anti-human IgG was coated on plates and increasing amounts of the indicated chimeric proteins were added to the plates.
- hIgG was used as a positive control
- mCD80-Fc-NKG2A was used as a negative control. The binding was detected using an anti-human Fcgamma HRP.
- FIG. 24 shows the results of ELISA assays demonstrating the dose-dependent binding of the Fc domain of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins to anti-human Fc antibody.
- Anti-human IgG was coated on plates and increasing amounts of the indicated chimeric proteins were added to the plates.
- hIgG was used as a positive control. The binding was detected using an anti-human Fcgamma HRP.
- FIG. 25 shows the results of ELISA assays demonstrating the dose-dependent binding of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins to HLA-E.
- HLA-E was coated on plates and increasing amounts of the indicated chimeric proteins were added to the plates. The binding was detected using an anti-human Fcgamma HRP.
- FIG. 26 shows the results of ELISA assays demonstrating the dose-dependent binding of the hCD86-Fc-NKG2A chimeric protein to HLA-E.
- HLA-E was coated on plates and increasing amounts of hCD86-Fc-NKG2A were added to the plates. The binding was detected using an anti-human Fcgamma HRP.
- FIG. 27 shows the results of ELISA assays demonstrating the dose-dependent binding of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins to HLA-E. Increasing amounts of the indicated chimeric proteins were coated on plates and detected using an anti-human HLA-E-His. A chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 28 shows the results of ELISA assays demonstrating the dose-dependent binding of the hTGFBR2-Fc-NKG2A and hSLAMF6-Fc-NKG2A chimeric proteins to HLA-E. Increasing amounts of the indicated chimeric proteins were coated on plates and detected using an anti-human HLA-E-His. A chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 29 shows the results of ELISA assays demonstrating the dose-dependent binding of the hCD48-Fc-NKG2A chimeric protein to h2B4.
- h2B4 or hCD28-His which was used as a negative control, were coated on plates and detected using the hCD48-Fc-NKG2A chimeric protein chimeric protein.
- FIG. 30 shows the results of ELISA assays demonstrating the dose-dependent binding of the mTGFBR2-Fc-NKG2A chimeric protein to mTGF ⁇ 1.
- mTGF ⁇ 1 was coated on plates and detected using mTGFBR2-Fc-NKG2A, or mCD80-Fc-NKG2A, which was used as a negative control.
- FIG. 31 shows the results of ELISA assays demonstrating ELISA assays demonstrating the dose-dependent binding of the hCD48-Fc-NKG2A and hCD58-Fc-NKG2A bind chimeric proteins to hCD2.
- Recombinant human CD2 (rhCD2) protein was coated on plates.
- Increasing amounts of the indicated chimeric proteins or Recombinant human CD58-Fc fusion protein (rhCD58-Fc) were added and detected using an anti-mFc-HRP (for mCD80-Fc-NKG2A) or anti-hFc-HRP (for rest of the proteins).
- FIG. 32 shows the results of ELISA assays demonstrating the dose-dependent binding of the hCD48-Fc-NKG2A chimeric protein to recombinant human 2B4 protein (rh2B4).
- rh2B4-His was coated on plates.
- Increasing amounts of the indicated chimeric proteins or rhCD48-Fc were added and detected using an anti-mFc-HRP (for mCD80-Fc-NKG2A) or anti-hFc-HRP (for rest of the proteins).
- FIG. 33 shows the results of ELISA assays demonstrating the dose-dependent binding of the mCD86-Fc-NKG2A chimeric protein to mCD28.
- mCD28-Fc was coated on plates.
- Increasing amounts of the mCD86-Fc-NKG2A chimeric protein was added and detected using an anti-mFc-HRP.
- FIG. 34 shows the results of ELISA assays demonstrating the dose-dependent binding of the hCD80-Fc-NKG2A, hCD86-Fc-NKG2A chimeric proteins to recombinant human CD28 (rhCD28).
- rhCD28-His was coated on plates.
- Increasing amounts of the indicated chimeric proteins or hCD86-Fc (a positive control) were added and detected using an anti-mFc-HRP.
- mCD48-Fc-NKG2A was used a negative control.
- FIG. 35 shows the results of ELISA assays demonstrating the dose-dependent binding of the mPD1-Fc-NKG2A, chimeric protein mPD-L1. Increasing amounts of mPD1-Fc-NKG2A were coated on plates, and detected using mPD-L1-His.
- FIG. 36 shows the results of ELISA assays demonstrating that the mCD48-Fc-NKG2A chimeric protein binds to both Qa1 and anti-CD48 simultaneously in a dose dependent manner.
- An anti-mouse Qa1 antibody was coated on plates.
- Recombinant Qa1 protein, and increasing amounts of the mCD48-Fc-NKG2A chimeric protein was added in that order, and detected using an anti-mCD48 antibody.
- FIG. 37 shows the results of ELISA assays demonstrating that the mCD86-Fc-NKG2A chimeric protein binds to both HLA-E and anti-CD86 simultaneously in a dose dependent manner.
- HLA-E-His was coated on plates.
- Increasing amounts of the mCD86-Fc-NKG2A chimeric protein was added and detected using an anti-mCD86.
- a chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 38 shows the results of ELISA assays demonstrating that the mSIRP ⁇ -Fc-NKG2A chimeric protein binds to both anti-NKG2A and mCD47 simultaneously in a dose dependent manner.
- anti-NKG2A was coated on plates.
- Increasing amounts of the mSIRP ⁇ -Fc-NKG2A chimeric protein was added and detected using mCD47-His.
- the CD86-Fc-NKG2A chimeric protein was used as a negative control.
- FIG. 39 shows the results of ELISA assays demonstrating that the hPD-1-Fc-NKG2A chimeric protein binds to both hPD-L1 and HLA-E simultaneously in a dose dependent manner.
- hPD-L1-Fc was coated on plates.
- Increasing amounts of the hPD-1-Fc-NKG2A chimeric protein was added and detected using HLA-E-His.
- a chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 40 shows the results of ELISA assays demonstrating that the hCD80-Fc-NKG2A chimeric protein binds to both rhCD28 and HLA-E simultaneously in a dose dependent manner.
- rhCD28-Fc was coated on plates.
- Increasing amounts of the hCD80-Fc-NKG2A chimeric protein was added and detected using HLA-E-His.
- FIG. 41 shows the results of ELISA assays demonstrating that the hCD86-Fc-NKG2A chimeric protein binds to both rhCD28 and HLA-E simultaneously in a dose dependent manner.
- rhCD28-Fc was coated on plates.
- Increasing amounts of the hCD86-Fc-NKG2A chimeric protein was added and detected using HLA-E-His.
- a chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 42 shows the results of ELISA assays demonstrating that the hSLAMF6-Fc-NKG2A chimeric protein binds to both recombinant human SLAMF6 (rhSLAMF6) and HLA-E simultaneously in a dose dependent manner.
- rhSLAMF6-Fc was coated on plates.
- Increasing amounts of the hSLAMF6-Fc-NKG2A chimeric protein was added and detected using HLA-E-His.
- a chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 43 shows the results of ELISA assays demonstrating that the mPD-1-Fc-NKG2A chimeric protein binds to both recombinant mouse PD-L1 (rmPD-L1) and HLA-E simultaneously in a dose dependent manner.
- rmPD-L1-Fc was coated on plates.
- Increasing amounts of the mPD-1-Fc-NKG2A chimeric protein was added and detected using HLA-E-His.
- a chimeric protein comprising ECD of a type II transmembrane protein other than NKG2A was used as a negative control.
- FIG. 44 shows the results of ELISA assays demonstrating simultaneous binding to two ligands by the chimeric proteins disclosed herein.
- rh2B4-Fc recombinant human 2B4-Fc fusion protein
- recombinant human CD2-Fc fusion protein (ii) recombinant human CD2-Fc fusion protein (rhCD2-Fc) was coated on plates. Increasing amounts of the hCD58-Fc-NKG2A or hCD86-Fc-NKG2A chimeric proteins were added and detected using HLA-E-His. The hCD86-Fc-NKG2A chimeric protein was used as a negative control (Negative control #2). These data demonstrate that the hCD58-Fc-NKG2A chimeric protein binds to both human CD2 and HLA-E simultaneously in a dose dependent manner.
- FIG. 45 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing h2B4 (the binding partner of CD48). A positive clone was stained with an anti-2B4 antibody. A control clone was stained with isotype control antibody.
- FIG. 46A and FIG. 46B show the binding of the hCD48-Fc-NKG2A chimeric protein to Wild type (WT) CHO-K1 cells ( FIG. 46A ) or the CHO-K1/h2B4 cells ( FIG. 46B ) as measured by flow cytometry.
- WT Wild type
- FIG. 46A CHO-K1 cells
- FIG. 46B CHO-K1/h2B4 cells
- the dose dependent shifts in the CHO-K1/h2B4 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the hCD48-Fc-NKG2A chimeric protein to h2B4 expressed by the CHO-K1/h2B4 cells.
- FIG. 47 shows the quantitation of the binding of the hCD48-Fc-NKG2A chimeric protein to the CHO-K1/h2B4 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 48 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing m2B4 (the binding partner of CD48).
- a positive clone was stained with an anti-2B4 antibody.
- a control was stained with isotype control antibody.
- An unstained control was also analyzed.
- FIG. 49A and FIG. 49B show the binding of the mCD48-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 49A ) or the CHO-K1/m2B4 cells ( FIG. 49B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/m2B4 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the mCD48-Fc-NKG2A chimeric protein to m2B4 expressed by the CHO-K1/m2B4 cells.
- FIG. 50 shows the quantitation of the binding of the mCD48-Fc-NKG2A chimeric protein to the CHO-K1/m2B4 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 51 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing hPD-L1.
- a positive clone was stained with an anti-hPD-L1 antibody. Unstained cells were used as the negative control.
- FIG. 52A and FIG. 52B show the binding of the hPD-1-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 52A ) or the CHO-K1/hPD-L1 cells ( FIG. 52B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/hPD-L1 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the hPD-1-Fc-NKG2A chimeric protein to hPD-L1 expressed by the CHO-K1/hPD-L1 cells.
- FIG. 53 shows the quantitation of the binding of the hPD-1-Fc-NKG2A chimeric protein to the CHO-K1/hPD-L1 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 54 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing mPD-L1.
- a positive clone was stained with an anti-mPD-L1 antibody. Unstained cells were used as the negative control.
- FIG. 55A and FIG. 55B show the binding of the mPD-1-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 55A ) or the CHO-K1/mPD-L1 cells ( FIG. 55B ) as measured by flow cytometry.
- the greater dose dependent shifts in the CHO-K1/mPD-L1 cells, compared to WT CHO-K1 cells illustrate dose dependent binding of the mPD-1-Fc-NKG2A chimeric protein to mPD-L1 expressed by the CHO-K1/mPD-L1 cells.
- FIG. 56 shows the quantitation of the binding of the mPD-1-Fc-NKG2A chimeric protein to the CHO-K1/mPD-L1 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 57 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing mQa1 (the binding partner of CD48).
- a positive clone was stained with an anti-mQa1 antibody.
- a control was stained with isotype control antibody.
- An unstained control was also analyzed.
- FIG. 58A and FIG. 58B show the binding of the mCD48-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 58A ) or the CHO-K1/mQa1 cells ( FIG. 58B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/mQa1 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the mCD48-Fc-NKG2A chimeric protein to mQa1 expressed by the CHO-K1/mQa1 cells.
- FIG. 59 shows the quantitation of the binding of the mCD48-Fc-NKG2A chimeric protein to the CHO-K1/mQa1 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 60 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing hCD2.
- a positive clone was stained with an anti-hCD2 antibody. Unstained cells and isotype control-stained cells were used as the negative controls.
- FIG. 61A and FIG. 61B show the binding of the hCD58-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 61A ) or the CHO-K1/hCD2 cells ( FIG. 61B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/hCD2 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the hCD58-Fc-NKG2A chimeric protein to hCD2 expressed by the CHO-K1/hCD2 cells.
- FIG. 62 shows the quantitation of the binding of the hCD58-Fc-NKG2A chimeric protein to the CHO-K1/hCD2 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 63 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing hCD28. Two positive clones were stained with an anti-hCD28 antibody. Unstained cells and isotype control-stained cells were used as the negative controls.
- FIG. 64A and FIG. 64B show the binding of the hCD86-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 64A ) or the CHO-K1/hCD28 cells ( FIG. 64B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/hCD28 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the hCD86-Fc-NKG2A chimeric protein to hCD28 expressed by the CHO-K1/hCD28 cells.
- FIG. 65 shows the quantitation of the binding of the hCD86-Fc-NKG2A chimeric protein to the CHO-K1/hCD28 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 66 shows the flow cytometry analysis showing the generation of the CHO-K1 cells expressing mCD28. Two positive clones were stained with an anti-mCD28 antibody. Unstained cells and isotype control-stained cells were used as the negative controls.
- FIG. 67A and FIG. 67B show the binding of the mCD80-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 67A ) or the CHO-K1/mCD28 cells ( FIG. 67B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/mCD28 cells, but not WT CHO-K1 cells illustrate dose dependent binding of the mCD80-Fc-NKG2A chimeric protein to mCD28 expressed by the CHO-K1/mCD28 cells.
- FIG. 68 shows the quantitation of the binding of the mCD80-Fc-NKG2A chimeric protein to the CHO-K1/mCD28 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 69A and FIG. 69B show the binding of the mCD86-Fc-NKG2A chimeric protein to WT CHO-K1 cells ( FIG. 69A ) or the CHO-K1/mCD28 cells ( FIG. 69B ) as measured by flow cytometry.
- the dose dependent shifts in the CHO-K1/mCD28 cells, compared to WT CHO-K1 cells illustrate dose dependent binding of the mCD86-Fc-NKG2A chimeric protein to mCD28 expressed by the CHO-K1/mCD28 cells.
- FIG. 70 shows the quantitation of the binding of the mCD86-Fc-NKG2A chimeric protein to the CHO-K1/mCD28 cells in comparison to WT CHO-K1 cells as measured by flow cytometry.
- FIG. 71 shows the results of luciferase assays illustrating that the mCD48-Fc-NKG2A chimeric protein activates 2B4 signaling in a dose dependent manner.
- the CHO-K1/m2B4 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the m2B4 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- mCD48-Fc-NKG2A chimeric protein was incubated with the CHO-K1/m2B4 cells, or WT CHO-K1 cells, and the activation of the m2B4 was measured by a luciferase assay.
- FIG. 72 shows the results of luciferase assays illustrating that the mCD48-Fc-NKG2A chimeric protein activates m2B4 and mCD2 signaling in a dose dependent manner.
- the CHO-K1/m2B4 and CHO-K1/mCD2 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the m2B4 and mCD2 protein, respectively, that the cells express.
- WT CHO-K1 cells were used as a negative control.
- mCD48-Fc-NKG2A chimeric protein was incubated with the CHO-K1/m2B4 cells, CHO-K1/mCD2 cells or WT CHO-K1 cells, and the activation of the m2B4 cells or mCD2 was measured by a luciferase assay.
- FIG. 73 shows the results of luciferase assays illustrating that the mSLAMF6-Fc-NKG2A chimeric protein activates mSLAMF6 signaling in a dose dependent manner.
- the CHO-K1/mSLAMF6 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the mSLAMF6 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- mSLAMF6-Fc-NKG2A chimeric protein was incubated with the CHO-K1/mSLAMF6 cells or WT CHO-K1 cells, and the activation of the CHO-K1/mSLAMF6 cells was measured by a luciferase assay.
- FIG. 74 shows the results of luciferase assays illustrating that the hCD80-Fc-NKG2A chimeric protein activates CD28 signaling in a dose dependent manner.
- the CHO-K1/CD28 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the CD28 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- Increasing amounts of the hCD80-Fc-NKG2A chimeric protein was incubated with the CHO-K1/CD28 cells, or WT CHO-K1 cells, and the activation of the CD28 was measured by a luciferase assay.
- FIG. 75 shows the results of luciferase assays illustrating that the hCD86-Fc-NKG2A chimeric protein activates hCD28 signaling in a dose dependent manner.
- the CHO-K1/hCD28 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the hCD28 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- Increasing amounts of the hCD86-Fc-NKG2A chimeric protein was incubated with the CHO-K1/hCD28 cells, or WT CHO-K1 cells, and the activation of the hCD28 was measured by a luciferase assay.
- FIG. 76 shows the results of luciferase assays illustrating that the hPD-1-Fc-NKG2A chimeric protein activates HLA-E signaling in a dose dependent manner.
- the CHO-K1/HLA-E cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the HLA-E protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- hPD-1-Fc-NKG2A chimeric protein was incubated with the CHO-K1/HLA-E cells, or WT CHO-K1 cells, and the activation of the HLA-E was measured by a luciferase assay.
- FIG. 77 shows the results of luciferase assays illustrating that the mCD80-Fc-NKG2A chimeric protein activates Qa1 signaling in a dose dependent manner.
- the CHO-K1/Qa1 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the Qa1 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- Increasing amounts of the mCD80-Fc-NKG2A chimeric protein was incubated with the CHO-K1/Qa1 cells, or WT CHO-K1 cells, and the activation of the Qa1 was measured by a luciferase assay.
- FIG. 78 shows the results of luciferase assays illustrating that the mPD-1-Fc-NKG2A chimeric protein activates Qa1 signaling in a dose dependent manner.
- the CHO-K1/Qa1 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the Qa1 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- Increasing amounts of the mPD-1-Fc-NKG2A chimeric protein was incubated with the CHO-K1/Qa1 cells, or WT CHO-K1 cells, and the activation of the Qa1 was measured by a luciferase assay.
- FIG. 79 shows the results of luciferase assays illustrating that the TGFBR2-Fc-NKG2A chimeric protein activates Qa1 signaling in a dose dependent manner.
- the CHO-K1/Qa1 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the Qa1 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- Increasing amounts of the TGFBR2-Fc-NKG2A chimeric protein was incubated with the CHO-K1/Qa1 cells, or WT CHO-K1 cells, and the activation of the Qa1 was measured by a luciferase assay.
- FIG. 80 shows the results of luciferase assays illustrating that the hCD48-Fc-NKG2A chimeric protein activates h2B4 signaling in a dose dependent manner.
- the CHO-K1/h2B4 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the h2B4 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- hCD48-Fc-NKG2A chimeric protein was incubated with the CHO-K1/h2B4 cells, or WT CHO-K1 cells, and the activation of the h2B4 was measured by a luciferase assay.
- FIG. 81 shows the results of luciferase assays illustrating that the hCD58-Fc-NKG2A chimeric protein activates hCD2 signaling in a dose dependent manner.
- the CHO-K1/hCD2 cells used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the hCD2 protein that the cells express.
- WT CHO-K1 cells were used as a negative control.
- Increasing amounts of the hCD58-Fc-NKG2A chimeric protein was incubated with the CHO-K1/hCD2 cells, or WT CHO-K1 cells, and the activation of the hCD2 was measured by a luciferase assay.
- FIG. 82 shows the binding of the hCD86-Fc-NKG2A chimeric protein to NK92-CD16V cells as measured by flow cytometry.
- the dose dependent shifts demonstrate the dose dependent binding of the hCD86-Fc-NKG2A chimeric protein to NK92-CD16V cells.
- FIG. 83A and FIG. 83B show the binding of the hCD48-Fc-NKG2A chimeric protein to NK92-CD16V cells.
- FIG. 83A results of a flow cytometry-based binding assay.
- FIG. 83B shows the quantitation of the binding of the hCD48-Fc-NKG2A chimeric protein to NK92-CD16V effector cells.
- the dose dependent binding demonstrate that the hCD48-Fc-NKG2A chimeric protein effectively bind to NK92-CD16V cells.
- FIG. 84 shows the binding of the hCD80-Fc-NKG2A chimeric protein to NK92-CD16V cells as measured by flow cytometry.
- the dose dependent shifts demonstrate the dose dependent binding of the hCD80-Fc-NKG2A chimeric protein to NK92-CD16V cells.
- FIG. 85 shows the binding of the hPD-1-Fc-NKG2A chimeric protein to NK92-CD16V cells as measured by flow cytometry.
- the dose dependent shifts demonstrate the dose dependent binding of the hPD-1-Fc-NKG2A chimeric protein to NK92-CD16V cells.
- FIG. 86 demonstrates that the mCD86-Fc-NKG2A chimeric protein induces apoptosis of antigen positive (OVA+) target cells mediated by the antigen activated T cells (OT-1 na ⁇ ve T cells) in a dose-dependent manner.
- OVA+ antigen positive
- OT-1 na ⁇ ve T cells antigen activated T cells
- Increasing amounts of the mCD86-Fc-NKG2A chimeric protein was incubated with OT-1 na ⁇ ve T cells (effector cells) and OVA+ cells (target cells) at the effector cells: target cell ration of 5:1.
- Apoptosis was assessed by measuring caspase 3/7 activity.
- FIG. 87 demonstrates that the hCD86-Fc-NKG2A chimeric protein, in combination with an anti-EGFR antibody, induces NK cell-mediated antibody dependent cellular cytotoxicity in the EGFR-positive A431 human non-small cell lung cancer (NSCLC) cells (target cells) in a dose-dependent manner.
- NSCLC human non-small cell lung cancer
- Apoptosis was assessed by measuring annexin V.
- FIG. 88 demonstrates that the hCD86-Fc-NKG2A chimeric protein, in combination with an anti-EGFR antibody, induces NK cell-mediated antibody dependent cellular cytotoxicity in the EGFR-positive A549 human lung carcinoma cells (target cells) in a dose-dependent manner.
- Increasing amounts of the hCD86-Fc-NKG2A chimeric protein and 10 ⁇ g/ml Cetuximab were incubated with NK92-CD16V cells (effector cells) and A549 cells (target cells) at the effector cells: target cell ration of 5:1.
- Apoptosis was assessed by measuring annexin V.
- FIG. 89A and FIG. 89B demonstrate that the mCD86-Fc-NKG2A chimeric protein induces apoptosis mediated by freshly isolated splenocytes in the murine reticulum cell sarcoma A20 cells in a dose-dependent manner.
- Increasing amounts of the mCD86-Fc-NKG2A chimeric protein was incubated with freshly isolated splenocytes (effector cells) and A20 cells (target cells).
- Apoptosis was assessed by measuring caspase 3/7 activity.
- FIG. 89A shows the caspase 3/7 activity as function of time.
- FIG. 89B shows a bar graph showing the caspase 3/7 activity at 3.5 hr. note that no apoatosis was observed without splenocytes (the black bar).
- FIG. 90A and FIG. 90B demonstrate the efficacy of the CD86-Fc-NKG2A chimeric protein against the murine colorectal carcinoma cell line CT26 allografts.
- Mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein. The mice were treated on days 5, 8, 11, 14, 16, and 18 days post-inoculation. Tumor volumes were measured.
- FIG. 90A shows the tumor volumes plotted as a function of time.
- FIG. 90B shows the tumor volumes on day 18. ** denotes p ⁇ 0.01, and *** denotes p ⁇ 0.001 between the indicated groups.
- FIG. 91A and FIG. 91B demonstrate the efficacy of the CD80-Fc-NKG2A chimeric protein against the murine colorectal carcinoma cell line CT26 allografts.
- Mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the CD80-Fc-NKG2A chimeric protein. The mice were treated on 5, 8, 11, 14, 16, and 18 post-inoculation. Tumor volumes were measured.
- FIG. 91A shows the tumor volumes plotted as a function of time.
- FIG. 91B shows the tumor volumes on day 18. ** denotes p ⁇ 0.01 between the indicated groups.
- FIG. 92A and FIG. 92B demonstrate the efficacy of the CD48-Fc-NKG2A chimeric protein against the murine colorectal carcinoma cell line CT26 allografts.
- Mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the CD48-Fc-NKG2A chimeric protein. The mice were treated on days 5, 8, 11, 14, 16, and 18 post-inoculation. Tumor volumes were measured.
- FIG. 92A shows the tumor volumes plotted as a function of time.
- FIG. 92B shows the tumor volumes on day 18. denotes p ⁇ 0.01 between the indicated groups.
- FIG. 93A and FIG. 93B demonstrate the efficacy of the PD-1-Fc-NKG2A chimeric protein against murine colorectal carcinoma cell line CT26 allografts.
- Mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the PD-1-Fc-NKG2A chimeric protein. The mice were treated on days 5, 8, 11, and 14 days post-inoculation. Tumor volumes were measured.
- FIG. 93A shows the tumor volumes plotted as a function of time.
- FIG. 93B shows the tumor volumes on day 11. * denotes p ⁇ 0.05 between the indicated groups.
- FIG. 94A and FIG. 94B demonstrate the efficacy of the CD86-Fc-NKG2A chimeric protein against allografts of the murine lymphoma cell line EG7, which has been engineered to express the novel antigen OVA (EG7-OVA). Mice were inoculated with EG7-OVA cells, and infused with CD4 and CD8 OVA specific T cells.
- EG7-OVA novel antigen OVA
- mice were randomly assigned to one of four treatment groups: (1) untreated, (2) 100 ⁇ g/mouse anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse anti-NKG2A (BioXcell clone 20D5), and (4) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- the mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation.
- the mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation.
- Tumor volumes were measured on indicated days.
- FIG. 94A shows the tumor volumes plotted as a function of time.
- FIG. 94B shows the tumor volumes on day 7. denotes p ⁇ 0.01 between the indicated groups.
- FIG. 95 shows the effect of the CD86-Fc-NKG2A chimeric protein effector memory T cells (T EM cells) against tumor allograft.
- T EM cells CD86-Fc-NKG2A chimeric protein effector memory T cells
- FIG. 95 shows the effect of the CD86-Fc-NKG2A chimeric protein effector memory T cells (T EM cells) against tumor allograft.
- Tail blood from was drawn from the mice described in the description of FIG. 94A and FIG. 94B and analyzed the immune makeup in the peripheral system on the indicated days.
- the fraction of effector memory T cells (T EM cells) on days 0 and 3 are plotted.
- Cells from OT-I:GFP from transgenic to OT-1 mice were used to measure OT-1 cells.
- FIG. 96A and FIG. 96B demonstrate the efficacy of the CD86-Fc-NKG2A chimeric protein against allografts of the murine myelomonocytic leukemia cell line WEHI-3.
- Balb/c mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- FIG. 96A shows the tumor volumes plotted as a function of time.
- FIG. 96B shows the tumor volumes on day 18. * denotes p ⁇ 0.05 between the indicated groups, and *** denotes p ⁇ 0.001 between the indicated groups.
- FIG. 97A and FIG. 97B demonstrate the efficacy of the SIRP ⁇ -Fc-NKG2A chimeric protein against allografts of the murine myelomonocytic leukemia cell line WEHI-3.
- Balb/c mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the SIRP ⁇ -Fc-NKG2A chimeric protein.
- FIG. 97A shows the tumor volumes plotted as a function of time.
- FIG. 97B shows the tumor volumes on day 18. * denotes p ⁇ 0.05 between the indicated groups, and *** denotes p ⁇ 0.001 between the indicated groups.
- FIG. 98A and FIG. 98B demonstrate the efficacy of the CD48-Fc-NKG2A chimeric protein against allografts of the murine myelomonocytic leukemia cell line WEHI-3.
- Balb/c mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the CD48-Fc-NKG2A chimeric protein.
- FIG. 98A shows the tumor volumes plotted as a function of time.
- FIG. 98B shows the tumor volumes on day 18. * denotes p ⁇ 0.05 between the indicated groups, and ** denotes p ⁇ 0.01 between the indicated groups.
- FIG. 99A and FIG. 99B demonstrate the efficacy of the TGFBR2-Fc-NKG2A chimeric protein against allografts of the murine myelomonocytic leukemia cell line WEHI-3.
- Balb/c mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the TGFBR2-Fc-NKG2A chimeric protein.
- FIG. 99A shows the tumor volumes plotted as a function of time.
- FIG. 99B shows the tumor volumes on day 18. * denotes p ⁇ 0.05 between the indicated groups, and ** denotes p ⁇ 0.01 between the indicated groups.
- FIG. 100A and FIG. 100B demonstrate CD8 T cells are required for the anti-tumor effect of the CD86-Fc-NKG2A chimeric protein against allografts of the murine myelomonocytic leukemia cell line WEHI-3. Balb/c mice were inoculated with WEHI-3 cells.
- mice were randomly assigned to the following treatment groups: (1) 250 ⁇ g/mouse of an anti-CD8a antibody (Bioxcell clone 2.43), (2) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein, and (3) 250 ⁇ g/mouse of the anti-CD8a antibody (Bioxcell clone 2.43)+300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- Tumor volumes were measured on indicated days.
- FIG. 100A shows the tumor volumes plotted as a function of time.
- FIG. 100B shows the tumor volumes on day 18. * denotes p ⁇ 0.05 between the indicated groups.
- FIG. 101A to FIG. 101C demonstrate that CD86-Fc-NKG2A induced the growth of cytokine secretory cells in the spleen compared to both untreated and anti-NKG2A antibody therapy.
- Balb/c mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (3) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein. The mice were treated on days 1, 3, 5, and 7 post-inoculation.
- FIG. 101A shows the CD3-CD11 b+CD27+ cells in the spleens of the mice from indicated treatment groups.
- FIG. 101B shows the CD3-NKP46+CD11b+CD27+ cells in the spleens of the mice from indicated treatment groups.
- FIG. 101C shows the CD3-KLRG1+CD11b+CD27+ cells in the spleens of the mice from indicated treatment groups.
- FIG. 102A and FIG. 102B demonstrate that CD86-Fc-NKG2A induced the growth of activated cytotoxic T cells and CD107+ cell (a marker for enhanced cytotoxicity) in the spleen of treated mice compared to untreated mice.
- FIG. 102A shows the PD-1+ cytotoxic T lymphocytes (CTLs) in the spleens of the mice from indicated treatment groups.
- FIG. 102B shows the CD107+ cells in the spleens of the mice from indicated treatment groups.
- CTLs cytotoxic T lymphocytes
- FIG. 103 demonstrates that CD86-Fc-NKG2A induced the enhanced infiltration of immune cells into the tumor with the cytolytic marker granzyme B in the tumors of treated mice compared to untreated.
- Balb/c mice were inoculated with WEHI-3 cells.
- Statistical analyses were performed using a Students T test and *p ⁇ 0.05.
- FIG. 104A to FIG. 104C demonstrate that CD86-Fc-NKG2A enhanced infiltration of immune cells into the tumor that express potent activation markers (CD137, IFN- ⁇ , and PD1).
- FIG. 104A shows the CD137+ cells in the tumors of the mice from indicated treatment groups.
- FIG. 104B shows the IFN ⁇ + cells in the tumors of the mice from indicated treatment groups.
- FIG. 104C shows the PD-1+ cytotoxic T lymphocytes (CTLs) in the tumors of the mice from indicated treatment groups.
- CTLs cytotoxic T lymphocytes
- FIG. 105A to FIG. 105C demonstrate that CD86-Fc-NKG2A induced enhanced infiltration of immune cells in the draining lymph node of effector memory T cells, central memory t cells, and NKG2A+CD8+ T cells indicating mCD86-Fc-NKG2A was able to induce the infiltration and proliferation of these important effector immune cells.
- FIG. 105A shows the effector memory T cells in the lymph nodes of the mice from indicated treatment groups.
- FIG. 105B shows the central memory T cells in the lymph nodes of the mice from indicated treatment groups.
- FIG. 105C shows the NKG2a+ cytotoxic T lymphocytes (CTLs) in the lymph nodes of the mice from indicated treatment groups.
- CTLs cytotoxic T lymphocytes
- the present invention is based, in part, on the development of chimeric proteins that block immune inhibitory signals originating from a cancer cell or a virus-infected cell and/or prevent reception of inhibitory signals by a Natural killer (NK) cell.
- NK Natural killer
- NK cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation; they can also regulate specific humoral and cell-mediated immunity.
- NK cells express C-Type Lectin receptors which receive an inhibitory signal when bound to non-classical MHC Class I Proteins, e.g., HLA-E (in humans) and Qa1 (in mice). HLA-E/Qa1 are expressed by virtually all cells and are often upregulated by cancer cells.
- An example of C-Type Lectin receptors expressed by NK cells are the members of the NKG2 family of receptors, which includes NKG2A, NKG2B, NKG2C, NKG2D, NKG2E, NKG2F, and NKG2H.
- NKG2A dimerizes with CD94 (KLRD1), which stabilizes NKG2A at the surface and allows the NKG2A/CD94 heterodimer to recognize and bind HLA-E, thereby receiving an immune inhibitory signal.
- NKG2A is also expressed by cytotoxic T cells, Gamma delta ( ⁇ ) T cells, and Natural killer T (NKT) cells. Blocking NKG2A's reception of an immune inhibitory signal, from a cancer cell or a virus-infected cell, will prevent inhibition of the NK cell and will allow it to kill the cancer cell or the virus-infected cell.
- the chimeric proteins of the present invention can be engineered comprising a portion of the extracellular domain of a Type I transmembrane protein or a portion of a membrane-anchored extracellular protein and the extracellular domain of a Type II transmembrane protein in which the Type II transmembrane protein is naturally expressed on the surface of a Natural Killer (NK) cell.
- NK Natural Killer
- These chimeric proteins can inhibit transmission and/or reception of immunosuppressive signals.
- the Type I transmembrane protein end of a chimeric protein disrupts, blocks, reduces, inhibits and/or sequesters the transmission of immune inhibitory signals, e.g., originating from a cancer cell or a virus-infected cell that is attempting to avoid its detection and/or destruction.
- the Type I transmembrane protein may provide an immune-stimulatory signal that increases the activity of another immune cell.
- the Type II transmembrane protein end of a chimeric protein disrupts, blocks, reduces, inhibits and/or sequesters the inhibitory signals thereby preventing their reception by an NK cell. Together, these two actions allow for an anti-cancer attack or an attack of a virus-infected cell by the NK cell.
- an extracellular domain refers to a portion of a transmembrane protein which is capable of interacting with the extracellular environment. In embodiments, an extracellular domain refers to a portion of a transmembrane protein which is sufficient for binding to a ligand or receptor and is effective in transmitting a signal to a cell. In embodiments, an extracellular domain is the entire amino acid sequence of a transmembrane protein which is normally present at the exterior of a cell or of the cell membrane.
- an extracellular domain is that portion of an amino acid sequence of a transmembrane protein which is external of a cell or of the cell membrane and is needed for signal transduction and/or ligand binding as may be assayed using methods know in the art (e.g., in vitro ligand binding and/or cellular activation assays).
- Transmembrane proteins typically consist of an extracellular domain, one or a series of transmembrane domains, and an intracellular domain.
- the extracellular domain of a transmembrane protein is responsible for interacting with a soluble receptor or ligand or membrane-bound receptor or ligand (i.e., a membrane of an adjacent cell).
- the trans-membrane domain(s) is responsible for localizing the transmembrane protein to the plasma membrane.
- the intracellular domain of a transmembrane protein is responsible for coordinating interactions with cellular signaling molecules to coordinate intracellular responses with the extracellular environment (or visa-versa).
- Type I transmembrane proteins which have an extracellular amino terminus and an intracellular carboxy terminus (see, FIG. 1A , left protein) and Type II transmembrane proteins which have an extracellular carboxy terminus and an intracellular amino terminus (see, FIG. 1A , right protein).
- Type I and Type II transmembrane proteins can be either receptors or ligands.
- the amino terminus of the protein faces outside the cell, and therefore contains the functional domains that are responsible for interacting with other binding partners (either ligands or receptors) in the extracellular environment.
- Type II transmembrane proteins the carboxy terminus of the protein faces outside the cell, and therefore contains the functional domains that are responsible for interacting with other binding partners (either ligands or receptors) in the extracellular environment.
- these two types of transmembrane proteins have opposite orientations to each other relative to the cell membrane, with the amino terminus of a Type I transmembrane protein is orientated away from the cell membrane whereas the amino terminus of a Type II transmembrane protein is orientated towards from the cell membrane.
- a chimeric protein comprises a portion of a membrane-anchored extracellular protein.
- membrane-anchored extracellular protein resides in and interacts with the extracellular environment.
- the portion of the membrane-anchored extracellular protein is sufficient for binding to a ligand or receptor.
- the portion is the entire amino acid sequence of the membrane-anchored extracellular protein. Determining whether the portion of the membrane-anchored extracellular protein is capable ligand/receptor binding may be assayed using methods know in the art (e.g., in vitro ligand binding and/or cellular activation assays).
- FIG. 1B shows two membrane-anchored extracellular proteins, with the curved lines represents the anchoring domains; the left protein has its carboxy terminus anchored to the cell membrane and the right protein has its amino terminus anchored to the cell membrane.
- a Type I transmembrane protein and a Type II transmembrane protein may be engineered such that their transmembrane and intracellular domains are omitted and the transmembrane proteins' extracellular domains are adjoined using a linker sequence to generate a single chimeric protein.
- two membrane-anchored extracellular proteins may be engineered such that a portion of their extracellular domains are adjoined using a linker sequence to generate a single chimeric protein.
- one membrane-anchored extracellular protein and one transmembrane protein (lacking its transmembrane and intracellular domains) may be adjoined using a linker sequence to generate a single chimeric protein. As shown in FIG.
- FIG. 1C depicts the linkage of a liberated Type I transmembrane protein (from its transmembrane and intracellular domains) or a liberated carboxy-terminus anchored extracellular protein (from its anchoring domain) and a liberated Type II transmembrane protein (from its transmembrane and intracellular domains) or a liberated amino-terminus anchored extracellular protein (from its anchoring domain) have been adjoined by a linker sequence.
- the extracellular domains in this depiction may include the entire amino acid sequence of the Type I protein's extracellular domain or the entire amino acid sequence of the carboxy-anchored extracellular protein, or a fraction thereof, wherein the fraction retains the ability to bind the intended ligand/receptor.
- the extracellular domains in this depiction may include the entire amino acid sequence of the Type II protein's extracellular domain or the entire amino acid sequence of the amino-anchored extracellular protein, or a fraction thereof, wherein the fraction retains the ability to bind the intended ligand/receptor.
- the chimeric protein comprises sufficient overall flexibility and/or physical distance between domains such that a first extracellular domain (shown at the left end of the chimeric protein in FIG. 1C and FIG.
- FIG. 1D is sterically capable of binding its receptor/ligand and/or a second extracellular domain (shown at the right end of the chimeric protein in FIG. 1C and FIG. 1D ) is sterically capable of binding its receptor/ligand.
- FIG. 1D depicts adjoined extracellular domains in a linear chimeric protein wherein each extracellular domain of the chimeric protein is facing “outward”.
- a chimeric protein of the present invention disrupts, blocks, reduces, inhibits, and/or sequesters the transmission of immunosuppressive signals with one domain, and also either (i) the reception of immunosuppressive signals or (ii) provide an immune stimulatory signal with the other domain, it can provide an anti-tumor effect and/or an antiviral effect by two distinct pathways; this dual-action is more likely to provide a therapeutic effect in a patient and/or to provide an enhanced therapeutic effect in a patient.
- chimeric proteins can act via two distinct pathways, they can be efficacious, at least, in patients who respond poorly to treatments that target one of the two pathways. Thus, a patient who is a poor responder to treatments acting via one of the two pathways can receive a therapeutic benefit by targeting the other pathway.
- the present chimeric proteins provide advantages including, without limitation, ease of use and ease of production. This is because two distinct immunotherapy agents are combined into a single product which may allow for a single manufacturing process instead of two independent manufacturing processes. In addition, administration of a single agent instead of two separate agents allows for easier administration and greater patient compliance. Further, in contrast to, for example, monoclonal antibodies, which are large multimeric proteins containing numerous disulfide bonds and post-translational modifications such as glycosylation, the present chimeric proteins are easier and more cost effective to manufacture.
- the chimeric proteins of the present invention comprise a portion of the extracellular domain of a Type I transmembrane protein or a portion of a membrane-anchored extracellular protein and the extracellular domain of a Type II transmembrane protein in which the Type II transmembrane protein is naturally expressed on the surface of a Natural Killer (NK) cell, e.g., an NKG2 family of receptors.
- NK Natural Killer
- These chimeric proteins can, at least, block transmission of immune inhibitory signals to an NK cell which allow for an anti-tumor attack or an attack of a virus-infected cell.
- An aspect of the present invention is a chimeric protein of a general structure of: N terminus-(a)-(b)-(c)-C terminus, where (a) is a first domain comprising a portion of the extracellular domain of a Type I transmembrane protein or a portion of a membrane-anchored extracellular protein, (b) is a linker adjoining the first and second domains, and (c) is a second domain comprising a portion of the extracellular domain of a Type II transmembrane protein, wherein the Type II transmembrane protein is naturally expressed on the surface of a Natural Killer (NK) cell.
- NK Natural Killer
- the Type II transmembrane protein is a member of the NKG2 family of receptors.
- the member of the NKG2 family of receptors is selected from NKG2A, NKG2B, NKG2C, NKG2D, NKG2E, NKG2F, and NKG2H, e.g., the member of the NKG2 family of receptors is NKG2A.
- the second domain is capable of binding an NKG2A ligand, e.g., HLA-E (in humans) or Qa1 (in mice).
- the second domain comprises substantially all the extracellular domain of NKG2A.
- binding the NKG2A ligand blocks transmission of an immune inhibitory signal to an NK cell.
- the Type I transmembrane protein is selected from CD80, CD86, CD58, PD-1, SLAMF6, SIRP ⁇ and TGFBR2.
- the first domain is capable of binding the ligand/receptor for the Type I transmembrane protein.
- the Type I transmembrane protein is CD80.
- the ligand/receptor is CTLA-4 or CD28.
- the Type I transmembrane protein is CD86.
- the ligand/receptor is CTLA-4 or CD28.
- the Type I transmembrane protein is CD58.
- the ligand/receptor is CD2.
- the Type I transmembrane protein is PD-1. In embodiments, the ligand/receptor is PD-L1 or PD-L2. In embodiments, the Type I transmembrane protein is SLAMF6. In embodiments, the ligand/receptor is SAP or EAT2. In embodiments, the Type I transmembrane protein is SIRP ⁇ . In embodiments, the ligand/receptor is CD47. In embodiments, the Type I transmembrane protein is TGFBR2. In embodiments, the ligand TGF ⁇ 3 or TGF ⁇ 1. In embodiments, the first domain comprises substantially all the extracellular domain the Type I transmembrane protein. In embodiments, binding the first domain to its ligand/receptor inhibits an immunosuppressive signal. In embodiments, binding the first domain to its ligand/receptor activates an immunosuppressive signal.
- the membrane-anchored extracellular protein is CD48.
- the ligand/receptor is CD2.
- the ligand/receptor is 2B4.
- the first domain comprises substantially all of the mature CD48 polypeptide. In embodiments, binding the first domain to its ligand/receptor inhibits an immunosuppressive signal. In embodiments, binding the first domain to its ligand/receptor activates an immunosuppressive signal.
- the chimeric protein is capable of forming a stable synapse between cells, e.g., an NK cell and a tumor cell or an NK cell and a virus-infected cell.
- the stable synapse between cells provides spatial orientation that favors tumor reduction or killing of virus-infected cells by the NK cell.
- the spatial orientation positions NK cells to attack target cells selected from tumor cells and virus-infected cells and/or sterically prevents the target cells from delivering negative signals, including negative signals beyond those masked by the chimeric protein of the invention.
- binding of either or both of the first domain and the second domains to its ligand/receptor occurs with slow off rates (K off ), which provides a long interaction of a receptor and its ligand.
- K off slow off rates
- the long interaction provides sustained negative signal masking effect, sustained inhibition of an immunosuppressive signal, and/or sustained activation of an immunosuppressive signal.
- the long interaction provides for NK cell proliferation and/or allows for anti-tumor attack or attack of a virus-infected cell.
- the long interaction allows sufficient signal transmission to provide release of a stimulatory signal, e.g., a cytokine.
- the chimeric protein is capable of providing a sustained immunomodulatory effect.
- linker is a polypeptide selected from a flexible amino acid sequence, an IgG hinge region, and an antibody sequence.
- the linker comprises at least one cysteine residue capable of forming a disulfide bond and/or comprises a hinge-CH2-CH3 Fc domain, e.g., derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- Another aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of CD80 that is capable of binding a CD80 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- Yet another aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of CD86 that is capable of binding a CD86 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the present invention provides a chimeric protein comprising: (a) a first domain comprising a portion of CD48 that is capable of binding a CD48 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the present invention provides a chimeric protein comprising: (a) a first domain comprising a portion of CD58 that is capable of binding a CD58 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the present invention provides a chimeric protein comprising: (a) a first domain comprising a portion of PD-1 that is capable of binding a PD-1 ligand, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- An aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of SLAMF6 that is capable of binding a SLAMF6 ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- An aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of SIRP ⁇ that is capable of binding a SIRP ⁇ ligand/receptor, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- Another aspect of the present invention is a chimeric protein comprising: (a) a first domain comprising a portion of TGFBR2 that is capable of binding a TGFBR2 ligand, (b) a second domain comprising a portion of NKG2A that is capable of binding an NKG2A ligand, and (c) a linker linking the first domain and the second domain and comprising a hinge-CH2-CH3 Fc domain.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the hinge-CH2-CH3 Fc domain is derived from IgG, IgA, IgD, or IgE.
- the IgG is selected from IgG1, IgG2, IgG3, and IgG4 and the IgA is selected from IgA1 and IgA2.
- the IgG is IgG4, e.g., a human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the chimeric protein is a recombinant fusion protein, e.g., a single polypeptide having the extracellular domains disclosed herein.
- the chimeric protein is translated as a single unit in a prokaryotic cell, a eukaryotic cell, or a cell-free expression system.
- the present chimeric protein is producible in a mammalian host cell as a secretable and fully functional single polypeptide chain.
- chimeric protein refers to a recombinant protein of multiple polypeptides, e.g., multiple extracellular domains disclosed herein, that are combined (via covalent or no-covalent bonding) to yield a single unit, e.g., in vitro (e.g., with one or more synthetic linkers disclosed herein).
- the chimeric protein is chemically synthesized as one polypeptide or each domain may be chemically synthesized separately and then combined. In embodiments, a portion of the chimeric protein is translated and a portion is chemically synthesized.
- first and second domains are envisioned, e.g., the first domain is outward facing and the second domain is inward facing, the first domain is inward facing and the second domain is outward facing, and the first and second domains are both inward facing.
- the chimeric protein would have an amino-terminal to carboxy-terminal configuration comprising a portion of the extracellular domain of the Type II protein or the portion of the amino-anchored extracellular protein, a linker, and a portion of the extracellular domain of a Type I protein or the portion of the carboxy-anchored extracellular protein.
- Chimeric proteins of the present invention have a first domain which is sterically capable of binding its ligand/receptor and/or a second domain which is sterically capable of binding its ligand/receptor.
- This flexibility and/or physical distance (which is herein referred to as “slack”) may be normally present in the extracellular domain(s), normally present in the linker, and/or normally present in the chimeric protein (as a whole).
- the chimeric protein may be modified by including one or more additional amino acid sequences (e.g., the joining linkers described below) or synthetic linkers (e.g., a polyethylene glycol (PEG) linker) which provide additional slack needed to avoid steric hindrance.
- additional amino acid sequences e.g., the joining linkers described below
- synthetic linkers e.g., a polyethylene glycol (PEG) linker
- the NKG2A protein belongs to the killer cell lectin-like receptor family, also called the NKG2 family, which is a group of transmembrane proteins preferentially expressed in Natural killer (NK) cells.
- This family of proteins is characterized by the Type II membrane orientation and the presence of a C-type lectin domain.
- This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells.
- the chimeric proteins of the present invention comprise variants of the extracellular domain of NKG2A.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or
- the extracellular domain of human NKG2A has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of NKG2A.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least
- the second domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 57.
- the portion of the extracellular domain of NKG2A is a truncation of SEQ ID NO: 57.
- the truncation retains the ability to bind an NKG2A ligand, e.g., HLA-E.
- CD80 is a membrane receptor that is activated by the binding of CD28 or cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). The activated protein induces T-cell proliferation and cytokine production. CD80 can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.
- CTL-4 cytotoxic T-lymphocyte-associated protein 4
- the chimeric proteins of the present invention comprise variants of the extracellular domain of CD80.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least
- the extracellular domain of human CD80 has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of CD80.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about 9
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 59.
- the portion of the extracellular domain of CD80 is a truncation of SEQ ID NO: 59.
- the truncation retains the ability to bind a CD80 ligand/receptor, e.g., CTLA-4 and CD28.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 59, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a CD80-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a CD80-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%, or
- CD86 is a Type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response.
- CTL-4 cytotoxic T-lymphocyte-associated protein 4
- the chimeric proteins of the present invention comprise variants of the extracellular domain of CD86.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least
- the extracellular domain of human CD86 has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of CD86.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about 9
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 63.
- the portion of the extracellular domain of CD86 is a truncation of SEQ ID NO: 63.
- the truncation retains the ability to bind a CD86 ligand/receptor, e.g., CTLA-4 and CD28.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 63, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a CD86-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a CD86-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%, or
- CD58 is a member of the immunoglobulin superfamily.
- the encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes.
- the chimeric proteins of the present invention comprise variants of the extracellular domain of CD58.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least
- the extracellular domain of human CD58 has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of CD58.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about 9
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 67.
- the portion of the extracellular domain of CD58 is a truncation of SEQ ID NO: 67.
- the truncation retains the ability to bind a CD58 ligand/receptor, e.g., CD2.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 67, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a CD58-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a CD58-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%, or
- PD-1 is a cell surface membrane protein of the immunoglobulin superfamily. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. In mice, PD-1 expression is induced in the thymus when anti-CD3 antibodies are injected and large numbers of thymocytes undergo apoptosis. Mice deficient for its gene bred on a BALB/c background developed dilated cardiomyopathy and died from congestive heart failure. These studies suggest that PD-1 may also be important in T cell function and contribute to the prevention of autoimmune diseases.
- the chimeric proteins of the present invention comprise variants of the extracellular domain of PD-1.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at
- the extracellular domain of human PD-1 has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of PD-1.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 69.
- the portion of the extracellular domain of PD-1 is a truncation of SEQ ID NO: 69.
- the truncation retains the ability to bind a PD-1 ligand, e.g., PD-L1 and PD-L2.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 69, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a PD-1-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a PD-1-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%,
- SLAMF6 is a type I transmembrane protein, belonging to the CD2 subfamily of the immunoglobulin superfamily. It is expressed on Natural killer (NK), T, and B lymphocytes. It undergoes tyrosine phosphorylation and associates with the Src homology 2 domain-containing protein (SH2D1A) as well as with SH2 domain-containing phosphatases (SHPs). SLAMF6 functions as a coreceptor in the process of NK cell activation. It can also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.
- the chimeric proteins of the present invention comprise variants of the extracellular domain of SLAMF6.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or
- the extracellular domain of human SLAMF6 has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of SLAMF6.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 73.
- the portion of the extracellular domain of SLAMF6 is a truncation of SEQ ID NO: 73.
- the truncation retains the ability to bind a SLAMF6 ligand, e.g., SAP and EAT2.
- NTB-A [correction of GNTB-A]
- SH2D1A-associated surface molecule contributing to the inability of natural killer cells to kill Epstein-Barr virus-infected B cells in X-linked lymphoproliferative disease.” J. Exp. Med. 194 (3), 235-246 (2001); Eissmann et al., “Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells.” J. Immunol.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 73, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a SLAMF6-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a SLAMF6-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or
- SIRP ⁇ Signal regulatory protein ⁇
- CD172a or SHP substrate 1 (SHPS-1) is a is a type I transmembrane protein.
- SIRP ⁇ is established as an immunoreceptor harboring an IgV domain. It is expressed on Natural killer (NK), monocytes, granulocytes, dendritic cells and hematopoietic stem cells, myeloid stem cells and neurons.
- NK Natural killer
- monocytes granulocytes
- dendritic cells granulocytes
- dendritic cells granulocytes
- hematopoietic stem cells myeloid stem cells and neurons.
- SIRP ⁇ is a negative regulator of the phosphatidylinositol 3-kinase signaling and mitogen-activated protein kinase pathways.
- CD47 which is a membrane protein expressed in nearly all cell types, modulates the function of SIRP ⁇ .
- the binding of Ig domain of CD47 and the N-terminal Ig domain of SIRP ⁇ is believed to be sufficient for mediating transcellular bidirectional signaling.
- the binding of SIRP ⁇ to CD47 promotes tyrosine phosphorylation of the cytoplasmic region of SIRP ⁇ .
- the protein tyrosine phosphatase, SHP-2 also known as tyrosine-protein phosphatase non-receptor type 11
- SHP-2 also known as tyrosine-protein phosphatase non-receptor type 11
- Functional CD47/SIRP ⁇ interaction is required for optimal human T- and natural killer- (NK) cell homeostasis.
- the chimeric proteins of the present invention comprise variants of the extracellular domain of SIRP ⁇ .
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at
- the extracellular domain of human SIRP ⁇ has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of SIRP ⁇ .
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 85.
- the portion of the extracellular domain of SIRP ⁇ is a truncation of SEQ ID NO: 85.
- the truncation retains the ability to bind a SIRP ⁇ ligand, e.g., CD47.
- SIRP ⁇ signal regulatory protein ⁇
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 85, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a SIRP ⁇ -Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a SIRP ⁇ -Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%,
- TGFBR2 is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with TGF-beta receptor type-1, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of genes related to cell proliferation, cell cycle arrest, wound healing, immunosuppression, and tumorigenesis. Mutations in the gene encoding TGFBR2 have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.
- the chimeric proteins of the present invention comprise variants of the extracellular domain of TGFBR2.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at
- the extracellular domain of human TGFBR2 has the following amino acid sequence:
- a chimeric protein comprises a variant of the extracellular domain of TGFBR2.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 77.
- the portion of the extracellular domain of TGFBR2 is a truncation of SEQ ID NO: 77.
- the truncation retains the ability to bind a TGFBR2 ligand, e.g., TGF ⁇ 3 or TGF ⁇ 1.
- TGFBR2 TGF-beta type II receptor, a functional transmembrane serine/threonine kinase.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 77, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a TGFBR2-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a TGFBR2-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%,
- CD48 is a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins.
- SLAM signal lymphocyte activation molecules
- CD48 is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells.
- CD48 does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor.
- the chimeric proteins of the present invention comprise variants of the portion of the membrane-anchored extracellular protein CD48.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 9
- the membrane-anchored extracellular protein human CD48 has the following amino acid sequence:
- a chimeric protein comprises a variant of CD48.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or at least about 92%, or at least
- the first domain of a chimeric protein comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 81.
- the portion of CD48 is a truncation of SEQ ID NO: 81.
- the truncation retains the ability to bind a CD48 ligand/receptor, e.g., CD2 and 2B4.
- a chimeric protein of the present invention comprises: (1) a first domain comprising the amino acid sequence of SEQ ID NO: 81, (b) a second domain comprises the amino acid sequence of SEQ ID NO: 57, and (c) a linker comprises an amino acid sequence that is at least 95% identical to SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- a CD48-Fc-NKG2A chimeric protein of the present invention may comprise the following amino acid sequence:
- a chimeric protein comprises a variant of a CD48-Fc-NKG2A chimeric protein.
- the variant may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 60%, or
- the chimeric protein may comprise an amino acid sequence having one or more amino acid mutations relative to any of the protein sequences disclosed herein.
- the one or more amino acid mutations may be independently selected from substitutions, insertions, deletions, and truncations.
- the amino acid mutations are amino acid substitutions, and may include conservative and/or non-conservative substitutions. “Conservative substitutions” may be made, for instance, on the basis of similarity in polarity, charge, size, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the amino acid residues involved.
- the 20 naturally occurring amino acids can be grouped into the following six standard amino acid groups: (1) hydrophobic: Met, Ala, Val, Leu, Ile; (2) neutral hydrophilic: Cys, Ser, Thr; Asn, Gln; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; and (6) aromatic: Trp, Tyr, Phe.
- conservative substitutions are defined as exchanges of an amino acid by another amino acid listed within the same group of the six standard amino acid groups shown above. For example, the exchange of Asp by Glu retains one negative charge in the so modified polypeptide.
- glycine and proline may be substituted for one another based on their ability to disrupt a-helices.
- “non-conservative substitutions” are defined as exchanges of an amino acid by another amino acid listed in a different group of the six standard amino acid groups (1) to (6) shown above.
- the substitutions may also include non-classical amino acids (e.g., selenocysteine, pyrrolysine, N-formylmethionine ⁇ -alanine, GABA and ⁇ -Aminolevulinic acid, 4-aminobenzoic acid (PABA), D-isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, ⁇ -Abu, ⁇ -Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosme, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine,
- Mutations may also be made to the nucleotide sequences of the chimeric proteins by reference to the genetic code, including taking into account codon degeneracy.
- a chimeric protein is capable of binding murine ligand(s)/receptor(s).
- a chimeric protein is capable of binding human ligand(s)/receptor(s).
- each extracellular domain (or variant thereof) of the chimeric protein binds to its cognate receptor or ligand with a K D of about 1 nM to about 5 nM, for example, about 1 nM, about 1.5 nM, about 2 nM, about 2.5 nM, about 3 nM, about 3.5 nM, about 4 nM, about 4.5 nM, or about 5 nM.
- the chimeric protein binds to a cognate receptor or ligand with a K D of about 5 nM to about 15 nM, for example, about 5 nM, about 5.5 nM, about 6 nM, about 6.5 nM, about 7 nM, about 7.5 nM, about 8 nM, about 8.5 nM, about 9 nM, about 9.5 nM, about 10 nM, about 10.5 nM, about 11 nM, about 11.5 nM, about 12 nM, about 12.5 nM, about 13 nM, about 13.5 nM, about 14 nM, about 14.5 nM, or about 15 nM.
- each extracellular domain (or variant thereof) of the chimeric protein binds to its cognate receptor or ligand with a K D of less than about 1 ⁇ M, about 900 nM, about 800 nM, about 700 nM, about 600 nM, about 500 nM, about 400 nM, about 300 nM, about 200 nM, about 150 nM, about 130 nM, about 100 nM, about 90 nM, about 80 nM, about 70 nM, about 60 nM, about 55 nM, about 50 nM, about 45 nM, about 40 nM, about 35 nM, about 30 nM, about 25 nM, about 20 nM, about 15 nM, about 10 nM, or about 5 nM, or about 1 nM (as measured, for example, by surface plasmon resonance or biolayer interferometry).
- the chimeric protein binds to human CSF1 with a K D of less than about 1 nM, about 900 pM, about 800 pM, about 700 pM, about 600 pM, about 500 pM, about 400 pM, about 300 pM, about 200 pM, about 100 pM, about 90 pM, about 80 pM, about 70 pM, about 60 pM about 55 pM about 50 pM about 45 pM, about 40 pM, about 35 pM, about 30 pM, about 25 pM, about 20 pM, about 15 pM, or about 10 pM, or about 1 pM (as measured, for example, by surface plasmon resonance or biolayer interferometry).
- a variant of an extracellular domain is capable of binding the receptor/ligand of a native extracellular domain.
- a variant may include one or more mutations in an extracellular domain which do not affect its binding affinity to its receptor/ligand; alternately, the one or more mutations in an extracellular domain may improve binding affinity for the receptor/ligand; or the one or more mutations in an extracellular domain may reduce binding affinity for the receptor/ligand, yet not eliminate binding altogether.
- the one or more mutations are located outside the binding pocket where the extracellular domain interacts with its receptor/ligand.
- the one or more mutations are located inside the binding pocket where the extracellular domain interacts with its receptor/ligand, as long as the mutations do not eliminate binding altogether. Based on the skilled artisan's knowledge and the knowledge in the art regarding receptor-ligand binding, s/he would know which mutations would permit binding and which would eliminate binding.
- the chimeric protein exhibits enhanced stability and protein half-life.
- a chimeric protein of the present invention may comprise more than two extracellular domains.
- the chimeric protein may comprise three, four, five, six, seven, eight, nine, ten, or more extracellular domains.
- a second extracellular domain may be separated from a third extracellular domain via a linker, as disclosed herein.
- a second extracellular domain may be directly linked (e.g., via a peptide bond) to a third extracellular domain.
- a chimeric protein includes extracellular domains that are directly linked and extracellular domains that are indirectly linked via a linker, as disclosed herein.
- the chimeric protein comprises a linker.
- the linker comprising at least one cysteine residue capable of forming a disulfide bond.
- the at least one cysteine residue is capable of forming a disulfide bond between a pair (or more) of chimeric proteins.
- disulfide bond forming is responsible for maintaining a useful multimeric state of chimeric proteins. This allows for efficient production of the chimeric proteins; it allows for desired activity in vitro and in vivo.
- the linker is a polypeptide selected from a flexible amino acid sequence, an IgG hinge region, or an antibody sequence.
- the linker is derived from naturally-occurring multi-domain proteins or is an empirical linker as described, for example, in Chichili et al., (2013), Protein Sci. 22(2):153-167, Chen et al., (2013), Adv Drug Deliv Rev. 65(10):1357-1369, the entire contents of which are hereby incorporated by reference.
- the linker may be designed using linker designing databases and computer programs such as those described in Chen et al., (2013), Adv Drug Deliv Rev. 65(10):1357-1369 and Crasto et. al., (2000), Protein Eng. 13(5):309-312, the entire contents of which are hereby incorporated by reference.
- the linker comprises a polypeptide.
- the polypeptide is less than about 500 amino acids long, about 450 amino acids long, about 400 amino acids long, about 350 amino acids long, about 300 amino acids long, about 250 amino acids long, about 200 amino acids long, about 150 amino acids long, or about 100 amino acids long.
- the linker may be less than about 100, about 95, about 90, about 85, about 80, about 75, about 70, about 65, about 60, about 55, about 50, about 45, about 40, about 35, about 30, about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 12, about 11, about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, or about 2 amino acids long.
- the linker is flexible.
- the linker is rigid.
- the linker is substantially comprised of glycine and serine residues (e.g., about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 95%, or about 97%, or about 98%, or about 99%, or about 100% glycines and serines).
- the linker comprises a hinge region of an antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g., IgG1, IgG2, IgG3, and IgG4, and IgA1, and IgA2)).
- the hinge region found in IgG, IgA, IgD, and
- IgE class antibodies acts as a flexible spacer, allowing the Fab portion to move freely in space.
- the hinge domains are structurally diverse, varying in both sequence and length among immunoglobulin classes and subclasses. For example, the length and flexibility of the hinge region varies among the IgG subclasses.
- the hinge region of IgG1 encompasses amino acids 216-231 and, because it is freely flexible, the Fab fragments can rotate about their axes of symmetry and move within a sphere centered at the first of two inter-heavy chain disulfide bridges.
- IgG2 has a shorter hinge than IgG1, with 12 amino acid residues and four disulfide bridges.
- the hinge region of IgG2 lacks a glycine residue, is relatively short, and contains a rigid poly-proline double helix, stabilized by extra inter-heavy chain disulfide bridges. These properties restrict the flexibility of the IgG2 molecule.
- IgG3 differs from the other subclasses by its unique extended hinge region (about four times as long as the IgG1 hinge), containing 62 amino acids (including 21 prolines and 11 cysteines), forming an inflexible poly-proline double helix. In IgG3, the Fab fragments are relatively far away from the Fc fragment, giving the molecule a greater flexibility.
- the elongated hinge in IgG3 is also responsible for its higher molecular weight compared to the other subclasses.
- the hinge region of IgG4 is shorter than that of IgG1 and its flexibility is intermediate between that of IgG1 and IgG2.
- the flexibility of the hinge regions reportedly decreases in the order IgG3>IgG1>IgG4>IgG2.
- the linker may be derived from human IgG4 and contain one or more mutations to enhance dimerization (including S228P) or FcRn binding.
- the immunoglobulin hinge region can be further subdivided functionally into three regions: the upper hinge region, the core region, and the lower hinge region.
- the upper hinge region includes amino acids from the carboxyl end of CH1 to the first residue in the hinge that restricts motion, generally the first cysteine residue that forms an interchain disulfide bond between the two heavy chains.
- the length of the upper hinge region correlates with the segmental flexibility of the antibody.
- the core hinge region contains the inter-heavy chain disulfide bridges, and the lower hinge region joins the amino terminal end of the CH2 domain and includes residues in CH2. Id.
- the core hinge region of wild-type human IgG1 contains the sequence CPPC (SEQ ID NO: 24) which, when dimerized by disulfide bond formation, results in a cyclic octapeptide believed to act as a pivot, thus conferring flexibility.
- the present linker comprises, one, or two, or three of the upper hinge region, the core region, and the lower hinge region of any antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g., IgG1, IgG2, IgG3, and IgG4, and IgA1 and IgA2)).
- the hinge region may also contain one or more glycosylation sites, which include a number of structurally distinct types of sites for carbohydrate attachment.
- IgA1 contains five glycosylation sites within a 17-amino-acid segment of the hinge region, conferring resistance of the hinge region polypeptide to intestinal proteases, considered an advantageous property for a secretory immunoglobulin.
- the linker of the present invention comprises one or more glycosylation sites.
- the linker comprises an Fc domain of an antibody (e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g., IgG1, IgG2, IgG3, and IgG4, and IgA1 and IgA2)).
- an antibody e.g., of IgG, IgA, IgD, and IgE, inclusive of subclasses (e.g., IgG1, IgG2, IgG3, and IgG4, and IgA1 and IgA2)
- the linker comprises a hinge-CH2-CH3 Fc domain derived from IgG4. In embodiments, the linker comprises a hinge-CH2-CH3 Fc domain derived from a human IgG4. In embodiments, the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of any one of SEQ ID NO: 1 to SEQ ID NO: 3, e.g., at least 95% identical to the amino acid sequence of SEQ ID NO: 2. In embodiments, the linker comprises one or more joining linkers, such joining linkers independently selected from SEQ ID NOs: 4-50 (or a variant thereof).
- the linker comprises two or more joining linkers each joining linker independently selected from SEQ ID NOs: 4-50 (or a variant thereof); wherein one joining linker is N terminal to the hinge-CH2-CH3 Fc domain and another joining linker is C terminal to the hinge-CH2-CH3 Fc domain.
- the linker comprises a hinge-CH2-CH3 Fc domain derived from a human IgG1 antibody.
- the Fc domain exhibits increased affinity for and enhanced binding to the neonatal Fc receptor (FcRn).
- the Fc domain includes one or more mutations that increases the affinity and enhances binding to FcRn. Without wishing to be bound by theory, it is believed that increased affinity and enhanced binding to FcRn increases the in vivo half-life of the present chimeric proteins.
- the Fc domain in a linker contains one or more amino acid substitutions at amino acid residue 250, 252, 254, 256, 308, 309, 311, 416, 428, 433 or 434 (in accordance with Kabat numbering, as in as in Kabat, et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) expressly incorporated herein by reference), or equivalents thereof.
- the amino acid substitution at amino acid residue 250 is a substitution with glutamine.
- the amino acid substitution at amino acid residue 252 is a substitution with tyrosine, phenylalanine, tryptophan or threonine.
- the amino acid substitution at amino acid residue 254 is a substitution with threonine.
- the amino acid substitution at amino acid residue 256 is a substitution with serine, arginine, glutamine, glutamic acid, aspartic acid, or threonine.
- the amino acid substitution at amino acid residue 308 is a substitution with threonine.
- the amino acid substitution at amino acid residue 309 is a substitution with proline.
- the amino acid substitution at amino acid residue 311 is a substitution with serine.
- the amino acid substitution at amino acid residue 385 is a substitution with arginine, aspartic acid, serine, threonine, histidine, lysine, alanine or glycine.
- the amino acid substitution at amino acid residue 386 is a substitution with threonine, proline, aspartic acid, serine, lysine, arginine, isoleucine, or methionine.
- the amino acid substitution at amino acid residue 387 is a substitution with arginine, proline, histidine, serine, threonine, or alanine.
- the amino acid substitution at amino acid residue 389 is a substitution with proline, serine or asparagine.
- the amino acid substitution at amino acid residue 416 is a substitution with serine.
- the amino acid substitution at amino acid residue 428 is a substitution with leucine.
- the amino acid substitution at amino acid residue 433 is a substitution with arginine, serine, isoleucine, proline, or glutamine.
- the amino acid substitution at amino acid residue 434 is a substitution with histidine, phenylalanine, or tyrosine.
- the Fc domain linker (e.g., comprising an IgG constant region) comprises one or more mutations such as substitutions at amino acid residue 252, 254, 256, 433, 434, or 436 (in accordance with Kabat numbering, as in as in Kabat, et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) expressly incorporated herein by reference).
- the IgG constant region includes a triple M252Y/S254T/T256E mutation or YTE mutation.
- the IgG constant region includes a triple H433K/N434F/Y436H mutation or KFH mutation.
- the IgG constant region includes an YTE and KFH mutation in combination.
- the linker comprises an IgG constant region that contains one or more mutations at amino acid residues 250, 253, 307, 310, 380, 428, 433, 434, and 435 (in accordance with Kabat numbering, as in as in Kabat, et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991) expressly incorporated herein by reference).
- Illustrative mutations include T250Q, M428L, T307A, E380A, 1253A, H310A, M428L, H433K, N434A, N434F, N434S, and H435A.
- the IgG constant region comprises a M428L/N434S mutation or LS mutation. In embodiments, the IgG constant region comprises a T250Q/M428L mutation or QL mutation. In embodiments, the IgG constant region comprises an N434A mutation. In embodiments, the IgG constant region comprises a T307A/E380A/N434A mutation or MA mutation. In embodiments, the IgG constant region comprises an 1253A/H310A/H435A mutation or IHH mutation. In embodiments, the IgG constant region comprises a H433K/N434F mutation. In embodiments, the IgG constant region comprises a M252Y/S254T/T256E and a H433K/N434F mutation in combination.
- An illustrative Fc stabilizing mutant is S228P.
- Illustrative Fc half-life extending mutants are T250Q, M428L, V308T, L309P, and Q311S and the present linkers may comprise 1, or 2, or 3, or 4, or 5 of these mutants.
- the chimeric protein binds to FcRn with high affinity.
- the chimeric protein may bind to FcRn with a K D of about 1 nM to about 80 nM.
- the chimeric protein may bind to FcRn with a K D of about 1 nM, about 2 nM, about 3 nM, about 4 nM, about 5 nM, about 6 nM, about 7 nM, about 8 nM, about 9 nM, about 10 nM, about 15 nM, about 20 nM, about 25 nM, about 30 nM, about 35 nM, about 40 nM, about 45 nM, about 50 nM, about 55 nM, about 60 nM, about 65 nM, about 70 nM, about 71 nM, about 72 nM, about 73 nM, about 74 nM, about 75 nM, about 76 nM, about 77 n
- the chimeric protein may bind to FcRn with a K D of about 9 nM. In embodiments, the chimeric protein does not substantially bind to other Fc receptors (i.e. other than FcRn) with effector function.
- the Fc domain in a linker has the amino acid sequence of SEQ ID NO: 1 (see Table 1, below), or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.
- mutations are made to SEQ ID NO: 1 to increase stability and/or half-life.
- the Fc domain in a linker comprises the amino acid sequence of SEQ ID NO: 2 (see Table 1, below), or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.
- the Fc domain in a linker comprises the amino acid sequence of SEQ ID NO: 3 (see Table 1, below), or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto.
- one or more joining linkers may be employed to connect an Fc domain in a linker (e.g., one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto) and the extracellular domains.
- a linker e.g., one of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3 or at least 90%, or 93%, or 95%, or 97%, or 98%, or 99% identity thereto
- any one of SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, or variants thereof may connect an extracellular domain as disclosed herein and an Fc domain in a linker as disclosed herein.
- any one of SEQ ID NOs: 4 to 50, or variants thereof are located between an extracellular domain as disclosed herein and an Fc domain as disclosed herein.
- the present chimeric proteins may comprise variants of the joining linkers disclosed in Table 1, below.
- a linker may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or
- first and second joining linkers may be different or they may be the same.
- linker comprising at least a part of an Fc domain in a chimeric protein, helps avoid formation of insoluble and, likely, non-functional protein concatamers and/or aggregates. This is in part due to the presence of cysteines in the Fc domain which are capable of forming disulfide bonds between chimeric proteins.
- a chimeric protein may comprise one or more joining linkers, as disclosed herein, and lack an Fc domain linker, as disclosed herein.
- first and/or second joining linkers are independently selected from the amino acid sequences of SEQ ID Nos: 4 to 50 and are provided in Table 1 below:
- the joining linker substantially comprises glycine and serine residues (e.g., about 30%, or about 40%, or about 50%, or about 60%, or about 70%, or about 80%, or about 90%, or about 95%, or about 97%, or about 98%, or about 99%, or about 100% glycines and serines).
- the joining linker is (Gly 4 Ser) n , where n is from about 1 to about 8, e.g., 1, 2, 3, 4, 5, 6, 7, or 8 (SEQ ID NO: 25 to SEQ ID NO: 32, respectively).
- the joining linker sequence is GGSGGSGGGGSGGGGS (SEQ ID NO: 33).
- the joining linker is GGS.
- a joining linker has the sequence (Gly) n where n is any number from 1 to 100, for example: (Gly) 8 (SEQ ID NO: 34) and (Gly) 6 (SEQ ID NO: 35).
- the joining linker is one or more of GGGSE (SEQ ID NO: 47), GSESG (SEQ ID NO: 48), GSEGS (SEQ ID NO: 49), GEGGSGEGSSGEGSSSEGGGSEGGGSEGGGSEGGS (SEQ ID NO: 50), and a joining linker of randomly placed G, S, and E every 4 amino acid intervals.
- a chimeric protein comprises an extracellular domain (ECD) of CD80, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 61.
- a chimeric protein comprises an extracellular domain (ECD) of CD86, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 65.
- a chimeric protein comprises an extracellular domain (ECD) of CD58, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 68.
- a chimeric protein comprises an extracellular domain (ECD) of PD-1, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 71.
- a chimeric protein comprises an extracellular domain (ECD) of SLAMF6, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 75.
- a chimeric protein comprises an extracellular domain (ECD) of SIRP ⁇ , one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 86.
- a chimeric protein comprises an extracellular domain (ECD) of TGFBR2, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 79.
- a chimeric protein comprises a portion of the membrane-anchored extracellular protein CD48, one joining linker preceding an Fc domain, a second joining linker following the Fc domain, and an ECD of NKG2A
- the chimeric protein may comprise the following structure:
- This chimeric protein comprises the sequence of SEQ ID NO: 83.
- a chimeric protein comprises a modular linker as shown in Table 2:
- the present chimeric proteins may comprise variants of the modular linkers disclosed in Table 2, above.
- a linker may have at least about 60%, or at least about 61%, or at least about 62%, or at least about 63%, or at least about 64%, or at least about 65%, or at least about 66%, or at least about 67%, or at least about 68%, or at least about 69%, or at least about 70%, or at least about 71%, or at least about 72%, or at least about 73%, or at least about 74%, or at least about 75%, or at least about 76%, or at least about 77%, or at least about 78%, or at least about 79%, or at least about 80%, or at least about 81%, or at least about 82%, or at least about 83%, or at least about 84%, or at least about 85%, or at least about 86%, or at least about 87%, or at least about 88%, or at least about 89%, or at least about 90%, or at least about 91%, or
- the linker may be flexible, including without limitation highly flexible. In embodiments, the linker may be rigid, including without limitation a rigid alpha helix. Characteristics of illustrative joining linkers is shown below in Table 3:
- the linker may be functional.
- the linker may function to improve the folding and/or stability, improve the expression, improve the pharmacokinetics, and/or improve the bioactivity of the present chimeric protein.
- the linker may function to target the chimeric protein to a particular cell type or location.
- a chimeric protein comprises only one joining linkers.
- a chimeric protein lacks joining linkers.
- the linker is a synthetic linker such as polyethylene glycol (PEG).
- PEG polyethylene glycol
- a chimeric protein has a first domain which is sterically capable of binding its ligand/receptor and/or the second domain which is sterically capable of binding its ligand/receptor.
- first domain which is sterically capable of binding its ligand/receptor
- second domain which is sterically capable of binding its ligand/receptor.
- This flexibility and/or physical distance (which is referred to as “slack”) may be normally present in the extracellular domain(s), normally present in the linker, and/or normally present in the chimeric protein (as a whole).
- an amino acid sequence may be added to one or more extracellular domains and/or to the linker to provide the slack needed to avoid steric hindrance.
- Any amino acid sequence that provides slack may be added.
- the added amino acid sequence comprises the sequence (Gly) n where n is any number from 1 to 100. Additional examples of addable amino acid sequence include the joining linkers described in Table 1 and Table 3.
- a polyethylene glycol (PEG) linker may be added between an extracellular domain and a linker to provide the slack needed to avoid steric hindrance. Such PEG linkers are well known in the art.
- a chimeric protein of the present invention comprises the extracellular domain of CD80 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of CD80 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “CD80-Fc-NKG2A”.
- a chimeric protein of the present invention comprises the extracellular domain of CD86 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of CD86 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “CD86-Fc-NKG2A”.
- a chimeric protein of the present invention comprises the extracellular domain of CD58 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of CD58 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “CD58-Fc-NKG2A”.
- a chimeric protein of the present invention comprises the extracellular domain of PD-1 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of PD-1 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “PD-1-Fc-NKG2A”.
- a chimeric protein of the present invention comprises the extracellular domain of SLAMF6 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of SLAMF6 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “SLAMF6-Fc-NKG2A”.
- a chimeric protein of the present invention comprises the extracellular domain of SIRP ⁇ (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of SIRP ⁇ (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “SIRP ⁇ -Fc-NKG2A”.
- a chimeric protein of the present invention comprises the extracellular domain of TGFBR2 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the extracellular domain of TGFBR2 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- TGFBR2-Fc-NKG2A Such a chimeric protein may be referred to herein as “TGFBR2-Fc-NKG2A”.
- a chimeric protein of the present invention comprises a portion of the membrane-anchored extracellular protein CD48 (or a variant thereof), a linker, and the extracellular domain of NKG2A (or a variant thereof).
- the linker comprises a hinge-CH2-CH3 Fc domain, e.g., from an IgG1 or from IgG4, including human IgG1 or IgG4.
- a chimeric protein of the present invention comprises the portion of the membrane-anchored extracellular protein CD48 (or a variant thereof), linker comprising a hinge-CH2-CH3 Fc domain, and the extracellular domain of NKG2A (or a variant thereof).
- Such a chimeric protein may be referred to herein as “CD48-Fc-NKG2A”.
- Non-limiting examples of chimeric proteins of the present disclosure are is shown below in Table 4:
- ECD Extracellular Domain
- a Type I Transmem- brane Protein or The ECD Of a Membrane- A Type II Chimeric Protein of a General Anchored Extra Trans- Structure of: N terminus -(a) cellular Protein membrane -(b) -(c) -C terminus, Where (b) (a) Protein (c) is a Liker Adjoining (a) and (b) Human CD80 ECD: Human NKG2A Human CD80-Fc-NKG2A chimeric protein: VIHVTKEVKEVATLSCG ECD: VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKK HNVSVEELAQTRIYWQ PSTLIQRHNNSS MVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPS KEKKMVLTMMSGDMNI LNTRTQKARHC DEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPS WPEYKNRTIFDITNNLS
- An aspect of the present invention is the use of a herein-disclosed chimeric protein as a medicament in the treatment of a cancer or a viral infection.
- Another aspect of the present invention is the use of a herein-disclosed chimeric protein, in the manufacture of a medicament.
- Yet another aspect of the present invention is an expression vector comprising a nucleic acid that encodes a herein-disclosed chimeric protein.
- the present invention provides a host cell comprising an expression vector that comprises a nucleic acid that encodes a herein-disclosed chimeric protein.
- a chimeric protein disclosed herein may be used in the treatment of cancer and/or in the treatment of a viral infection.
- aspects of the present invention provide methods of treating a cancer or treating a viral infection.
- the methods comprise a step of administering to a subject in need thereof an effective amount of a pharmaceutical composition comprising herein-disclosed chimeric protein, e.g., a therapeutically effective amount of the chimeric protein.
- the present invention pertains to cancers and/or tumors; for example, the treatment or prevention of cancers and/or tumors.
- the treatment of cancer involves, in embodiments, modulating the immune system with the present chimeric proteins to favor of increasing or activating immune stimulatory signals.
- the method reduces the amount or activity of regulatory T cells (Tregs) as compared to untreated subjects or subjects treated with antibodies directed to transmembrane proteins, membrane-bound extracellular proteins, and/or their respective ligands or receptors.
- Tregs regulatory T cells
- the method increases priming of effector T cells in draining lymph nodes of the subject as compared to untreated subjects or subjects treated with antibodies directed to transmembrane proteins, membrane-bound extracellular proteins, and/or their respective ligands or receptors.
- the method causes an overall decrease in immunosuppressive cells and a shift toward a more inflammatory tumor environment as compared to untreated subjects or subjects treated with antibodies directed to transmembrane proteins, membrane-bound extracellular proteins, and/or their respective ligands or receptors.
- the present chimeric proteins are capable of, or can be used in methods comprising, modulating the amplitude of an immune response, e.g., modulating the level of effector output.
- the present chimeric proteins alter the extent of immune stimulation as compared to immune inhibition to increase the amplitude of a T cell response, including, without limitation, stimulating increased levels of cytokine production, proliferation or target killing potential.
- the patient's T cells are activated and/or stimulated by the chimeric protein, with the activated T cells being capable of dividing and/or secreting cytokines.
- Cancers or tumors refer to an uncontrolled growth of cells and/or abnormal increased cell survival and/or inhibition of apoptosis which interferes with the normal functioning of the bodily organs and systems. Included are benign and malignant cancers, polyps, hyperplasia, as well as dormant tumors or micrometastases. Also, included are cells having abnormal proliferation that is not impeded by the immune system (e.g., virus-infected cells).
- the cancer may be a primary cancer or a metastatic cancer.
- the primary cancer may be an area of cancer cells at an originating site that becomes clinically detectable, and may be a primary tumor.
- the metastatic cancer may be the spread of a disease from one organ or part to another non-adjacent organ or part.
- the metastatic cancer may be caused by a cancer cell that acquires the ability to penetrate and infiltrate surrounding normal tissues in a local area, forming a new tumor, which may be a local metastasis.
- the cancer may also be caused by a cancer cell that acquires the ability to penetrate the walls of lymphatic and/or blood vessels, after which the cancer cell is able to circulate through the bloodstream (thereby being a circulating tumor cell) to other sites and tissues in the body.
- the cancer may be due to a process such as lymphatic or hematogeneous spread.
- the cancer may also be caused by a tumor cell that comes to rest at another site, re-penetrates through the vessel or walls, continues to multiply, and eventually forms another clinically detectable tumor.
- the cancer may be this new tumor, which may be a metastatic (or secondary) tumor.
- the cancer may be caused by tumor cells that have metastasized, which may be a secondary or metastatic tumor.
- the cells of the tumor may be like those in the original tumor.
- the secondary tumor while present in the liver, is made up of abnormal breast or colon cells, not of abnormal liver cells.
- the tumor in the liver may thus be a metastatic breast cancer or a metastatic colon cancer, not liver cancer.
- the cancer may have an origin from any tissue.
- the cancer may originate from melanoma, colon, breast, or prostate, and thus may be made up of cells that were originally skin, colon, breast, or prostate, respectively.
- the cancer may also be a hematological malignancy, which may be leukemia or lymphoma.
- the cancer may invade a tissue such as liver, lung, bladder, or intestinal.
- cancers and/or tumors of the present invention include, but are not limited to, cancer is selected from acute lymphoblastic leukemia (ALL); AIDS-related lymphoma; basal cell carcinoma; biliary tract cancer; bladder cancer; bone cancer; brain and central nervous system cancer; breast cancer; cancer of the digestive system; cancer of the head and neck; cancer of the peritoneum; cancer of the respiratory system; cancer of the urinary system; carcinoma; cervical cancer; choriocarcinoma; chronic lymphocytic leukemia (CLL); chronic myeloblastic leukemia; colon and rectum cancer; connective tissue cancer; edema (e.g., that is associated with brain tumors); endometrial cancer; esophageal cancer; eye cancer; gastric cancer (including gastrointestinal cancer); glioblastoma; Hairy cell leukemia; hepatic carcinoma; hepatoma; intra-epithelial neoplasm; kidney or renal cancer; larynx cancer; leukemia; liver cancer
- the chimeric protein is used to treat a subject that has a treatment-refractory cancer. In embodiments, the chimeric protein is used to treat a subject that is refractory to one or more immune-modulating agents. For example, in embodiments, the chimeric protein is used to treat a subject that presents no response to treatment, or even progress, after 12 weeks or so of treatment.
- the subject is refractory to a PD-1 and/or PD-L1 and/or PD-L2 agent, including, for example, nivolumab (ONO-4538/BMS-936558, MDX1106, OPDIVO, BRISTOL MYERS SQUIBB), pembrolizumab (KEYTRUDA, MERCK), pidilizumab (CT-011, CURE TECH), MK-3475 (MERCK), BMS 936559 (BRISTOL MYERS SQUIBB), Ibrutinib (PHARMACYCLICS/ABBVIE), atezolizumab (TECENTRIQ, GENENTECH), and/or MPDL3280A (ROCHE)-refractory patients.
- nivolumab ONO-4538/BMS-936558, MDX1106, OPDIVO, BRISTOL MYERS SQUIBB
- pembrolizumab KEYTRUDA, MERCK
- pidilizumab
- the subject is refractory to an anti-CTLA-4 agent, e.g., ipilimumab (YERVOY)-refractory patients (e.g., melanoma patients).
- an anti-CTLA-4 agent e.g., ipilimumab (YERVOY)-refractory patients (e.g., melanoma patients).
- YERVOY ipilimumab
- the present invention provides methods of cancer treatment that rescue patients that are non-responsive to various therapies, including monotherapy of one or more immune-modulating agents.
- the present invention provides chimeric proteins which target a cell or tissue within the tumor microenviroment.
- the cell or tissue within the tumor microenvironment expresses one or more targets or binding partners of the chimeric protein.
- the tumor microenvironment refers to the cellular milieu, including cells, secreted proteins, physiological small molecules, and blood vessels in which the tumor exists.
- the cells or tissue within the tumor microenvironment are one or more of: tumor vasculature; tumor-infiltrating lymphocytes; fibroblast reticular cells; endothelial progenitor cells (EPC); cancer-associated fibroblasts; pericytes; other stromal cells; components of the extracellular matrix (ECM); dendritic cells; antigen presenting cells; T-cells; regulatory T cells; macrophages; neutrophils; and other immune cells located proximal to a tumor.
- the present chimeric protein targets a cancer cell.
- the cancer cell expresses one or more of targets or binding partners of the chimeric protein.
- the present methods provide treatment with the chimeric protein in a patient who is refractory to an additional agent, such “additional agents” being disclosed elsewhere herein, inclusive, without limitation, of the various chemotherapeutic agents disclosed herein.
- costimulatory and co-inhibitory signals Two major families of costimulatory molecules include the B7 and the tumor necrosis factor (TNF) families. These molecules bind to receptors on T cells belonging to the CD28 or TNF receptor families, respectively. Many well-defined co-inhibitors and their receptors belong to the B7 and CD28 families.
- B7 and CD28 families Two major families of costimulatory molecules include the B7 and the tumor necrosis factor (TNF) families. These molecules bind to receptors on T cells belonging to the CD28 or TNF receptor families, respectively. Many well-defined co-inhibitors and their receptors belong to the B7 and CD28 families.
- TNF tumor necrosis factor
- an immune stimulatory signal refers to a signal that enhances an immune response.
- such signals may enhance antitumor immunity.
- immune stimulatory signal may be identified by directly stimulating proliferation, cytokine production, killing activity, or phagocytic activity of leukocytes.
- Specific examples include direct stimulation of TNF superfamily receptors such as OX40, LTbR, 4-1BB or TNFRSF25 using either receptor agonist antibodies or using chimeric proteins encoding the ligands for such receptors (OX40L, LIGHT, 4-1BBL, TL1A, respectively). Stimulation from any one of these receptors may directly stimulate the proliferation and cytokine production of individual T cell subsets.
- Another example includes direct stimulation of an immune inhibitory cell with through a receptor that inhibits the activity of such an immune suppressor cell.
- This would include, for example, stimulation of CD4+FoxP3+ regulatory T cells with a GITR agonist antibody or GITRL containing chimeric protein, which would reduce the ability of those regulatory T cells to suppress the proliferation of conventional CD4+ or CD8+ T cells.
- this would include stimulation of CD40 on the surface of an antigen presenting cell using a CD40 agonist antibody or a chimeric protein containing CD40L, causing activation of antigen presenting cells including enhanced ability of those cells to present antigen in the context of appropriate native costimulatory molecules, including those in the B7 or TNF superfamily.
- the present chimeric proteins are capable of, or find use in methods involving, enhancing, restoring, promoting and/or stimulating immune modulation.
- the present chimeric proteins described herein, restore, promote and/or stimulate the activity or activation of one or more immune cells against tumor cells including, but not limited to: T cells, cytotoxic T lymphocytes, T helper cells, natural killer (NK) cells, natural killer T (NKT) cells, anti-tumor macrophages (e.g. M1 macrophages), B cells, and dendritic cells.
- the present chimeric proteins enhance, restore, promote and/or stimulate the activity and/or activation of T cells, including, by way of a non-limiting example, activating and/or stimulating one or more T-cell intrinsic signals, including a pro-survival signal; an autocrine or paracrine growth signal; a p38 MAPK-, ERK-, STAT-, JAK-, AKT- or PI3K-mediated signal; an anti-apoptotic signal; and/or a signal promoting and/or necessary for one or more of: pro-inflammatory cytokine production or T cell migration or T cell tumor infiltration.
- T-cell intrinsic signals including a pro-survival signal; an autocrine or paracrine growth signal; a p38 MAPK-, ERK-, STAT-, JAK-, AKT- or PI3K-mediated signal; an anti-apoptotic signal; and/or a signal promoting and/or necessary for one or more of: pro-inflammatory cytokine production or T cell
- the present chimeric proteins are capable of, or find use in methods involving, causing an increase of one or more of T cells (including without limitation cytotoxic T lymphocytes, T helper cells, natural killer T (NKT) cells), B cells, natural killer (NK) cells, natural killer T (NKT) cells, dendritic cells, monocytes, and macrophages (e.g., one or more of M1 and M2) into a tumor or the tumor microenvironment.
- T cells including without limitation cytotoxic T lymphocytes, T helper cells, natural killer T (NKT) cells), B cells, natural killer (NK) cells, natural killer T (NKT) cells, dendritic cells, monocytes, and macrophages (e.g., one or more of M1 and M2) into a tumor or the tumor microenvironment.
- T cells including without limitation cytotoxic T lymphocytes, T helper cells, natural killer T (NKT) cells), B cells, natural killer (NK) cells, natural killer T (NKT) cells, dend
- the present chimeric protein induces CD19 expression and/or increases the number of CD19 positive cells (e.g., CD19 positive B cells). In embodiments, the present chimeric protein induces IL-15Ra expression and/or increases the number of IL-15Ra positive cells (e.g., IL-15Ra positive dendritic cells).
- the present chimeric proteins are capable of, or find use in methods involving, inhibiting and/or causing a decrease in immunosuppressive cells (e.g., myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs), tumor associated neutrophils (TANs), M2 macrophages, and tumor associated macrophages (TAMs)), and particularly within the tumor and/or tumor microenvironment (TME).
- immunosuppressive cells e.g., myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs), tumor associated neutrophils (TANs), M2 macrophages, and tumor associated macrophages (TAMs)
- TME tumor associated macrophages
- the present therapies may alter the ratio of M1 versus M2 macrophages in the tumor site and/or TME to favor M1 macrophages.
- the present chimeric proteins are able to increase the serum levels of various cytokines including, but not limited to, one or more of IFN ⁇ , TNF ⁇ , IL-2, IL-4, IL-5, IL-6, IL-9, IL-10, IL-13, IL-17A, IL-17F, and IL-22.
- the present chimeric proteins are capable of enhancing IL-2, IL-4, IL-5, IL-10, IL-13, IL-17A, IL-22, TNF ⁇ or IFN ⁇ in the serum of a treated subject.
- administration of the present chimeric protein is capable of enhancing TNF ⁇ secretion.
- administration of the present chimeric protein is capable of enhancing superantigen mediated TNF ⁇ secretion by leukocytes. Detection of such a cytokine response may provide a method to determine the optimal dosing regimen for the indicated chimeric protein.
- the chimeric protein is capable of increasing or preventing a decrease in a sub-population of CD4+ and/or CD8+ T cells.
- the chimeric protein is capable of enhancing tumor-killing activity by T cells.
- the present chimeric proteins inhibit, block and/or reduce cell death of an anti-tumor CD8+ and/or CD4+ T cell; or stimulate, induce, and/or increase cell death of a pro-tumor T cell.
- T cell exhaustion is a state of T cell dysfunction characterized by progressive loss of proliferative and effector functions, culminating in clonal deletion.
- a pro-tumor T cell refers to a state of T cell dysfunction that arises during many chronic infections, inflammatory diseases, and cancer. This dysfunction is defined by poor proliferative and/or effector functions, sustained expression of inhibitory receptors and a transcriptional state distinct from that of functional effector or memory T cells. Exhaustion prevents optimal control of infection and tumors.
- Illustrative pro-tumor T cells include, but are not limited to, Tregs, CD4+ and/or CD8+ T cells expressing one or more checkpoint inhibitory receptors, Th2 cells and Th17 cells.
- Checkpoint inhibitory receptors refer to receptors expressed on immune cells that prevent or inhibit uncontrolled immune responses.
- an anti-tumor CD8+ and/or CD4+ T cell refers to T cells that can mount an immune response to a tumor.
- the present chimeric proteins are capable of, and can be used in methods comprising, increasing a ratio of effector T cells to regulatory T cells.
- Illustrative effector T cells include ICOS + effector T cells; cytotoxic T cells (e.g., a ⁇ TCR, CD3 + , CD8 + , CD45RO + ); CD4 + effector T cells (e.g., a ⁇ TCR, CD3 + , CD4 + , CCR7 + , CD62Lhi, IL ⁇ 7R/CD127 + ); CD8 + effector T cells (e.g., a ⁇ TCR, CD3 + , CD8 + , CCR7 + , CD62Lhi, IL ⁇ 7R/CD127 + ); effector memory T cells (e.g., CD62Llow, CD44 + , TCR, CD3 + , IL ⁇ 7R/CD127 + , IL-15R + , CCR7low); central memory T cells (e.g.
- Illustrative regulatory T cells include ICOS + regulatory T cells, CD4 + CD25 + FOXP3 + regulatory T cells, CD4 + CD25 + regulatory T cells, CD4 + CD25 ⁇ regulatory T cells, CD4 + CD25high regulatory T cells, TIM-3 + PD-1 + regulatory T cells, lymphocyte activation gene-3 (LAG-3) + regulatory T cells, CTLA-4/CD152 + regulatory T cells, neuropilin-1 (Nrp-1) + regulatory T cells, CCR4 + CCR8 + regulatory T cells, CD62L (L-selectin) + regulatory T cells, CD45RBlow regulatory T cells, CD127low regulatory T cells, LRRC32/GARP + regulatory T cells, CD39 + regulatory T cells, GITR + regulatory T cells, LAP + regulatory T cells, 1B11 + regulatory T cells, BTLA + regulatory T cells, type 1 regulatory T cells (Tr1 cells),T helper type 3 (Th3) cells, regulatory cell of natural killer T cell phenotype (NKTregs), CD8 + regulatory T
- the chimeric protein of the invention causes an increase in effector T cells (e.g., CD4+CD25 ⁇ T cells).
- the chimeric protein causes a decrease in regulatory T cells (e.g., CD4+CD25+ T cells).
- the chimeric protein generates a memory response which may be capable of preventing relapse or protecting the animal from a recurrence and/or preventing, or reducing the likelihood of, metastasis.
- a chimeric protein of the present invention stimulates both active tumor destruction and also immune recognition of tumor antigens, which are essential in programming a memory response capable of preventing relapse.
- the chimeric protein is capable of causing activation of antigen presenting cells. In embodiments, the chimeric protein is capable enhancing the ability of antigen presenting cells to present antigen.
- the present chimeric proteins are capable of, and can be used in methods comprising, transiently stimulating effector T cells for longer than about 12 hours, about 24 hours, about 48 hours, about 72 hours or about 96 hours or about 1 week or about 2 weeks.
- the transient stimulation of effector T cells occurs substantially in a patient's bloodstream or in a particular tissue/location including lymphoid tissues such as for example, the bone marrow, lymph-node, spleen, thymus, mucosa-associated lymphoid tissue (MALT), non-lymphoid tissues, or in the tumor microenvironment.
- lymphoid tissues such as for example, the bone marrow, lymph-node, spleen, thymus, mucosa-associated lymphoid tissue (MALT), non-lymphoid tissues, or in the tumor microenvironment.
- the present chimeric protein unexpectedly provides binding of the extracellular domain components to their respective binding partners with slow off rates (Kd or K off ). In embodiments, this provides an unexpectedly long interaction of the receptor to ligand and vice versa. Such an effect allows for a longer positive signal effect, e.g., increase in or activation of immune stimulatory signals.
- the present chimeric protein e.g., via the long off rate binding allows sufficient signal transmission to provide immune cell proliferation, allow for anti-tumor attack, allows sufficient signal transmission to provide release of stimulatory signals, e.g., cytokines.
- the chimeric protein is capable of forming a stable synapse between cells.
- the stable synapse of cells promoted by the chimeric proteins e.g., between cells bearing negative signals
- this provides longer on-target (e.g., intra-tumoral) half-life (t 1/2 ) as compared to serum t 1/2 of the chimeric proteins.
- Such properties could have the combined advantage of reducing off-target toxicities associated with systemic distribution of the chimeric proteins.
- the chimeric protein is capable of providing a sustained immunomodulatory effect.
- the present chimeric proteins provide synergistic therapeutic effects (e.g., anti-tumor effects) as it allows for improved site-specific interplay of two immunotherapy agents.
- the present chimeric proteins provide the potential for reducing off-site and/or systemic toxicity.
- the present chimeric protein exhibit enhanced safety profiles. In embodiment, the present chimeric protein exhibit reduced toxicity profiles. For example, administration of the present chimeric proteins may result in reduced side effects such as one or more of diarrhea, inflammation (e.g., of the gut), or weight loss, which occur following administration of antibodies directed to the ligand(s)/receptor(s) targeted by the extracellular domains of the present chimeric proteins. In embodiments, the present chimeric protein provides improved safety, as compared to antibodies directed to the ligand(s)/receptor(s) targeted by the extracellular domains of the present chimeric proteins, yet, without sacrificing efficacy.
- the present chimeric proteins provide reduced side-effects, e.g., GI complications, relative to current immunotherapies, e.g., antibodies directed to ligand(s)/receptor(s) targeted by the extracellular domains of the present chimeric proteins.
- GI complications include abdominal pain, appetite loss, autoimmune effects, constipation, cramping, dehydration, diarrhea, eating problems, fatigue, flatulence, fluid in the abdomen or ascites, gastrointestinal (GI) dysbiosis, GI mucositis, inflammatory bowel disease, irritable bowel syndrome (IBS-D and IBS-C), nausea, pain, stool or urine changes, ulcerative colitis, vomiting, weight gain from retaining fluid, and/or weakness.
- GI complications include abdominal pain, appetite loss, autoimmune effects, constipation, cramping, dehydration, diarrhea, eating problems, fatigue, flatulence, fluid in the abdomen or ascites, gastrointestinal (GI) dysbiosis, GI mucositis, inflammatory bowel disease,
- the present chimeric agents are used to treat one or more infections.
- the present chimeric proteins are used in methods of treating viral infections (including, for example, HIV and HCV).
- the infections induce immunosuppression.
- HIV infections often result in immunosuppression in the infected subjects.
- the treatment of such infections may involve, in embodiments, modulating the immune system with the present chimeric proteins to favor immune stimulation over blocking or preventing immune inhibition.
- the present invention provides methods of treating viral infections including, without limitation, acute or chronic viral infections, for example, of the respiratory tract, of papilloma virus infections, of herpes simplex virus (HSV) infection, of human immunodeficiency virus (HIV) infection, and of viral infection of internal organs such as infection with hepatitis viruses.
- the viral infection is caused by a member of Flaviviridae.
- the member of Flaviviridae is selected from Yellow Fever Virus, West Nile virus, Dengue virus, Japanese Encephalitis Virus, St. Louis Encephalitis Virus, and Hepatitis C Virus.
- the viral infection is caused by a member of Picornaviridae, e.g., poliovirus, rhinovirus, coxsackievirus.
- the viral infection is caused by a member of Orthomyxoviridae, e.g., an influenza virus.
- the viral infection is caused by a member of Retroviridae, e.g., a lentivirus.
- the viral infection is caused by a member of Paramyxoviridae, e.g., respiratory syncytial virus, a human parainfluenza virus, rubulavirus (e.g., mumps virus), measles virus, and human metapneumovirus.
- the viral infection is caused by a member of Bunyaviridae, e.g., hantavirus. In embodiments, the viral infection is caused by a member of Reoviridae, e.g., a rotavirus.
- the invention provides for chimeric proteins and methods that further comprise administering an additional agent to a subject.
- the invention pertains to co-administration and/or co-formulation. Any of the compositions disclosed herein may be co-formulated and/or co-administered.
- any chimeric protein disclosed herein acts synergistically when co-administered with another agent and is administered at doses that are lower than the doses commonly employed when such agents are used as monotherapy.
- any agent referenced herein may be used in combination with any of the chimeric proteins disclosed herein.
- An aspect of the present invention provides a method for treating a cancer or a viral infection in a subject in need thereof comprising: providing the subject a first pharmaceutical composition comprising a therapeutically effective amount of a herein-disclosed chimeric protein; providing the subject a second pharmaceutical composition comprising an antibody that is capable of binding CTLA-4, or an antibody that is capable of binding PD-1 or a PD-1 ligand and capable of inhibiting the interaction of PD-1 with one or more of its ligands.
- Another aspect of the present invention provides a method for treating a cancer or a viral infection in a subject comprising: providing the subject a pharmaceutical composition comprising a herein-disclosed chimeric protein.
- the subject has undergone or is undergoing treatment with an antibody that is capable of binding CTLA-4, or an antibody that is capable of binding PD-1 or a PD-1 ligand and capable of inhibiting the interaction of PD-1 with one or more of its ligands.
- Yet another aspect of the present invention provides a method for treating a cancer in a subject comprising: providing the subject a pharmaceutical composition comprising an antibody that is capable of binding CTLA-4, or an antibody that is capable of binding PD-1 or a PD-1 ligand and capable of inhibiting the interaction of PD-1 with one or more of its ligands.
- the subject has undergone or is undergoing treatment with a herein-disclosed chimeric protein.
- the first pharmaceutical composition and the second pharmaceutical composition are provided simultaneously.
- the first pharmaceutical composition is provided after the second pharmaceutical composition is provided.
- the first pharmaceutical composition is provided before the second pharmaceutical composition is provided.
- the dose of the first pharmaceutical composition is less than the dose of the first pharmaceutical composition provided to a subject who has not undergone or is not undergoing treatment with the second pharmaceutical composition.
- the dose of the second pharmaceutical composition provided is less than the dose of the second pharmaceutical composition provided to a subject who has not undergone or is not undergoing treatment with the first pharmaceutical composition.
- the dose of the pharmaceutical composition provided to the subject is less than the dose of the pharmaceutical composition that is provided to a subject who has not undergone or is not undergoing treatment with an antibody that is capable of binding PD-1 or a PD-1 ligand, or who has not undergone or is not undergoing treatment with an antibody that is capable of binding CTLA-4.
- the subject has an increased chance of survival, a gain in weight, a reduction in tumor size or cancer prevalence, and/or a decrease in viral load/virally-infected cells when compared to a subject who has only undergone or is only undergoing treatment with the first pharmaceutical composition.
- the subject has an increased chance of survival, a gain in weight, a reduction in tumor size or cancer prevalence, and/or a decrease in viral load/virally-infected cells when compared to a subject who has only undergone or is only undergoing treatment with the second pharmaceutical composition.
- the subject has an increased chance of survival, a gain in weight, a reduction in tumor size or cancer prevalence, and/or a decrease in viral load/virally-infected cells when compared to the subject who has not undergone or is not undergoing treatment with an antibody that is capable of binding PD-1 or binding a PD-1 ligand, or the antibody that is capable of binding CTLA-4.
- the subject has a cancer or viral infection that is poorly responsive or is refractory to treatment comprising the antibody that is capable of binding PD-1 or binding a PD-1 ligand, or the antibody that is capable of binding CTLA-4.
- the linker is a polypeptide selected from a flexible amino acid sequence, an IgG hinge region, and an antibody sequence.
- the linker comprises at least one cysteine residue capable of forming a disulfide bond and/or comprises a hinge-CH2-CH3 Fc domain.
- the linker and/or the region linker comprises a hinge-CH2-CH3 Fc domain derived from IgG4, e.g., human IgG4.
- the linker comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, or SEQ ID NO: 3.
- the heterologous chimeric protein is “CD80-Fc-NKG2A”, “CD86-Fc-NKG2A”, “CD58-Fc-NKG2A”, “PD-1-Fc-NKG2A”, “SLAMF6-Fc-NKG2A”, “SIRP ⁇ -Fc-N KG2A, “TGFBR2-Fc-NKG2A”, or “CD48-Fc-NKG2A”, as disclosed herein.
- the antibody that is capable of binding PD-1 or a PD-1 ligand is selected from the group consisting of nivolumab (ONO 4538, BMS 936558, MDX1106, OPDIVO (Bristol Myers Squibb)), pembrolizumab (KEYTRUDA/MK 3475, Merck), pidilizumab (CT 011, Cure Tech), RMP1-14, AGEN2034 (Agenus), and cemiplimab ((REGN-2810).
- nivolumab ONO 4538, BMS 936558, MDX1106, OPDIVO (Bristol Myers Squibb)
- pembrolizumab KEYTRUDA/MK 3475, Merck
- pidilizumab CT 011, Cure Tech
- RMP1-14 AGEN2034
- AGEN2034 Agenus
- cemiplimab (REGN-2810).
- Such an antibody is capable of inhibiting the
- the antibody that is capable of binding CTLA-4 is selected from the group consisting of YERVOY (ipilimumab), 9D9, tremelimumab (formerly ticilimumab, CP-675,206; MedImmune), AGEN1884, and RG2077.
- the subject has a cancer or viral infection that is poorly responsive or is refractory to treatment comprising an antibody that is capable of binding PD-1 or binding a PD-1 ligand, or an antibody that is capable of binding CTLA-4.
- the cancer or viral infection is poorly responsive or is non-responsive to treatment with an antibody that is capable of binding PD-1 or binding a PD-1 ligand, or an antibody that is capable of binding CTLA-4 after 12 weeks or so of such treatment.
- the present additional agent is one or more immune-modulating agents selected from an agent that blocks, reduces and/or inhibits PD-1 and PD-L1 or PD-L2 and/or the binding of PD-1 with PD-L1 or PD-L2 (by way of non-limiting example, one or more of nivolumab (ONO-4538/BMS-936558, MDX1106, OPDIVO, BRISTOL MYERS SQUIBB), pembrolizumab (KEYTRUDA, Merck), pidilizumab (CT-011, CURE TECH), MK-3475 (MERCK), BMS 936559 (BRISTOL MYERS SQUIBB), atezolizumab (TECENTRIQ, GENENTECH), MPDL3280A (ROCHE)), an agent that increases and/or stimulates CD137 (4-1BB) and/or the binding of CD137 (4-1BB) with one or more of 4-1BB ligand (by way of
- the antibody is capable of mediating antibody dependent cellular cytotoxicity (ADCC).
- ADCC antibody dependent cellular cytotoxicity
- the antibody is selected from the group consisting of cetuximab (Eli Lilly and Co), daratumumab (Genmab), gatipotuzumab (Glycotope), margetuximab (Raven biotechnologies), mogamulizumab (Kyowa Kirin International PLC), MEDI-551 or inebilizumab (MedImmune), MOR208 or tafasitamab (MorphoSys AG), ocaratuzumab (Creative BioLabs), GAZYVA® or obinutuzumab (Roche), RO5083945 or GA201 (Creative BioLabs), rituximab (Genentech), trastuzumab (Roche),TrasGEX (Glycotope), tomuzotuximab (Glycotop)
- the antibody is capable of binding to a tumor antigen.
- the antibody is selected from the group consisting of cetuximab (Eli Lilly and Co), daratumumab (Genmab), gatipotuzumab (Glycotope), margetuximab (Raven biotechnologies), mogamulizumab (Kyowa Kirin International PLC), MEDI-551 or inebilizumab (MedImmune), MOR208 or tafasitamab (MorphoSys AG), ocaratuzumab (Creative BioLabs), GAZYVA® or obinutuzumab (Roche), RO5083945 or GA201 (Creative BioLabs), rituximab (Genentech), trastuzumab (Roche),TrasGEX (Glycotope), tomuzotuximab (Glycotope), and
- the subject has a cancer or viral infection that is poorly responsive or is refractory to treatment comprising an antibody that is capable of binding capable of binding to a tumor antigen and/or antibody is capable of mediating antibody dependent cellular cytotoxicity (ADCC).
- ADCC antibody dependent cellular cytotoxicity
- the cancer or viral infection is poorly responsive or is non-responsive to treatment with an antibody that is capable of binding capable of binding to a tumor antigen and/or antibody is capable of mediating antibody dependent cellular cytotoxicity (ADCC) after 12 weeks or so of such treatment.
- ADCC antibody dependent cellular cytotoxicity
- the chimeric proteins (and/or additional agents) disclosed herein include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the composition such that covalent attachment does not prevent the activity of the composition.
- derivatives include composition that have been modified by, inter alia, glycosylation, lipidation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc.
- the derivative can contain one or more non-classical amino acids.
- the chimeric proteins (and/or additional agents) disclosed herein further comprise a cytotoxic agent, comprising, in illustrative embodiments, a toxin, a chemotherapeutic agent, a radioisotope, and an agent that causes apoptosis or cell death. Such agents may be conjugated to a composition disclosed herein.
- chimeric proteins (and/or additional agents) disclosed herein may thus be modified post-translationally to add effector moieties such as chemical linkers, detectable moieties such as for example fluorescent dyes, enzymes, substrates, bioluminescent materials, radioactive materials, and chemiluminescent moieties, or functional moieties such as for example streptavidin, avidin, biotin, a cytotoxin, a cytotoxic agent, and radioactive materials.
- effector moieties such as chemical linkers, detectable moieties such as for example fluorescent dyes, enzymes, substrates, bioluminescent materials, radioactive materials, and chemiluminescent moieties, or functional moieties such as for example streptavidin, avidin, biotin, a cytotoxin, a cytotoxic agent, and radioactive materials.
- aspects of the present invention include a pharmaceutical composition comprising a therapeutically effective amount of a chimeric protein as disclosed herein.
- the chimeric proteins (and/or additional agents) disclosed herein can possess a sufficiently basic functional group, which can react with an inorganic or organic acid, or a carboxyl group, which can react with an inorganic or organic base, to form a pharmaceutically acceptable salt.
- a pharmaceutically acceptable acid addition salt is formed from a pharmaceutically acceptable acid, as is well known in the art.
- Such salts include the pharmaceutically acceptable salts listed in, for example, Journal of Pharmaceutical Science, 66, 2-19 (1977) and The Handbook of Pharmaceutical Salts; Properties, Selection, and Use . P. H. Stahl and C. G. Wermuth (eds.), Verlag, Zurich (Switzerland) 2002, which are hereby incorporated by reference in their entirety.
- compositions disclosed herein are in the form of a pharmaceutically acceptable salt.
- any chimeric protein (and/or additional agents) disclosed herein can be administered to a subject as a component of a composition, e.g., pharmaceutical composition, that comprises a pharmaceutically acceptable carrier or vehicle.
- a pharmaceutical composition e.g., pharmaceutical composition
- Such pharmaceutical compositions can optionally comprise a suitable amount of a pharmaceutically acceptable excipient so as to provide the form for proper administration.
- Pharmaceutical excipients can be liquids, such as water and oils, including those of petroleum, animal, vegetable, or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- the pharmaceutical excipients can be, for example, saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea and the like.
- the pharmaceutically acceptable excipients are sterile when administered to a subject.
- Water is a useful excipient when any agent disclosed herein is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid excipients, specifically for injectable solutions.
- Suitable pharmaceutical excipients also include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Any agent disclosed herein, if desired, can also comprise minor amounts of wetting or emulsifying agents, or pH buffering agents.
- compositions e.g., pharmaceutical compositions, disclosed herein are resuspended in a saline buffer (including, without limitation TBS, PBS, and the like).
- a saline buffer including, without limitation TBS, PBS, and the like.
- the chimeric proteins may by conjugated and/or fused with another agent to extend half-life or otherwise improve pharmacodynamic and pharmacokinetic properties.
- the chimeric proteins may be fused or conjugated with one or more of PEG, XTEN (e.g., as rPEG), polysialic acid (POLYXEN), albumin (e.g., human serum albumin or HAS), elastin-like protein (ELP), PAS, HAP, GLK, CTP, transferrin, and the like.
- each of the individual chimeric proteins is fused to one or more of the agents described in BioDrugs (2015) 29:215-239, the entire contents of which are hereby incorporated by reference.
- the present invention includes the disclosed chimeric protein (and/or additional agents) in various formulations of pharmaceutical composition.
- Any chimeric protein (and/or additional agents) disclosed herein can take the form of solutions, suspensions, emulsion, drops, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained-release formulations, suppositories, emulsions, aerosols, sprays, suspensions, or any other form suitable for use.
- DNA or RNA constructs encoding the protein sequences may also be used.
- the composition is in the form of a capsule (see, e.g., U.S. Pat. No. 5,698,155).
- suitable pharmaceutical excipients are described in Remington's Pharmaceutical Sciences 1447-1676 (Alfonso R. Gennaro eds., 19th ed. 1995), incorporated herein by reference.
- compositions comprising the chimeric protein (and/or additional agents) can also include a solubilizing agent.
- the agents can be delivered with a suitable vehicle or delivery device as known in the art.
- Combination therapies outlined herein can be co-delivered in a single delivery vehicle or delivery device.
- Compositions for administration can optionally include a local anesthetic such as, for example, lignocaine to lessen pain at the site of the injection.
- compositions comprising the chimeric protein (and/or additional agents) of the present invention may conveniently be presented in unit dosage forms and may be prepared by any of the methods well known in the art of pharmacy. Such methods generally include the step of bringing therapeutic agents into association with a carrier, which constitutes one or more accessory ingredients. Typically, the pharmaceutical compositions are prepared by uniformly and intimately bringing therapeutic agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into dosage forms of the desired formulation (e.g., wet or dry granulation, powder blends, etc., followed by tableting using conventional methods known in the art).
- a carrier which constitutes one or more accessory ingredients.
- the pharmaceutical compositions are prepared by uniformly and intimately bringing therapeutic agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product into dosage forms of the desired formulation (e.g., wet or dry granulation, powder blends, etc., followed by tableting using
- any chimeric protein (and/or additional agents) disclosed herein is formulated in accordance with routine procedures as a pharmaceutical composition adapted for a mode of administration disclosed herein.
- administration results in the release of chimeric protein (and/or additional agents) disclosed herein into the bloodstream (via enteral or parenteral administration), or alternatively, the chimeric protein (and/or additional agents) is administered directly to the site of active disease.
- Dosage forms suitable for parenteral administration include, for example, solutions, suspensions, dispersions, emulsions, and the like. They may also be manufactured in the form of sterile solid compositions (e.g., lyophilized composition), which can be dissolved or suspended in sterile injectable medium immediately before use. They may contain, for example, suspending or dispersing agents known in the art.
- any chimeric protein (and/or additional agents) disclosed herein as well as the dosing schedule can depend on various parameters, including, but not limited to, the disease being treated, the subject's general health, and the administering physician's discretion.
- any chimeric protein (and/or additional agents) disclosed herein can depend on several factors including the severity of the condition, whether the condition is to be treated or prevented, and the age, weight, and health of the subject to be treated. Additionally, pharmacogenomic (the effect of genotype on the pharmacokinetic, pharmacodynamic or efficacy profile of a therapeutic) information about a particular subject may affect dosage used. Furthermore, the exact individual dosages can be adjusted somewhat depending on a variety of factors, including the specific combination of the agents being administered, the time of administration, the route of administration, the nature of the formulation, the rate of excretion, the particular disease being treated, the severity of the disorder, and the anatomical location of the disorder. Some variations in the dosage can be expected.
- delivery can be in a vesicle, in particular a liposome (see Langer, 1990, Science 249:1527-1533; Treat et al., in Liposomes in Therapy of Infectious Disease and Cancer , Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989).
- a liposome see Langer, 1990, Science 249:1527-1533; Treat et al., in Liposomes in Therapy of Infectious Disease and Cancer , Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989).
- a chimeric protein (and/or additional agents) disclosed herein can be administered by controlled-release or sustained-release means or by delivery devices that are well known to those of ordinary skill in the art. Examples include, but are not limited to, those described in U.S. Pat. Nos. 3,845,770; 3,916,899; 3,536,809; 3,598,123; 4,008,719; 5,674,533; 5,059,595; 5,591,767; 5,120,548; 5,073,543; 5,639,476; 5,354,556; and 5,733,556, each of which is incorporated herein by reference in its entirety.
- Such dosage forms can be useful for providing controlled- or sustained-release of one or more active ingredients using, for example, hydropropylmethyl cellulose, other polymer matrices, gels, permeable membranes, osmotic systems, multilayer coatings, microparticles, liposomes, microspheres, or a combination thereof to provide the desired release profile in varying proportions.
- Controlled- or sustained-release of an active ingredient can be stimulated by various conditions, including but not limited to, changes in pH, changes in temperature, stimulation by an appropriate wavelength of light, concentration or availability of enzymes, concentration or availability of water, or other physiological conditions or compounds.
- polymeric materials can be used (see Medical Applications of Controlled Release , Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance , Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, 1983 , J. Macromol. Sci. Rev. Macromol. Chem. 23:61; see also Levy et al., 1985 , Science 228:190; During et al., 1989 , Ann. Neurol. 25:351; Howard et al., 1989 , J. Neurosurg. 71:105).
- a controlled-release system can be placed in proximity of the target area to be treated, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release , supra, vol. 2, pp. 115-138 (1984)).
- Other controlled-release systems discussed in the review by Langer, 1990 , Science 249:1527-1533) may be used.
- any chimeric protein (and/or additional agents) disclosed herein can be selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the subject; the severity of the condition to be treated; the route of administration; the renal or hepatic function of the subject; the pharmacogenomic makeup of the individual; and the specific compound of the invention employed.
- Any chimeric protein (and/or additional agents) disclosed herein can be administered in a single daily dose, or the total daily dosage can be administered in divided doses of two, three or four times daily.
- any chimeric protein (and/or additional agents) disclosed herein can be administered continuously rather than intermittently throughout the dosage regimen.
- aspects of the present invention provide an expression vector comprising a nucleic acid which encodes a chimeric protein as disclosed herein.
- the expression vector comprises a nucleic acid encoding the chimeric protein disclosed herein.
- the expression vector comprises DNA or RNA.
- the expression vector is a mammalian expression vector.
- Constructs could be produced by cloning of the nucleic acids encoding the three fragments (the extracellular domain of a Type I transmembrane protein or a portion of a membrane-bound extracellular protein, followed by a linker sequence, followed by the extracellular domain of a Type II transmembrane protein, e.g., NKG2A) into a vector (plasmid, viral or other) wherein the amino terminus of the complete sequence corresponded to the ‘left’ side of the molecule containing the Type I transmembrane protein or the portion of a membrane-bound extracellular protein and the carboxy terminus of the complete sequence corresponded to the ‘right’ side of the molecule containing the extracellular domain of a Type II transmembrane protein, e.g., NKG2A.
- a vector plasmid, viral or other
- a construct would comprise three nucleic acids such that the translated chimeric protein produced would have the desired configuration, e.g., a dual inward-facing chimeric protein. Accordingly, in embodiments, the present chimeric proteins are engineered as such.
- Prokaryotic vectors include constructs based on E. coli sequences (see, e.g., Makrides, Microbiol Rev 1996, 60:512-538).
- Non-limiting examples of regulatory regions that can be used for expression in E. coli include lac, trp, Ipp, phoA, recA, tac, T3, T7 and AP L .
- Non-limiting examples of prokaryotic expression vectors may include the ⁇ gt vector series such as ⁇ gt11 (Huynh et al., in “DNA Cloning Techniques, Vol. I: A Practical Approach,” 1984, (D. Glover, ed.), pp.
- Prokaryotic host-vector systems cannot perform much of the post-translational processing of mammalian cells, however. Thus, eukaryotic host-vector systems may be particularly useful.
- a variety of regulatory regions can be used for expression of the chimeric proteins in mammalian host cells. For example, the SV40 early and late promoters, the cytomegalovirus (CMV) immediate early promoter, and the Rous sarcoma virus long terminal repeat (RSV-LTR) promoter can be used.
- CMV cytomegalovirus
- RSV-LTR Rous sarcoma virus long terminal repeat
- Inducible promoters that may be useful in mammalian cells include, without limitation, promoters associated with the metallothionein II gene, mouse mammary tumor virus glucocorticoid responsive long terminal repeats (MMTV-LTR), the ⁇ -interferon gene, and the hsp70 gene (see, Williams et al., Cancer Res 1989, 49:2735-42; and Taylor et al., Mol Cell Biol 1990, 10:165-75). Heat shock promoters or stress promoters also may be advantageous for driving expression of the chimeric proteins in recombinant host cells.
- expression vectors of the invention comprise a nucleic acid encoding the chimeric proteins, or a complement thereof, operably linked to an expression control region, or complement thereof, that is functional in a mammalian cell.
- the expression control region is capable of driving expression of the operably linked blocking and/or stimulating agent encoding nucleic acid such that the blocking and/or stimulating agent is produced in a human cell transformed with the expression vector.
- Expression control regions are regulatory polynucleotides (sometimes referred to herein as elements), such as promoters and enhancers, that influence expression of an operably linked nucleic acid.
- An expression control region of an expression vector of the invention is capable of expressing operably linked encoding nucleic acid in a human cell.
- the cell is a tumor cell.
- the cell is a non-tumor cell.
- the expression control region confers regulatable expression to an operably linked nucleic acid.
- a signal (sometimes referred to as a stimulus) can increase or decrease expression of a nucleic acid operably linked to such an expression control region.
- Such expression control regions that increase expression in response to a signal are often referred to as inducible.
- Such expression control regions that decrease expression in response to a signal are often referred to as repressible.
- the amount of increase or decrease conferred by such elements is proportional to the amount of signal present; the greater the amount of signal, the greater the increase or decrease in expression.
- the present invention contemplates the use of inducible promoters capable of effecting high level of expression transiently in response to a cue.
- inducible promoters capable of effecting high level of expression transiently in response to a cue.
- a cell transformed with an expression vector for the chimeric protein (and/or additional agents) comprising such an expression control sequence is induced to transiently produce a high level of the agent by exposing the transformed cell to an appropriate cue.
- Illustrative inducible expression control regions include those comprising an inducible promoter that is stimulated with a cue such as a small molecule chemical compound. Particular examples can be found, for example, in U.S. Pat. Nos. 5,989,910, 5,935,934, 6,015,709, and 6,004,941, each of which is incorporated herein by reference in its entirety.
- Expression control regions and locus control regions include full-length promoter sequences, such as native promoter and enhancer elements, as well as subsequences or polynucleotide variants which retain all or part of full-length or non-variant function.
- the term “functional” and grammatical variants thereof, when used in reference to a nucleic acid sequence, subsequence or fragment, means that the sequence has one or more functions of native nucleic acid sequence (e.g., non-variant or unmodified sequence).
- operable linkage refers to a physical juxtaposition of the components so described as to permit them to function in their intended manner.
- the relationship is such that the control element modulates expression of the nucleic acid.
- an expression control region that modulates transcription is juxtaposed near the 5′ end of the transcribed nucleic acid (i.e., “upstream”).
- Expression control regions can also be located at the 3′ end of the transcribed sequence (i.e., “downstream”) or within the transcript (e.g., in an intron).
- Expression control elements can be located at a distance away from the transcribed sequence (e.g., 100 to 500, 500 to 1000, 2000 to 5000, or more nucleotides from the nucleic acid).
- a specific example of an expression control element is a promoter, which is usually located 5′ of the transcribed sequence.
- Another example of an expression control element is an enhancer, which can be located 5′ or 3′ of the transcribed sequence, or within the transcribed sequence.
- a promoter functional in a human cell is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3′) transcription of a coding sequence into mRNA.
- a promoter will have a transcription initiating region, which is usually placed proximal to the 5′ end of the coding sequence, and typically a TATA box located 25-30 base pairs upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site.
- a promoter will also typically contain an upstream promoter element (enhancer element), typically located within 100 to 200 base pairs upstream of the TATA box.
- An upstream promoter element determines the rate at which transcription is initiated and can act in either orientation.
- promoters are the promoters from mammalian viral genes, since the viral genes are often highly expressed and have a broad host range. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter, herpes simplex virus promoter, and the CMV promoter.
- transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3′ to the translation stop codon and thus, together with the promoter elements, flank the coding sequence.
- the 3′ terminus of the mature mRNA is formed by site-specific post-translational cleavage and polyadenylation.
- transcription terminator and polyadenylation signals include those derived from SV40. Introns may also be included in expression constructs.
- nucleic acids there are varieties of techniques available for introducing nucleic acids into viable cells.
- Techniques suitable for the transfer of nucleic acid into mammalian cells in vitro include the use of liposomes, electroporation, microinjection, cell fusion, polymer-based systems, DEAE-dextran, viral transduction, the calcium phosphate precipitation method, etc.
- liposomes For in vivo gene transfer, a number of techniques and reagents may also be used, including liposomes; natural polymer-based delivery vehicles, such as chitosan and gelatin; viral vectors are also suitable for in vivo transduction.
- a targeting agent such as an antibody or ligand specific for a tumor cell surface membrane protein.
- proteins which bind to a cell surface membrane protein associated with endocytosis may be used for targeting and/or to facilitate uptake, e.g., capsid proteins or fragments thereof tropic for a particular cell type, antibodies for proteins which undergo internalization in cycling, proteins that target intracellular localization and enhance intracellular half-life.
- the technique of receptor-mediated endocytosis is described, for example, by Wu et al., J. Biol. Chem. 262, 4429-4432 (1987); and Wagner et al., Proc. Natl. Acad. Sci. USA 87, 3410-3414 (1990).
- gene delivery agents such as, e.g., integration sequences can also be employed.
- Numerous integration sequences are known in the art (see, e.g., Nunes-Duby et al., Nucleic Acids Res. 26:391-406, 1998; Sadwoski, J. Bacteriol., 165:341-357, 1986; Bestor, Cell, 122(3):322-325, 2005; Plasterk et al., TIG 15:326-332, 1999; Kootstra et al., Ann. Rev. Pharm. Toxicol., 43:413-439, 2003). These include recombinases and transposases. Examples include Cre (Sternberg and Hamilton, J. Mol.
- transposases of the mariner family (Plasterk et al., supra), and components for integrating viruses such as AAV, retroviruses, and antiviruses having components that provide for virus integration such as the LTR sequences of retroviruses or lentivirus and the ITR sequences of AAV (Kootstra et al., Ann. Rev. Pharm. Toxicol., 43:413-439, 2003).
- direct and targeted genetic integration strategies may be used to insert nucleic acid sequences encoding the chimeric fusion proteins including CRISPR/CAS9, zinc finger, TALEN, and meganuclease gene-editing technologies.
- the expression vectors for the expression of the chimeric proteins (and/or additional agents) are viral vectors.
- Many viral vectors useful for gene therapy are known (see, e.g., Lundstrom, Trends Biotechnol., 21: 1 17, 122, 2003.
- Illustrative viral vectors include those selected from Antiviruses (LV), retroviruses (RV), adenoviruses (AV), adeno-associated viruses (AAV), and a viruses, though other viral vectors may also be used.
- viral vectors that do not integrate into the host genome are suitable for use, such as a viruses and adenoviruses.
- viruses include Sindbis virus, Venezuelan equine encephalitis (VEE) virus, and Semliki Forest virus (SFV).
- VEE Venezuelan equine encephalitis
- SFV Semliki Forest virus
- viral vectors that integrate into the host genome are suitable, such as retroviruses, AAV, and Antiviruses.
- the invention provides methods of transducing a human cell in vivo, comprising contacting a solid tumor in vivo with a viral vector of the invention.
- aspects of the present invention include a host cell comprising the expression vector which comprises the chimeric protein disclosed herein.
- Expression vectors can be introduced into host cells for producing the present chimeric proteins.
- Cells may be cultured in vitro or genetically engineered, for example.
- Useful mammalian host cells include, without limitation, cells derived from humans, monkeys, and rodents (see, for example, Kriegler in “Gene Transfer and Expression: A Laboratory Manual,” 1990, New York, Freeman & Co.).
- monkey kidney cell lines transformed by SV40 e.g., COS-7, ATCC CRL 1651
- human embryonic kidney lines e.g., 293, 293-EBNA, or 293 cells subcloned for growth in suspension culture, Graham et al., J Gen Virol 1977, 36:59
- baby hamster kidney cells e.g., BHK, ATCC CCL 10
- Chinese hamster ovary-cells-DH FR e.g., CHO, Urlaub and Chasin, Proc Natl Acad Sci USA 1980, 77:4216
- DG44 CHO cells CHO-K1 cells, mouse sertoli cells (Mather, Biol Reprod 1980, 23:243-251)
- mouse fibroblast cells e.g., NIH-3T3
- monkey kidney cells e.g., CV1 ATCC CCL 70
- African green monkey kidney cells e.g., African green monkey kidney cells.
- human cervical carcinoma cells e.g., HELA, ATCC CCL 2
- canine kidney cells e.g., MDCK, ATCC CCL 34
- buffalo rat liver cells e.g., BRL 3A, ATCC CRL 1442
- human lung cells e.g., W138, ATCC CCL 75
- human liver cells e.g., Hep G2, HB 8065
- mouse mammary tumor cells e.g., MMT 060562, ATCC CCL51.
- Illustrative cancer cell types for expressing the chimeric proteins disclosed herein include mouse fibroblast cell line, NIH3T3, mouse Lewis lung carcinoma cell line, LLC, mouse mastocytoma cell line, P815, mouse lymphoma cell line, EL4 and its ovalbumin transfectant, E.G7, mouse melanoma cell line, B16F10, mouse fibrosarcoma cell line, MC57, and human small cell lung carcinoma cell lines, SCLC #2 and SCLC #7.
- Host cells can be obtained from normal or affected subjects, including healthy humans, cancer patients, and patients with an infectious disease, private laboratory deposits, public culture collections such as the American Type Culture Collection (ATCC), or from commercial suppliers.
- ATCC American Type Culture Collection
- Cells that can be used for production of the present chimeric proteins in vitro, ex vivo, and/or in vivo include, without limitation, epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as T lymphocytes, B lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryocytes, granulocytes; various stem or progenitor cells, in particular hematopoietic stem or progenitor cells (e.g., as obtained from bone marrow), umbilical cord blood, peripheral blood, and fetal liver.
- epithelial cells include, without limitation, epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as T lymphocytes, B lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megak
- Fc-containing macromolecules such as monoclonal antibodies
- Fc-containing macromolecules are produced by human embryonic kidney (HEK) cells (or variants thereof) or Chinese Hamster Ovary (CHO) cells (or variants thereof) or in some cases by bacterial or synthetic methods.
- HEK human embryonic kidney
- CHO Chinese Hamster Ovary
- the Fc containing macromolecules that are secreted by HEK or CHO cells are purified through binding to Protein A columns and subsequently ‘polished’ using various methods.
- purified Fc containing macromolecules are stored in liquid form for some period of time, frozen for extended periods of time or in some cases lyophilized.
- production of the chimeric proteins contemplated herein may have unique characteristics as compared to traditional Fc containing macromolecules.
- the chimeric proteins may be purified using specific chromatography resins, or using chromatography methods that do not depend upon Protein A capture.
- the chimeric proteins may be purified in an oligomeric state, or in multiple oligomeric states, and enriched for a specific oligomeric state using specific methods. Without being bound by theory, these methods could include treatment with specific buffers including specified salt concentrations, pH and additive compositions. In other examples, such methods could include treatments that favor one oligomeric state over another.
- the chimeric proteins obtained herein may be additionally ‘polished’ using methods that are specified in the art.
- the chimeric proteins are highly stable and able to tolerate a wide range of pH exposure (between pH 3-12), are able to tolerate a large number of freeze/thaw stresses (greater than 3 freeze/thaw cycles) and are able to tolerate extended incubation at high temperatures (longer than 2 weeks at 40 degrees C.). In embodiments, the chimeric proteins are shown to remain intact, without evidence of degradation, deamidation, etc. under such stress conditions.
- the subject and/or animal is a mammal, e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, rabbit, sheep, or non-human primate, such as a monkey, chimpanzee, or baboon.
- the subject and/or animal is a non-mammal, such, for example, a zebrafish.
- the subject and/or animal may comprise fluorescently-tagged cells (with e.g., GFP).
- the subject and/or animal is a transgenic animal comprising a fluorescent cell.
- the subject and/or animal is a human.
- the human is a pediatric human.
- the human is an adult human.
- the human is a geriatric human.
- the human may be referred to as a patient.
- the human has an age in a range of from about 0 months to about 6 months old, from about 6 to about 12 months old, from about 6 to about 18 months old, from about 18 to about 36 months old, from about 1 to about 5 years old, from about 5 to about 10 years old, from about 10 to about 15 years old, from about 15 to about 20 years old, from about 20 to about 25 years old, from about 25 to about 30 years old, from about 30 to about 35 years old, from about 35 to about 40 years old, from about 40 to about 45 years old, from about 45 to about 50 years old, from about 50 to about 55 years old, from about 55 to about 60 years old, from about 60 to about 65 years old, from about 65 to about 70 years old, from about 70 to about 75 years old, from about 75 to about 80 years old, from about 80 to about 85 years old, from about 85 to about 90 years old, from about 90 to about 95 years old or from about 95 to about 100 years old.
- the subject is a non-human animal, and therefore the invention pertains to veterinary use.
- the non-human animal is a household pet.
- the non-human animal is a livestock animal.
- kits that can simplify the administration of any agent disclosed herein.
- kits of the invention comprises any chimeric protein and/or pharmaceutical composition disclosed herein in unit dosage form.
- the unit dosage form is a container, such as a pre-filled syringe, which can be sterile, containing any agent disclosed herein and a pharmaceutically acceptable carrier, diluent, excipient, or vehicle.
- the kit can further comprise a label or printed instructions instructing the use of any agent disclosed herein.
- the kit may also include a lid speculum, topical anesthetic, and a cleaning agent for the administration location.
- the kit can also further comprise one or more additional agents disclosed herein.
- the kit comprises a container containing an effective amount of a composition of the invention and an effective amount of another composition, such those disclosed herein.
- aspects of the present invention include use of a chimeric protein as disclosed herein in the manufacture of a medicament, e.g., a medicament for treatment of cancer and/or treatment of a viral infection.
- Another aspect of the present invention is the use of a herein-disclosed chimeric protein, in the manufacture of a medicament.
- the examples herein are provided to illustrate advantages and benefits of the present technology and to further assist a person of ordinary skill in the art with preparing or using the chimeric proteins of the present technology.
- the examples herein are also presented in order to more fully illustrate the preferred aspects of the present technology.
- the examples should in no way be construed as limiting the scope of the present disclosure, as defined by the appended claims.
- the examples can include or incorporate any of the variations, aspects or embodiments of the present technology described above.
- the variations, aspects or embodiments described above may also further each include or incorporate the variations of any or all other variations, aspects or embodiments of the present technology.
- a construct encoding a murine CD86- and NKG2A-based chimeric protein was generated.
- the “mCD86-Fc-NKG2A” construct included an extracellular domain (ECD) of murine CD86 fused to an ECD of murine NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 2A .
- the construct was codon optimized for expression in Chinese Hamster Ovary (CHO) cells, transfected into CHO cells and individual clones were selected for high expression. High expressing clones were then used for small-scale manufacturing in stirred bioreactors in serum-free media and the relevant chimeric fusion proteins were purified with Protein A binding resin columns.
- CHO Chinese Hamster Ovary
- the mCD86-Fc-NKG2A construct was transiently expressed in 293 cells and purified using protein-A affinity chromatography.
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e.
- the gels were run in triplicates and probed using an anti-CD86 antibody ( FIG. 2B , left blot), an anti-Fc antibody ( FIG. 2B , center blot), or an anti-NKG2A antibody ( FIG. 2B , right blot).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 2B , left blot), an anti-Fc antibody ( FIG. 2B , center blot), or an anti-NKG2A antibody ( FIG. 2B , right blot).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG.
- Functional ELISA enzyme-linked immunosorbent assay
- FIG. 3A binding of the Fc portion of the mCD86-Fc-NKG2A chimeric protein obtained from two distinct syntheses (Batch 1 and Batch 2) were characterized by capturing the chimeric protein to a plate-bound mouse IgG Fc gamma antibody and detecting via an HRP conjugated anti-mouse Fc antibody. A mouse whole IgG was used to generate a standard curve.
- binding of the NKG2A domain of the mCD86-Fc-NKG2A chimeric proteins were characterized by capturing to a plate-bound HLA class I histocompatibility antigen, alpha chain E (HLA-E) and detecting via an HRP conjugated anti-mouse Fc antibody.
- HLA-E alpha chain E
- binding of the CD86 domain of the mCD86-Fc-NKG2A chimeric proteins were characterized by capturing to a plate-bound mCTLA-4 and detecting via an HRP conjugated anti-mouse Fc antibody.
- the data shown in FIG. 3C demonstrates that the CD86 domain of mCD86-Fc-NKG2A for Batch 1 effectively interacted with its binding partner in a concentration-dependent manner and with high affinity whereas the Batch 2 interacted less efficiently.
- a construct encoding a murine CD80- and NKG2A-based chimeric protein was generated.
- the “mCD80-Fc-NKG2A” construct included an extracellular domain (ECD) of murine CD80 fused to an ECD of murine NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 4A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS)
- reduced and deglycosylated samples i.e. treated both with ⁇ -mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS.
- the gels were run in triplicates and probed using an anti-CD80 antibody ( FIG. 4B , left blot), an anti-Fc antibody ( FIG. 4B , center blot), or an anti-NKG2A antibody ( FIG. 4B , right blot).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 4B , lane 2 in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 4B , lane 3 in each blot). As shown in FIG.
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent.
- Functional ELISA were performed to demonstrate the binding affinity of the different domains of the mCD80-Fc-NKG2A chimeric protein to their respective binding partners.
- binding of the Fc portion of the mCD80-Fc-NKG2A chimeric protein obtained from two distinct syntheses (Batch 1 and Batch 2) were characterized by capturing the chimeric protein to a plate-bound mouse IgG Fc gamma antibody and detecting via an HRP conjugated anti-mouse Fc antibody. A mouse whole IgG was used to generate a standard curve.
- binding of the NKG2A domain of the mCD80-Fc-NKG2A chimeric proteins were characterized by capturing to a plate-bound HLA-E and detecting via an HRP conjugated anti-mouse Fc antibody.
- the data shown in FIG. 5B demonstrates that the NKG2A domain of mCD80-Fc-NKG2A effectively interacted with its binding partner in a concentration-dependent manner.
- CD80 is the ligand for, at least, two different proteins on the T cell surface: CD28 (for autoregulation and intercellular association) and CTLA-4 (for attenuation of regulation and cellular disassociation)
- CD28 for autoregulation and intercellular association
- CTLA-4 for attenuation of regulation and cellular disassociation
- the affinity of the CD80 domain of the mCD80-Fc-NKG2A chimeric protein was characterized for each of CD28 and CTLA-4.
- FIG. 5C and FIG. 5D binding of the CD80 domain of the mCD80-Fc-NKG2A chimeric proteins (Batch 1 and Batch 2) were characterized by capturing to, respectively, a plate-bound mCD28 ( FIG. 5C ) and a plate-bound mCTLA-4 ( FIG.
- FIG. 5D demonstrates that the CD80 domain of mCD80-Fc-NKG2A effectively interacted with its binding partners (CD28 and CTLA-4) in a concentration-dependent manner and with high affinity, with the mCD80-Fc-NKG2A chimeric protein having greater affinity for CTLA-4 than for CD28.
- a construct encoding a murine CD48- and NKG2A-based chimeric protein was generated.
- the “mCD48-Fc-NKG2A” construct included an extracellular domain (ECD) of murine CD48 fused to an ECD of murine NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 6A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS)
- reduced and deglycosylated samples i.e. treated both with ⁇ -mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS.
- the gels were run in triplicates and probed using an anti-CD48 antibody ( FIG. 6B , left blot), an anti-Fc antibody ( FIG. 6B , center blot), or an anti-NKG2A antibody ( FIG. 6B , right blot).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 6B , lane 2 in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 6B , lane 3 in each blot). As shown in FIG.
- the chimeric protein ran as a monomer at the predicted molecular weight of about 66 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent.
- Functional ELISA assays were performed to demonstrate the binding affinity of the different domains of the mCD48-Fc-NKG2A chimeric protein to their respective binding partners.
- binding of the Fc portion of the mCD48-Fc-NKG2A chimeric protein obtained from two distinct syntheses (Batch 1 and Batch 2) were characterized by capturing the chimeric protein to a plate-bound mouse IgG Fc gamma antibody and detecting via an HRP conjugated anti-mouse Fc antibody. A mouse whole IgG was used to generate a standard curve.
- binding of the NKG2A domain of the mCD48-Fc-NKG2A chimeric proteins were characterized by capturing to a plate-bound HLA-E and detecting using an anti-mCD48 antibody in conjunction with an anti-goat HRP antibody.
- the data shown in FIG. 7B demonstrates that the NKG2A domain of mCD48-Fc-NKG2A effectively interacted with its binding partner in a concentration-dependent manner.
- binding of the NKG2A domain of mCD86-Fc-NKG2A (Batch 1) to HLA-E.
- CD48 had been found to have a low affinity for ligand CD2 and high affinity for ligand 2B4 (CD244), which is also a member of the CD2 subfamily SLAM of IgSF expressed on natural killer cells (NK cells) and other leukocytes. Since CD48 has, at least, two known ligands, the affinity of the CD48 domain of the mCD48-Fc-NKG2A chimeric protein was characterized for each of CD2 and 2B4. As shown in FIG. 7C and FIG. 7D , binding of the CD48 domain of the mCD48-Fc-NKG2A chimeric proteins (Batch 1 and Batch 2) were characterized by capturing to, respectively, a plate-bound mCD2 ( FIG.
- FIG. 7C a plate-bound m2B4
- FIG. 7D a plate-bound m2B4
- FIG. 7D a plate-bound m2B4
- FIG. 7D a plate-bound m2B4
- FIG. 7D a plate-bound m2B4
- FIG. 7D a plate-bound m2B4
- FIG. 7D a plate-bound m2B4
- FIG. 7D The data shown in FIG. 7C and FIG. 7D demonstrate that the CD48 domain of mCD48-Fc-NKG2A effectively interacted with its binding partners (CD2 and 2B4) in a concentration-dependent manner, with the mCD48-Fc-NKG2A chimeric protein having greater affinity for 2B4 than for CD2, as expected. There was an observed variation in binding ability between batches.
- hPD-1-Fc-hNKG2A included an extracellular domain (ECD) of human programmed cell death protein 1 (PD-1) fused to an ECD of human NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 8A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e. treated both with 3-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS).
- the gels were run in triplicates and probed using an anti-PD-1 antibody ( FIG. 8B , left blot), an anti-Fc antibody ( FIG. 8B , center blot), or an anti-NKG2A antibody ( FIG. 8B , right blot).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 8B , lane 2 in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 8B , lane 3 in each blot). As shown in FIG.
- the chimeric protein ran as a monomer at the predicted molecular weight of about 58 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent.
- Functional ELISA were performed to demonstrate the binding affinity of the different domains of the hPD-1-Fc-hNKG2A chimeric protein to their respective binding partners.
- binding of the Fc portion of the hPD-1-Fc-hNKG2A chimeric protein was characterized by capturing the chimeric protein to a plate-bound mouse IgG Fc gamma antibody and detecting via an HRP conjugated anti-mouse Fc antibody.
- a mouse whole IgG was used to generate a standard curve.
- binding of the NKG2A domain of the hPD-1-Fc-hNKG2A chimeric protein was characterized by capturing to a plate-bound PD-L1 and detecting using an anti-human HLA-E antibody in conjunction with an anti-6 ⁇ His-HRP antibody.
- the data shown in FIG. 9B demonstrates that the PD-1 domain of hPD-1-Fc-hNKG2A effectively interacted with its binding partner in a concentration-dependent manner.
- binding of the hNKG2A domain of the hPD-1-Fc-hNKG2A chimeric protein was characterized by capturing to, respectively, a plate-bound HLA-E.
- the hPD-1-Fc-hNKG2A chimeric protein was detected using an anti-human PD-1 antibody in conjunction with an HRP conjugated anti-mouse Fc antibody.
- the hPD-1-Fc-hNKG2A chimeric protein was directly detected via an HRP conjugated anti-mouse Fc antibody.
- FIG. 9D demonstrate that the hNKG2A domain of hPD-1-Fc-hNKG2A interacted with its binding partner. Also shown in FIG. 9C is an absence of detection of mCD86-Fc-NKG2A (Batch 1) binding using an anti-PD-1 antibody; since mCD86-Fc-NKG2A lacks a PD-1-containing domain, this results was expected.
- mice were inoculated with MC38 (colorectal carcinoma) tumors cells. Six days after inoculation, there was no significant difference between starting tumor volumes among the mice, i.e., volumes were approximately 60 mm 3 . Treatment then began according to the schedule shown in FIG. 11A to FIG. 11E , i.e., on day 6, day 11, day 14, and day 17.
- an anti-CTLA-4 antibody (9D9); an anti-PD-1 antibody (RMP1-14); the mCD48-Fc-NKG2A chimeric protein; the mCD48-Fc-NKG2A chimeric protein and the anti-CTLA-4 antibody; the mCD80-Fc-NKG2A chimeric protein; the mCD86-Fc-NKG2A chimeric protein; the mCD86-Fc-NKG2A chimeric protein and the anti-CTLA-4 antibody; or a vehicle.
- Antibodies were administered at the indicated time points as 100 ⁇ g intraperitoneal injection (IP) injection and the chimeric proteins were given as a 150 ⁇ g IP injection on day 6, day 11, day 14, and day 17. Tumor sizes were assayed every other day until the 20th day after inoculation.
- IP intraperitoneal injection
- the chimeric proteins had anti-tumor efficacy in MC38 cells and at relatively low doses.
- the data further suggests the possibility of a combinatorial efficacy with the anti-CTLA-4 antibody.
- the data shown in FIG. 11A consolidates the data shown in FIG. 11B to FIG. 11E .
- mice inoculated with MC38 tumor cells and combination of a chimeric protein with an anti-PD-1 antibody are assayed.
- mice are inoculated CT26 (colon carcinoma) tumor cells and the anti-cancer effects from treatments with the chimeric proteins with or without an anti-CTLA-4 antibody or an anti-PD-1 antibody are assayed.
- CT26 colon carcinoma
- the hCD86-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of human CD86 fused to an extracellular domain (ECD) of human NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 12A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e. treated both with 3-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS).
- the gels were run in triplicates and probed using an anti-CD86 antibody ( FIG. 12B , left blot), an anti-Fc antibody ( FIG. 12B , center blot), or an anti-NKG2A antibody ( FIG. 12B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the hCD86-Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 12B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 12B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 12B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 12B , lane DG in each blot).
- the hCD48-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of human CD48 fused to an extracellular domain (ECD) of human NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 13A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS)
- reduced and deglycosylated samples i.e. treated both with ⁇ -mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS.
- the gels were run in triplicates and probed using an anti-CD48 antibody ( FIG. 13B , left blot), an anti-Fc antibody ( FIG. 13B , center blot), or an anti-NKG2A antibody ( FIG. 13B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the hCD48-Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 13B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 13B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 13B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 13B , lane DG in each blot).
- the hCD58-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of human CD58 fused to an extracellular domain (ECD) of human NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 14A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with 3-mercaptoethanol, and boiled in the presence of SDS)
- reduced and deglycosylated samples i.e. treated both with p-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS.
- the gels were run in triplicates and probed using an anti-CD58 antibody ( FIG. 14B , left blot), an anti-Fc antibody ( FIG. 14B , center blot), or an anti-NKG2A antibody ( FIG. 14B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the hCD58-Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 14B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 14B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, 3-mercaptoethanol ( FIG. 14B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent (3-mercaptoethanol) and a deglycosylation agent ( FIG. 14B , lane DG in each blot).
- the hCD80-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of human CD80 fused to an extracellular domain (ECD) of human NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 15A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with 3-mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e. treated both with 3-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS).
- the gels were run in triplicates and probed using an anti-CD80 antibody ( FIG. 15B , left blot), an anti-Fc antibody ( FIG. 15B , center blot), or an anti-NKG2A antibody ( FIG. 15B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the hCD80-Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 15B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 15B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 15B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 15B , lane DG in each blot).
- a construct encoding a human SLAMF6- and NKG2A-based chimeric protein was generated.
- the hSLAMF6-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of human SLAMF6 fused to an extracellular domain (ECD) of human NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 16A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS)
- reduced and deglycosylated samples i.e. treated both with ⁇ -mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS.
- the gels were run in triplicates and probed using an anti-SLAMF6 antibody ( FIG. 16B , left blot), an anti-Fc antibody ( FIG. 16B , center blot), or an anti-NKG2A antibody ( FIG. 16B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the hSLAMF6-Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 16B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 16B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 16B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 16B , lane DG in each blot).
- a construct encoding a mouse CD80- and NKG2A-based chimeric protein was generated.
- the mCD80-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of mouse CD80 fused to an extracellular domain (ECD) of mouse NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 17A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with 3-mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e. treated both with ⁇ -mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 17B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, 3-mercaptoethanol ( FIG. 17B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent (3-mercaptoethanol) and a deglycosylation agent ( FIG. 17B , lane DG in each blot).
- a construct encoding a mouse CD86- and NKG2A-based chimeric protein was generated.
- the mCD86-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of mouse CD86 fused to an extracellular domain (ECD) of Mouse NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 18A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with 3-mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e. treated both with 3-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS).
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 18B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 18B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 18B , lane DG in each blot).
- a construct encoding a mouse PD-1- and NKG2A-based chimeric protein was generated.
- the mPD-1-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of mouse PD-1 fused to an extracellular domain (ECD) of Mouse NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 19A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with ⁇ -mercaptoethanol, and boiled in the presence of SDS)
- reduced and deglycosylated samples i.e. treated both with p-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 19B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 19B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 19B , lane DG in each blot).
- SIRP ⁇ -Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of SIRP ⁇ fused to an extracellular domain (ECD) of Mouse NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 20A .
- the gels were run in triplicates and probed using an anti-SIRP ⁇ antibody ( FIG. 20B , left blot), an anti-Fc antibody ( FIG. 20B , center blot), or an anti-NKG2A antibody ( FIG. 20B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the SIRP ⁇ -Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 20B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 20B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, 3-mercaptoethanol ( FIG. 20B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent (3-mercaptoethanol) and a deglycosylation agent ( FIG. 20B , lane DG in each blot).
- TGFBR2-Fc-NKG2A chimeric protein construct included an extracellular domain (ECD) of mouse TGFBR2 fused to an extracellular domain (ECD) of Mouse NKG2A via a hinge-CH2-CH3 Fc domain derived from IgG1. See, FIG. 21A .
- untreated denatured samples i.e., boiled in the presence of SDS, without a treatment with a reducing agent or a deglycosylation agent
- reduced samples which were not deglycosylated (i.e. treated only with 3-mercaptoethanol, and boiled in the presence of SDS); and
- reduced and deglycosylated samples i.e. treated both with 3-mercaptoethanol and a deglycosylation agent, and boiled in the presence of SDS).
- the gels were run in triplicates and probed using an anti-TGFBR2 antibody ( FIG. 21B , left blot), an anti-Fc antibody ( FIG. 21B , center blot), or an anti-NKG2A antibody ( FIG. 21B , right blot).
- Western blot analyses were performed to confirm the presence the two ECD domains and the Fc linker of the TGFBR2-Fc-NKG2A chimeric protein with antibodies specific to the two ECD domains and the Fc linker ( FIG. 21B ). As shown in FIG.
- the Western blots indicated the presence of a dominant dimer band in the non-reduced lanes ( FIG. 21B , lane NR in each blot), which was reduced to a glycosylated monomeric band in the presence of the reducing agent, ⁇ -mercaptoethanol ( FIG. 21B , lane R in each blot).
- the chimeric protein ran as a monomer at the predicted molecular weight of about 67 kDa in the presence of both a reducing agent ( ⁇ -mercaptoethanol) and a deglycosylation agent ( FIG. 21B , lane DG in each blot).
- ELISA-based assays were performed. For these assays, an anti-mFc IgG antibody was coated on plates and increasing amounts of the mPD-1-Fc-NKG2A and mSLAMF6-Fc-NKG2a chimeric proteins were added to the plates for capture by the plate-bound anti-mFc IgG antibody. The binding of the mPD-1-Fc-NKG2A and mSLAMF6-Fc-NKG2a chimeric proteins bound to the anti-mFc IgG antibody were detected using an anti-mFc HRP.
- An IgG antibody mouse Fc was used to generate a standard curve.
- mFc IgG was used as a positive control.
- the Fc domain of the mSLAMF6-Fc-NKG2A and mPD-1-Fc-NKG2A chimeric proteins bound to the plate-bound anti-mFc IgG antibody in a dose-dependent manner.
- ELISA-based assays were performed. For these assays, an anti-human IgG antibody was coated on plates and increasing amounts of the hCD86-Fc-NKG2A and hTGFBR2-Fc-NKG2A, mCD80-Fc-NKG2a chimeric proteins, and a human IgG antibody were added to the plates for capture by the plate-bound anti-human antibody. The human IgG antibody was used as a positive control and to generate a standard curve. The mCD80-Fc-NKG2a chimeric protein was included as a negative control as containing a non-human Fc domain.
- the protein bound to the anti-human IgG antibody was detected using an anti-human Fcgamma HRP.
- the hCD86-Fc-NKG2A and hTGFBR2-Fc-NKG2A chimeric proteins bound to the plate-bound anti-human IgG antibody in a dose-dependent manner.
- the mCD80-Fc-NKG2a chimeric protein did not bind the plate-bound anti-human IgG antibody.
- an anti-human IgG antibody was coated on plates and increasing amounts of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins, and a human IgG antibody were added to the plates for capture by the plate-bound anti-mFc IgG antibody.
- the human IgG antibody was used as a positive control and to generate a standard curve.
- the binding to the anti-human IgG antibody was detected using an anti-human Fcgamma HRP. As shown in FIG.
- each of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins bound to the plate-bound anti-human IgG antibody in a dose-dependent manner.
- the CD94/NK group 2 member A (NKG2A) heterodimer binds to a nonclassical minimally polymorphic HLA class I molecule (HLA-E), which presents peptides derived from other HLA class I molecules.
- HLA-E nonclassical minimally polymorphic HLA class I molecule
- ELISA-based assays were performed. Briefly, recombinant HLA-E protein was coated on plates and increasing amounts of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins were added to the plates for capture by the plate-bound recombinant HLA-E protein.
- the chimeric proteins bound to the recombinant HLA-E protein was detected using an anti-human Fcgamma HRP.
- each of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and hCD80-Fc-NKG2A chimeric proteins bound to the plate-bound recombinant HLA-E protein in a dose-dependent manner.
- Example 24 The Ability of the Type I Transmembrane Protein Parts of the NKG2A-Based Chimeric Proteins to Bind their Natural Ligands
- CD48 binds 2B4 (CD244), a member of the signaling lymphocyte-activation molecule (SLAM) family.
- SLAM signaling lymphocyte-activation molecule
- the chimeric hCD48-Fc-NKG2A protein bound to the recombinant 2B4-His protein was detected using an anti-human Fcgamma HRP.
- the hCD48-Fc-NKG2A chimeric protein bound to the plate-bound recombinant 2B4-His protein, but not human CD28-His protein, in a dose-dependent manner.
- TGF ⁇ 1 is a ligand of TGFBR2.
- TGFBR2 part of the TGFBR2-Fc-NKG2A chimeric protein can bind TGF ⁇ 1
- ELISA-based assays were performed. Briefly, recombinant TGF ⁇ 1 protein was coated on plates and increasing amounts of the TGFBR2-Fc-NKG2A chimeric protein was added to the plates for capture by the plate-bound recombinant TGF ⁇ 1 protein. The chimeric protein bound to the recombinant TGF ⁇ 1 protein was detected using an anti-mFc HRP. As shown in FIG.
- each of the TGFBR2-Fc-NKG2A chimeric protein bound to the plate-bound recombinant TGF ⁇ 1 protein in a dose-dependent manner.
- CD2 is a transmembrane protein in T cells that binds to its ligand CD58 on APC in humans and on CD48 in rodents. To understand whether the CD48 and CD58 parts of the hCD48-Fc-NKG2A, and hCD58-Fc-NKG2A chimeric protein can bind CD2, ELISA-based assays were performed.
- recombinant human CD2 protein (rhCD2-His) was coated on plates and increasing amounts of the hCD48-Fc-NKG2A, hCD58-Fc-NKG2A, and mCD80-Fc-NKG2A chimeric proteins and recombinant hCD58-Fc protein was added to the plates for capture by the plate-bound recombinant CD2 protein.
- the hCD80-Fc-NKG2A chimeric protein served as a negative control and recombinant hCD58-Fc protein served as a positive control.
- the hCD48-Fc-NKG2A and hCD58-Fc-NKG2A, chimeric proteins and recombinant hCD58-Fc protein bound to the recombinant CD2 protein was detected using an anti-human Fc HRP.
- the mCD80-Fc-NKG2A chimeric protein bound to the recombinant CD2 protein was detected using an anti-mouse Fc HRP.
- the hCD58-Fc-NKG2A and hCD58-Fc exhibited similar kinetics of binding to the plate-bound recombinant CD2 protein.
- the mCD80-Fc-NKG2A protein did not bind CD2.
- CD48 is the ligand for 2B4.
- ELISA-based assays were performed. Briefly, recombinant human 2B4 protein (rh2B4-His) was coated on plates and increasing amounts of the hCD48-Fc-NKG2A and mCD80-Fc-NKG2A chimeric proteins and recombinant human CD48-Fc (rhCD48-Fc) protein was added to the plates for capture by the plate-bound recombinant 2B4 protein.
- the hCD48-Fc-NKG2A chimeric protein and recombinant human CD48-Fc (rhCD48-Fc) protein bound to the recombinant 2B4 protein was detected using an anti-human Fc HRP.
- the mCD80-Fc-NKG2A chimeric protein, which was used as a negative control, bound to the recombinant 2B4 protein was detected using an anti-mouse Fc HRP.
- the hCD48-Fc-NKG2A, chimeric protein bound to the plate-bound recombinant 2B4 protein in a dose-dependent manner, with a kinetics comparable to that of rhCD48-Fc protein.
- CD28 is stimulated by CD80 and CD86 ligands on cells such as APCs, T cells and NK cells.
- ELISA-based assays were performed. Briefly, recombinant mouse CD28 (rmCD29) protein was coated on plates and increasing amounts of the mCD80-Fc-NKG2A chimeric protein was added to the plates for capture by the plate-bound recombinant CD28 protein. The chimeric protein bound to the recombinant CD28 protein was detected using an anti-mouse Fc HRP. As shown in FIG.
- CD80 and CD86 parts of the hCD80-Fc-NKG2A and hCD86-Fc-NKG2A chimeric protein can bind CD28
- ELISA-based assays were performed. Briefly, recombinant CD28 protein was coated on plates and increasing amounts of the hCD80-Fc-NKG2A, hCD86-Fc-NKG2A, and mCD48-Fc-NKG2A chimeric proteins, and recombinant human CD86-Fc (rhCD86-Fc) protein was added to the plates for capture by the plate-bound recombinant CD28 protein.
- the mCD48-Fc-NKG2A chimeric protein, and recombinant human CDrhCD86-Fc protein was used as negative and positive controls, respectively.
- the chimeric proteins bound to the recombinant CD28 protein was detected using an anti-human Fc HRP.
- the hCD80-Fc-NKG2A and hCD86-Fc-NKG2A chimeric proteins bound to the plate-bound recombinant CD28 protein in a dose-dependent manner, with a binding kinetics comparable to that of the rhCD86-Fc protein.
- the mCD48-Fc-NKG2A chimeric protein did not bind CD28.
- Programmed death-ligand 1 is a PD-1 ligand.
- ELISA-based assays were performed. Briefly, recombinant PD-L1 protein (mPD-L1-His) was coated on plates and increasing amounts of the PD-1-Fc-NKG2A chimeric protein was added to the plates for capture by the plate-bound recombinant PD-L1 protein. The chimeric protein bound to the recombinant PD-L1 protein was detected using an anti-His-6 ⁇ HRP. As shown in FIG.
- each of the PD-1-Fc-NKG2A chimeric protein bound to the plate-bound recombinant PD-L1 protein in a dose-dependent manner.
- Example 25 The Ability of the Type I Transmembrane Protein and the NKG2A Part of the Chimeric Proteins Disclosed Herein to Simultaneously Bind their Ligands
- mCD48-Fc-NKG2A chimeric protein can binds simultaneously to both Qa1 and Anti-CD48.
- an anti-mouse Qa1 antibody was coated on plates.
- Recombinant Qa1 protein Qa1-His
- Increasing amounts of the mCD48-Fc-NKG2A chimeric protein was added to the plates for capture by the Qa1-His protein.
- a goat anti-mCD48 antibody was added to the plate for capture by mCD48-Fc-NKG2A chimeric protein.
- the binding of the anti-mCD48 antibody was detected using an anti-goat antibody. As shown in FIG. 36 , the ELISA assays showed a dose-dependent binding. In contrast, a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of mCD48-Fc-NKG2A to both Qa1 and anti-CD48 antibody, these results demonstrate that mCD48-Fc-NKG2A binds to both Qa1 and Anti-CD48 simultaneously in a dose dependent manner.
- HLA-E HLA-E-His
- a rat anti-mCD86 antibody was added to the plate for capture by mCD86-Fc-NKG2A chimeric protein.
- the binding of the anti-mCD86 antibody was detected using an anti-rat antibody. As shown in FIG. 37 , the ELISA assays showed a dose-dependent binding.
- HLA-E-His HLA-E-His
- a rat anti-mCD86 antibody was added to the plate for capture by mCD86-Fc-NKG2A chimeric protein.
- the binding of the anti-mCD86 antibody was detected using an anti-rat antibody. As shown in FIG. 37 , the ELISA assays showed a dose-dependent binding.
- mSIRP ⁇ -Fc-NKG2A chimeric protein can binds simultaneously to both anti-NKG2a and CD47. Briefly, and anti-NKG2a antibody was coated on plates. Increasing amounts of the mSIRP ⁇ -Fc-NKG2A and mCD48-Fc-NKG2A chimeric proteins were added to the plates for capture by the anti-NKG2a antibody. Further, recombinant mCD47 (mCD47-His) protein was added to the plate for capture by mSIRP ⁇ -Fc-NKG2A chimeric protein. The binding of the mCD47-His protein was detected using an anti-His HRP antibody.
- the ELISA assays showed a dose-dependent binding by mSIRP ⁇ -Fc-NKG2A.
- the mCD48-Fc-NKG2A chimeric protein which was a negative control, did not exhibit such binding. Since signal generation requires simultaneous binding of mSIRP ⁇ -Fc-NKG2A to both anti-NKG2a antibody and mCD47-His protein, these results demonstrate that mSIRP ⁇ -Fc-NKG2A binds to both anti-NKG2a antibody and mCD47 simultaneously in a dose dependent manner.
- hPD-1-Fc-NKG2A chimeric protein can binds simultaneously to both hPD-L1 and HLA-E. Briefly, and recombinant hPD-L1 (hPD-L1-Fc) protein was coated on plates. Increasing amounts of the hPD-1-Fc-NKG2A chimeric protein was added to the plates for capture by the hPD-L1-Fc protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by hPD-1-Fc-NKG2A chimeric protein.
- HLA-E HLA-E-His
- the binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody.
- the ELISA assays showed a dose-dependent binding by hPD-1-Fc-NKG2A.
- a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of hPD-1-Fc-NKG2A to both hPD-L1 protein and HLA-E protein, these results demonstrate that hPD-1-Fc-NKG2A binds to both hPD-L1 protein and HLA-E simultaneously in a dose dependent manner.
- hCD80-Fc-NKG2A chimeric protein can binds simultaneously to both hCD28 and HLA-E. Briefly, and recombinant hCD28 (rhCD28-Fc) protein was coated on plates. Increasing amounts of the hCD80-Fc-NKG2A chimeric protein was added to the plates for capture by the recombinant human CD28-Fc (rhCD28-Fc) protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by hCD80-Fc-NKG2A chimeric protein.
- HLA-E HLA-E-His
- the binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody.
- the ELISA assays showed a dose-dependent binding by hCD80-Fc-NKG2A. Since signal generation requires simultaneous binding of hCD80-Fc-NKG2A to both rhCD28 protein and HLA-E protein, these results demonstrate that hCD80-Fc-NKG2A binds to both hCD28 protein and HLA-E simultaneously in a dose dependent manner.
- hCD86-Fc-NKG2A chimeric protein can binds simultaneously to both hCD28 and HLA-E. Briefly, and recombinant hCD28 (rhCD28-Fc) protein was coated on plates. Increasing amounts of the hCD86-Fc-NKG2A chimeric protein was added to the plates for capture by the rhCD28-Fc protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by hCD86-Fc-NKG2A chimeric protein. The binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody. As shown in FIG.
- the ELISA assays showed a dose-dependent binding by hCD86-Fc-NKG2A. In contrast, a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of hCD86-Fc-NKG2A to both rhCD28 protein and HLA-E protein, these results demonstrate that hCD86-Fc-NKG2A binds to both hCD28 protein and HLA-E simultaneously in a dose dependent manner.
- hSLAMF6-Fc-NKG2A chimeric protein can binds simultaneously to both hSLAMF6 and HLA-E. Briefly, and recombinant hSLAMF6 (rhSLAMF6-Fc) protein was coated on plates. Increasing amounts of the hSLAMF6-Fc-NKG2A chimeric protein was added to the plates for capture by the recombinant human SLAMF6-Fc (rhSLAMF6-Fc) protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by hSLAMF6-Fc-NKG2A chimeric protein.
- HLA-E HLA-E-His
- the binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody.
- the ELISA assays showed a dose-dependent binding by hSLAMF6-Fc-NKG2A.
- a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of hSLAMF6-Fc-NKG2A to both rhSLAMF6 protein and HLA-E protein, these results demonstrate that hSLAMF6-Fc-NKG2A binds to both hSLAMF6 protein and HLA-E simultaneously in a dose dependent manner.
- PD-1-Fc-NKG2A chimeric protein can binds simultaneously to both PD-L1 and HLA-E. Briefly, and recombinant PD-L1 (rPD-L1-Fc) protein was coated on plates. Increasing amounts of the PD-1-Fc-NKG2A chimeric protein was added to the plates for capture by the rPD-L1-Fc protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by PD-1-Fc-NKG2A chimeric protein. The binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody.
- the ELISA assays showed a dose-dependent binding by PD-1-Fc-NKG2A.
- a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of PD-1-Fc-NKG2A to both rPD-L1 protein and HLA-E protein, these results demonstrate that PD-1-Fc-NKG2A binds to both PD-L1 protein and HLA-E simultaneously in a dose dependent manner.
- hCD48-Fc-NKG2A chimeric protein can bind simultaneously to both 2B4 and HLA-E. Briefly, and recombinant 2B4 (rh2B4-Fc) protein was coated on plates. Increasing amounts of the hCD48-Fc-NKG2A chimeric protein was added to the plates for capture by the recombinant human 2B4-Fc (rh2B4-Fc) protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by hCD48-Fc-NKG2A chimeric proteins.
- 2B4 rh2B4-Fc
- HLA-E HLA-E-His
- the binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody.
- the ELISA assays showed a dose-dependent binding by hCD48-Fc-NKG2A.
- a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of hCD48-Fc-NKG2A to both rh2B4 protein and HLA-E protein, these results demonstrate that hCD48-Fc-NKG2A binds to both 2B4 protein and HLA-E simultaneously in a dose dependent manner.
- hCD58-Fc-NKG2A chimeric protein can bind simultaneously to both CD2 and HLA-E. Briefly, and recombinant CD2 (rhCD2-Fc) protein was coated on plates. Increasing amounts of the hCD58-Fc-NKG2A chimeric protein was added to the plates for capture by the recombinant human CD2-Fc (rhCD2-Fc) protein. Further, recombinant HLA-E (HLA-E-His) protein was added to the plate for capture by hCD58-Fc-NKG2A chimeric proteins. The binding of the HLA-E-His protein was detected using an anti-His 6 ⁇ HRP antibody.
- the ELISA assays showed a dose-dependent binding by hCD58-Fc-NKG2A. In contrast, a negative control did not exhibit such binding. Since signal generation requires simultaneous binding of hCD58-Fc-NKG2A to both rhCD2 protein and HLA-E protein, these results demonstrate that hCD58-Fc-NKG2A binds to both CD2 protein and HLA-E simultaneously in a dose dependent manner.
- CHO-K1/h2B4 cells A positive clone (called CHO-K1/h2B4 cells) was stained with an anti-2B4 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 45 , staining of the CHO-K1/h2B4 cells by the anti-2B4 antibody but not the isotype control, confirmed the generation of the CHO-K1/h2B4 cells.
- hCD48-Fc-NKG2A chimeric protein was specifically bind the CHO-K1/h2B4 cells.
- FIG. 46A and FIG. 46B the hCD48-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/h2B4 cells ( FIG. 46B ) compared to the WT CHO-K1 cells ( FIG. 46A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the hCD48-Fc-NKG2A chimeric protein to h2B4 expressed by the CHO-K1/h2B4 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 47 ).
- CHO-K1/m2B4 cells A positive clone (called CHO-K1/m2B4 cells) was stained with an anti-m2B4 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 48 , staining of the CHO-K1/m2B4 cells by the anti-m2B4 antibody but not the isotype control, when compared with an unstained cell control, confirmed the generation of the CHO-K1/m2B4 cells.
- FIG. 49A and FIG. 49B the mCD48-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/m2B4 cells ( FIG. 49B ) compared to the WT CHO-K1 cells ( FIG. 49A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the mCD48-Fc-NKG2A chimeric protein to m2B4 expressed by the CHO-K1/m2B4 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 50 ).
- Example 28 Specific Binding of the Human PD-1-Fc-NKG2A Chimeric Protein to Cells Expressing hPD-L1
- CHO-K1/hPD-L1 cells A positive clone (called CHO-K1/hPD-L1 cells) was stained with an anti-PD-L1 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 51 , staining of the CHO-K1/hPD-L1 cells by the anti-PD-L1 antibody but not the isotype control, confirmed the generation of the CHO-K1/hPD-L1 cells.
- hPD-1-Fc-NKG2A chimeric protein was specifically bind the CHO-K1/hPD-L1 cells.
- FIG. 52A and FIG. 52B the hPD-1-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/hPD-L1 cells ( FIG. 52B ) compared to the WT CHO-K1 cells ( FIG. 52A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the hPD-1-Fc-NKG2A chimeric protein to hPD-L1 expressed by the CHO-K1/hPD-L1 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 53 ).
- CHO-K1/mPD-L1 cells A positive clone (called CHO-K1/mPD-L1 cells) was stained with an anti-PD-L1 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 54 , staining of the CHO-K1/mPD-L1 cells by the anti-PD-L1 antibody but not the isotype control, confirmed the generation of the CHO-K1/mPD-L1 cells.
- a flow-cytometry-based assay was carried out. As shown in FIG. 55A and FIG. 55B , the mPD-1-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/mPD-L1 cells ( FIG. 55B ) compared to the WT CHO-K1 cells ( FIG. 55A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the mPD-1-Fc-NKG2A chimeric protein to mPD-L1 expressed by the CHO-K1/mPD-L1 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 56 ).
- CHO-K1/mQa1 cells A positive clone (called CHO-K1/mQa1 cells) was stained with an anti-Qa1 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 57 , staining of the CHO-K1/mQa1 cells by the anti-Qa1 antibody but not the isotype control, compared to an unstained control, confirmed the generation of the CHO-K1/mQa1 cells.
- a flow-cytometry-based assay was carried out. As shown in FIG. 58A and FIG. 58B , the mCD48-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/mQa1 cells ( FIG. 58B ) compared to the WT CHO-K1 cells ( FIG. 58A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the mCD48-Fc-NKG2A chimeric protein to mQa1 expressed by the CHO-K1/mQa1 cells. A quantitation of binding confirmed a dose-dependent binding ( FIG. 59 ).
- CHO-K1/hCD2 cells A positive clone (called CHO-K1/hCD2 cells) was stained with an anti-CD2 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 60 , staining of the CHO-K1/hCD2 cells by the anti-CD2 antibody but not the isotype control, compared to an unstained control, confirmed the generation of the CHO-K1/hCD2 cells.
- hCD58-Fc-NKG2A chimeric protein can specifically bind the CHO-K1/hCD2 cells.
- a flow-cytometry-based assay was carried out. As shown in FIG. 61A and FIG. 61B , the hCD58-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/hCD2 cells ( FIG. 61B ) compared to the WT CHO-K1 cells ( FIG. 61A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the hCD58-Fc-NKG2A chimeric protein to hCD2 expressed by the CHO-K1/hCD2 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 62 ).
- CHO-K1/hCD28 cell clones Two positive clone (called CHO-K1/hCD28 cell clones) were stained with an anti-CD28 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 63 , staining of the CHO-K1/hCD28 clones by the anti-CD28 antibody but not the isotype control, compared to an unstained control, confirmed the generation of the CHO-K1/hCD28 clones.
- hCD86-Fc-NKG2A chimeric protein was specifically bind the CHO-K1/hCD28 cells.
- FIG. 64A and FIG. 64B the hCD86-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/hCD28 cells ( FIG. 64B ) compared to the WT CHO-K1 cells ( FIG. 64A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the hCD86-Fc-NKG2A chimeric protein to hCD28 expressed by the CHO-K1/hCD28 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 65 ).
- CHO-K1/mCD28 cell clones Two positive clone (called CHO-K1/mCD28 cell clones) were stained with an anti-CD28 antibody or an isotype control, and subjected to flow cytometry analysis. As shown in FIG. 66 , staining of the CHO-K1/mCD28 clones by the anti-CD28 antibody but not the isotype control, compared to an unstained control, confirmed the generation of the CHO-K1/mCD28 clones.
- FIG. 67A and FIG. 67B the mCD80-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/mCD28 cells ( FIG. 67B ) compared to the WT CHO-K1 cells ( FIG. 67A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the mCD80-Fc-NKG2A chimeric protein to mCD28 expressed by the CHO-K1/mCD28 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 68 ).
- FIG. 69A and FIG. 69B the mCD80-Fc-NKG2A chimeric protein displayed more binding to CHO-K1/mCD28 cells ( FIG. 69B ) compared to the WT CHO-K1 cells ( FIG. 69A ).
- the dose dependent shifts in the flow cytometry profiles illustrate a dose-dependent binding of the mCD86-Fc-NKG2A chimeric protein to mCD28 expressed by the CHO-K1/mCD28 cells.
- a quantitation of binding confirmed a dose-dependent binding ( FIG. 70 ).
- Example 34 The Ability of the Type I Transmembrane Protein and NKG2A Parts of the NKG2A-Based Chimeric Proteins to Initiate Signal Transduction Downstream to their Ligands
- the objectives of these experiments were (i) to understand whether the type I transmembrane protein part, which is located at or near the N-terminus of the chimeric proteins, can activate their targets; and (ii) to understand whether the NKG2A part, which is located at or near the C-terminus of the chimeric proteins, can activate its targets.
- the CHO-K1 cell clones expressing various ligands that were used in these assays harbor an NF ⁇ B-luciferase reporter that is sensitive to the binding of a ligand to the ligands that the CHO-K1 cell clones express.
- the following experiment was performed. Briefly, increasing amounts of the mCD48-Fc-NKG2A chimeric protein was incubated with the CHO-K1/m2B4 cells, or WT CHO-K1 cells, and the activation of the m2B4 was measured by a luciferase assay. As shown in FIG. 71 , the mCD48-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/m2B4 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the mCD48-Fc-NKG2A chimeric protein activates m2B4 signaling in a dose dependent manner.
- mCD48-Fc-NKG2A chimeric protein can activate 2B4 and mCD2 signaling. Briefly, increasing amounts of the mCD48-Fc-NKG2A chimeric protein was incubated with the CHO-K1/m2B4 cells, the CHO-K1/mCD2 cells, or WT CHO-K1 cells, and the activation of the m2B4 or mCD2 was measured by a luciferase assay. As shown in FIG.
- the mCD48-Fc-NKG2A chimeric protein induced luciferase activity in the CHO-K1/m2B4 and CHO-K1/mCD2 cells, but not WT CHO-K1 cells, in a dose dependent manner.
- the following experiment was performed. Briefly, increasing amounts of the mSLAMF6-Fc-NKG2A chimeric protein was incubated with the CHO-K1/mSLAMF6 cells, or WT CHO-K1 cells, and the activation of the mSLAMF6 was measured by a luciferase assay. As shown in FIG. 73 , the mSLAMF6-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/mSLAMF6 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the mSLAMF6-Fc-NKG2A chimeric protein activates mSLAMF6 signaling in a dose dependent manner.
- hCD80-Fc-NKG2A chimeric protein can activate human CD28 (hCD28) signaling. Briefly, increasing amounts of the hCD80-Fc-NKG2A chimeric protein was incubated with the CHO-K1/hCD28 cells, or WT CHO-K1 cells, and the activation of the hCD28 was measured by a luciferase assay. As shown in FIG. 74 , the hCD80-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/hCD28 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the hCD80-Fc-NKG2A chimeric protein activates hCD28 signaling in a dose dependent manner.
- hCD86-Fc-NKG2A chimeric protein can activate human CD28 (hCD28) signaling. Briefly, increasing amounts of the hCD86-Fc-NKG2A chimeric protein was incubated with the CHO-K1/hCD28 cells, or WT CHO-K1 cells, and the activation of the hCD28 was measured by a luciferase assay. As shown in FIG. 75 , the hCD86-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/hCD28 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the hCD86-Fc-NKG2A chimeric protein activates hCD28 signaling in a dose dependent manner.
- the hPD-1-Fc-NKG2A chimeric protein can activate human HLA-E signaling. Briefly, increasing amounts of the hPD-1-Fc-NKG2A chimeric protein was incubated with the CHO-K1/HLA-E cells, or WT CHO-K1 cells, and the activation of the hHLA-E was measured by a luciferase assay. As shown in FIG. 76 , the hPD-1-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/H LA-E cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the hPD-1-Fc-NKG2A chimeric protein activates HLA-E signaling in a dose dependent manner.
- mCD80-Fc-NKG2A chimeric protein can activate mouse Qa1 (mQa1) signaling. Briefly, increasing amounts of the mCD80-Fc-NKG2A chimeric protein was incubated with the CHO-K1/mQa1 cells, or WT CHO-K1 cells, and the activation of the mQa1 was measured by a luciferase assay. As shown in FIG. 77 , the mCD80-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/mQa1 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the mCD80-Fc-NKG2A chimeric protein activates mQa1 signaling in a dose dependent manner.
- the following experiment was performed. Briefly, increasing amounts of the mPD-1-Fc-NKG2A chimeric protein was incubated with the CHO-K1/mQa1 cells, or WT CHO-K1 cells, and the activation of the mQa1 was measured by a luciferase assay. As shown in FIG. 78 , the mPD-1-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/mQa1 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the mPD-1-Fc-NKG2A chimeric protein activates mQa1 signaling in a dose dependent manner.
- TGFBR2-Fc-NKG2A chimeric protein can activate Qa1 signaling. Briefly, increasing amounts of the TGFBR2-Fc-NKG2A chimeric protein was incubated with the CHO-K1/mQa1 cells, or WT CHO-K1 cells, and the activation of the mQa1 was measured by a luciferase assay. As shown in FIG. 79 , the TGFBR2-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/mQa1 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the TGFBR2-Fc-NKG2A chimeric protein activates mQa1 signaling in a dose dependent manner.
- hCD48-Fc-NKG2A chimeric protein can activate human 2B4 (h2b4) signaling. Briefly, increasing amounts of the hCD48-Fc-NKG2A chimeric protein was incubated with the CHO-K1/h2B4 cells, or WT CHO-K1 cells, and the activation of the h2B4 was measured by a luciferase assay. As shown in FIG. 80 , the hCD48-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/h2B4 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the hCD48-Fc-NKG2A chimeric protein activates h2B4 signaling in a dose dependent manner.
- hCD58-Fc-NKG2A chimeric protein can activate human CD2 (h2b4) signaling. Briefly, increasing amounts of the hCD58-Fc-NKG2A chimeric protein was incubated with the CHO-K1/hCD2 cells, or WT CHO-K1 cells, and the activation of the hCD2 was measured by a luciferase assay. As shown in FIG. 81 , the hCD58-Fc-NKG2A chimeric protein induced luciferase activity in CHO-K1/hCD2 cells, but not WT CHO-K1 cells, in a dose dependent manner. These data demonstrate that the hCD58-Fc-NKG2A chimeric protein activates hCD2 signaling in a dose dependent manner.
- Example 35 Binding of the Chimeric Proteins of the Present Disclosure to the Human Natural Killer Cell Line NK-92
- the objective of this experiment was to understand whether the human chimeric proteins disclosed herein can bind to NK cells.
- the human NK cell line NK92 CD16V was employed for this purpose.
- the binding of the hCD48-Fc-NKG2A chimeric protein to NK92-CD16V cells was measured by flow cytometry. As shown in FIG. 83A , flow cytometry profiles exhibited a dose-dependent shift to the right hand side. The geometric mean of the peaks was plotted. As shown in FIG. 83B , the geometric mean of binding showed a dose-dependent increase. These results demonstrate a dose-dependent binding of the hCD48-Fc-NKG2A chimeric protein to NK92-CD16V cells.
- Example 36 Induction by the Chimeric Proteins of the Present Disclosure of Killing of Antigen Positive Cells Mediated by the Activated T Cells
- the objective of this experiment was to understand whether the human chimeric proteins disclosed herein can induce killing of antigen positive cells mediated by the antigen activated T cells.
- An assay to determine if the mouse chimeric proteins can enhance antigen specific anti-tumor response when exposed to antigen activated T cells (OT-1 na ⁇ ve T cells) was developed.
- Target cells were antigen positive (OVA+) cells.
- mCD86-Fc-NKG2A chimeric protein Increasing amounts of the mCD86-Fc-NKG2A chimeric protein was incubated with OT-1 na ⁇ ve T cells (effector cells) and EO771 OVA+ cells (target cells) at the effector cells: target cell ration of 5:1. Apoptosis was assessed by measuring caspase 3/7 activity.
- the INCUCYTE system which allows live-cell imaging and fluorescent signaling of caspase 3/7 (an apoptosis marker), was employed for this assay.
- the mCD86-Fc-NKG2A chimeric protein induced a dose-dependent increase in apoptosis of the target cells mediated by the effector cells.
- Example 37 Induction by the Chimeric Proteins of the Present Disclosure of NK Cell-Mediated Antibody Dependent Cellular Cytotoxicity (ADCC)
- the objective of this experiment was to understand whether the chimeric proteins disclosed herein can enhance the antibody dependent cellular cytotoxicity (ADCC) mediated by NK cells.
- ADCC antibody dependent cellular cytotoxicity
- the ADCC-capable anti-EGFR antibody Cetuximab and the EGFR-positive human A431 human non-small cell lung cancer (NSCLC) cells were used as target cells.
- Increasing amounts of the hCD86-Fc-NKG2A chimeric protein and 1 ⁇ g/ml Cetuximab and NK92-CD16V cells (effector cells) were mixed with A431 cells (target cells) at the effector cells: target cell ration of 5:1, and incubated.
- Apoptosis was assessed by measuring annexin V using the INCUCYTE live cell imaging system. As shown in FIG.
- the hCD86-Fc-NKG2A chimeric protein caused a dose-dependent increase in annexin V positive cells.
- the hCD86-Fc-NKG2A chimeric protein enhanced cell death of human A431 cells when exposed to human NK cells and the ADCC capable Cetuximab antibody in a dose-dependent manner. Therefore, the chimeric protein disclosed herein enhanced cell death of human A431 cells when exposed to human NK cells and the ADCC capable Cetuximab antibody in a dose-dependent manner.
- the ADCC-capable anti-EGFR antibody Cetuximab and the EGFR-positive human A549 human non-small cell lung cancer (NSCLC) cells were used as target cells.
- Increasing amounts of the hCD86-Fc-NKG2A chimeric protein and 10 ⁇ g/ml Cetuximab, and NK92-CD16V cells (effector cells) were mixed with A549 cells (target cells) at the effector cells: target cell ration of 5:1, and incubated.
- Apoptosis was assessed by measuring annexin V using the INCUCYTE live cell imaging system. As shown in FIG.
- the hCD86-Fc-NKG2A chimeric protein caused a dose-dependent increase in annexin V positive cells.
- the hCD86-Fc-NKG2A chimeric protein enhanced cell death of human A549 cells when exposed to human NK cells and the ADCC capable Cetuximab antibody in a dose-dependent manner. Therefore, the chimeric protein disclosed herein enhanced cell death of human A549 cells when exposed to human NK cells and the ADCC capable Cetuximab antibody in a dose-dependent manner.
- ADCC antibody dependent cellular cytotoxicity
- Example 38 Induction by the Chimeric Proteins of the Present Disclosure of Killing of Antigen Positive Cells Mediated by Splenocytes
- the objective of this experiment was to understand whether the human chimeric proteins disclosed herein can induce killing of antigen positive cells mediated by the splenocytes that are not antigen-activated.
- Non-activated splenocytes which comprised of multiple different immune effector cells (T cells, NK cells, etc.), were used as effector cells and murine A20 lymphocytes murine A20 lymphocytes were used as target cells.
- T cells immune effector cells
- NK cells NK cells
- Increasing amounts of the mCD86-Fc-NKG2A chimeric protein was incubated with freshly isolated splenocytes (effector cells) and A20 cells (target cells).
- Negative controls included splenocytes only (without target cells) and A20 cells only (without effector cells). Apoptosis was assessed by measuring caspase 3/7 activity using the INCUCYTE system. As shown in FIG.
- FIG. 89A shows a bar graph showing the caspase 3/7 activity at 3.5 hr. As shown in FIG. 89B , no apoptosis was observed without splenocytes (the invisible black bar in FIG. 89B ). Splenocytes only (without the target cells) showed apoptosis, indicating that the apoptosis going on in fresh splenocytes.
- mCD86-Fc-NKG2A chimeric protein induced significant apoptosis of target cells in the presence of splenocytes.
- Example 39 In Vivo Efficacy of the Chimeric Proteins of the Present Disclosure Against Colorectal Carcinoma Allografts
- the objective of this experiment was to study the efficacy of the chimeric proteins disclosed against cancer.
- Efficacy of the CD86-Fc-NKG2A chimeric protein was studied in comparison with an anti-Qa1 antibody in murine colorectal carcinoma cell line CT26 allografts.
- Balb/c mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- mice were treated on days 5, 8, 11, 14, 16, and 18 post-inoculation and tumor volumes were measured at indicated times.
- FIG. 90A the treatment with the anti-Qa1 antibody as well as the CD86-Fc-NKG2A chimeric protein significantly retarded the tumor growth compared to the untreated mice.
- the CD86-Fc-NKG2A chimeric protein caused higher tumor size reduction compared to the anti-Qa1 antibody.
- Tumor volumes on day 18 are plotted in FIG. 90B .
- the treatment with the CD86-Fc-NKG2A chimeric protein caused more reduction in tumor volume on day 18 compared to that of the anti-Qa1 antibody ( FIG. 90B ).
- mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the mCD80-Fc-NKG2A chimeric protein. The mice were treated on days 5, 8, 11, 14, 16, and 18 post-inoculation and tumor volumes were measured at indicated times. As shown in FIG.
- the treatment with the anti-Qa1 antibody as well as the mCD80-Fc-NKG2A chimeric protein significantly retarded the tumor growth compared to the untreated mice.
- Tumor volumes on day 18 are plotted in FIG. 91B .
- the treatment with the mCD80-Fc-NKG2A chimeric protein caused more reduction in tumor volume on day 18 compared to that of the anti-Qa1 antibody ( FIG. 91B ).
- mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the mCD48-Fc-NKG2A chimeric protein. The mice were treated on days 5, 8, 11, 14, 16, and 18 post-inoculation and tumor volumes were measured at indicated times. As shown in FIG.
- the treatment with the anti-Qa1 antibody as well as the mCD48-Fc-NKG2A chimeric protein significantly retarded the tumor growth compared to the untreated mice.
- Tumor volumes on day 18 are plotted in FIG. 92B .
- the treatment with the mCD48-Fc-NKG2A chimeric protein caused more reduction in tumor volume on day 18 compared to that of the anti-Qa1 antibody ( FIG. 92B ).
- mice were inoculated with CT26 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-Qa1 antibody (Bioxcell Clone 4C2.4A7.5H11), and (3) 300 ⁇ g/mouse of the mPD-1-Fc-NKG2A chimeric protein. The mice were treated on days 5, 8, 11, and 14 post-inoculation and tumor volumes were measured at indicated times. As shown in FIG.
- Example 40 In Vivo Efficacy of the Chimeric Proteins of the Present Disclosure against an Antigen Positive Lymphoma Allograft with the Antigen Activated T Cells
- the objective of this experiment was to test the effect of the chimeric proteins of the present disclosure on the growth of cancer positive for an antigen in the presence of antigen-activated T cells.
- the effect of the mCD86-Fc-NKG2A chimeric protein on the growth of the murine lymphoma cell line EG7 which has been engineered to express the novel antigen OVA (EG7-OVA) was studied. Briefly, mice were inoculated with EG7-OVA cells, and infused with CD4 and CD8 OVA specific T cells.
- mice were randomly assigned to one of four treatment groups: (1) untreated, (2) 100 ⁇ g/mouse anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse anti-NKG2A (BioXcell clone 20D5), and (4) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- the mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation.
- the mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation. Tumor volumes were measured. As shown in FIG.
- each of the treatment with anti-PD1 antibody, anti-NKG2A antibody, or the CD86-Fc-NKG2A chimeric protein retarded the tumor growth compared to the untreated mice.
- the CD86-Fc-NKG2A chimeric protein caused higher tumor size reduction compared to anti-PD1 antibody or anti-NKG2A antibody.
- Tumor volumes on day 7 are plotted in FIG. 94B .
- the treatment with the CD86-Fc-NKG2A chimeric protein caused significantly more reduction in tumor compared to anti-PD-1 antibody.
- peripheral phenotyping was performed using following antibodies: CD44:PE/Cy7 (Biolegend: 103209 Clone IM7), CD62L:APC (Biolegend: 104427 Clone MEL-14), CD4:BV605 (Biolegend: 100451 Clone GK1.5), Va2:AF488 (Biolegend: 127819 Clone B20.1), CD8:AF700 (Biolegend: 100729 Clone 53-6/7), and PD1:BV421 (Biolegend: 135217 Clone 29F.1A12).
- Cells from OT-I:GFP from transgenic to OT-1 mice were used to measure OT-1 cells.
- the fraction of effector memory T cells (TEM cells) on days 0 and 3 are plotted. As shown in FIG. 95 , the effect with the CD86-Fc-NKG2A chimeric protein resulted in increased effector memory T cells (TEM cells) compared to the treatments with anti-PD1 antibody, anti-NKG2A antibody or with untreated mice.
- Example 41 In Vivo Efficacy of the Chimeric Proteins of the Present Disclosure Against Myelomonocytic Leukemia Allografts
- the objective of this experiment was to further study the efficacy of the chimeric proteins disclosed herein against cancer. Efficacy of several chimeric proteins was studied in comparison with an anti-PD-1 antibody and anti-NKG2a antibody in murine myelomonocytic leukemia cell line WEHI-3 allografts.
- mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- treatment groups (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation. The mice were treated six times, two days apart. Tumor volumes were measured. As shown in FIG. 96A , each of the treatments with anti-NKG2A antibody or the CD86-Fc-NKG2A chimeric protein retarded the tumor growth compared to the untreated mice. The treatment with anti-PD1 antibody did not have a significant effect. The CD86-Fc-NKG2A chimeric protein caused higher tumor size reduction compared to anti-PD1 antibody or anti-NKG2A antibody. Tumor volumes on day 18 are plotted in FIG. 96B .
- the treatment with the CD86-Fc-NKG2A chimeric protein significant reduction in tumor volume compared to the tumors in both untreated and anti-PD-1 antibody-treated mice. These results demonstrate that the mCD86-Fc-NKG2A chimeric protein significantly reduced tumor growth and outperformed the anti-PD-1 antibody. These results demonstrate that the CD86-Fc-NKG2A chimeric protein outperformed the anti-PD-1 and anti-NKG2A antibodies in reducing the tumor volume of WEHI3 tumors.
- mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the SIRP ⁇ -Fc-NKG2A chimeric protein.
- treatment groups (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the SIRP ⁇ -Fc-NKG2A chimeric protein.
- mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation. The mice were treated six times, two days apart. Tumor volumes were measured. As shown in FIG. 97A , each of the treatments with anti-NKG2A antibody or the SIRP ⁇ -Fc-NKG2A chimeric protein retarded the tumor growth compared to the untreated mice. The treatment with anti-PD1 antibody did not have a significant effect. The SIRP ⁇ -Fc-NKG2A chimeric protein caused higher tumor size reduction compared to anti-PD1 antibody or anti-NKG2A antibody. Tumor volumes on day 18 are plotted in FIG. 97B .
- the treatment with the SIRP ⁇ -Fc-NKG2A chimeric protein significant reduction in tumor volume compared to the tumors in both untreated and anti-PD-1 antibody-treated mice.
- mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the CD48-Fc-NKG2A chimeric protein.
- treatment groups (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the CD48-Fc-NKG2A chimeric protein.
- mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation. The mice were treated six times, two days apart. Tumor volumes were measured. As shown in FIG. 98A , each of the treatments with anti-NKG2A antibody or the CD48-Fc-NKG2A chimeric protein retarded the tumor growth compared to the untreated mice. The treatment with anti-PD1 antibody did not have a significant effect. The CD48-Fc-NKG2A chimeric protein caused higher tumor size reduction compared to anti-PD1 antibody or anti-NKG2A antibody. Tumor volumes on day 18 are plotted in FIG. 98B .
- the treatment with the CD48-Fc-NKG2A chimeric protein significant reduction in tumor volume compared to the tumors in both untreated and anti-PD-1 antibody-treated mice.
- mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the TGFBR2-Fc-NKG2A chimeric protein.
- treatment groups (1) untreated, (2) 100 ⁇ g/mouse of an anti-PD1 antibody (Bioxcell clone RMP1-14), (3) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (4) 300 ⁇ g/mouse of the TGFBR2-Fc-NKG2A chimeric protein.
- mice were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation. The mice were treated six times, two days apart. Tumor volumes were measured. As shown in FIG. 99A , each of the treatments with anti-NKG2A antibody or the TGFBR2-Fc-NKG2A chimeric protein retarded the tumor growth compared to the untreated mice. The treatment with anti-PD1 antibody did not have a significant effect. The TGFBR2-Fc-NKG2A chimeric protein caused higher tumor size reduction compared to anti-PD1 antibody or anti-N KG2A antibody. Tumor volumes on day 18 are plotted in FIG. 99B .
- the treatment with the TGFBR2-Fc-NKG2A chimeric protein significant reduction in tumor volume compared to the tumors in both untreated and anti-PD-1 antibody-treated mice. These results demonstrate that the mTGFBR2-Fc-NKG2A chimeric protein significantly reduced tumor growth and outperformed the anti-PD-1 antibody. These results demonstrate that the TGFBR2-Fc-NKG2A chimeric protein outperformed the anti-PD-1 and anti-NKG2A antibodies in reducing the tumor volume of WEHI3 tumors.
- CD8 T cells were depleted using an anti-CD8a antibody (Bioxcell clone 2.43) that is known to deplete CD8+ cells, and the ability of the mCD86-Fc-NKG2A chimeric protein to control tumor growth was measured. Briefly, Balb/c mice were inoculated with WEHI-3 cells.
- mice were randomly assigned to the following treatment groups: (1) 250 ⁇ g/mouse of an anti-CD8a antibody (Bioxcell clone 2.43), (2) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein, and (3) 250 ⁇ g/mouse of the anti-CD8a antibody (Bioxcell clone 2.43)+300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein.
- the anti-CD8a antibody (Bioxcell clone 2.43) was administered on days ⁇ 1, 1, and 3 of the treatment regimen to deplete CD8 cells.
- mice from groups 2 and 3 were treated on days 0, 2, 4, 6, 8 and 10 post-inoculation with the CD86-Fc-NKG2A chimeric protein.
- the mice were treated six times, two days apart. Tumor volumes were measured on indicated days.
- mice treated with the CD86-Fc-NKG2A chimeric protein showed more antitumor activity compared to the mice treated with the anti-CD8a antibody.
- combined treatment with the anti-CD8a antibody and the CD86-Fc-NKG2A chimeric protein extinguished the observed antitumor activity.
- FIG. 100A mice treated with the CD86-Fc-NKG2A chimeric protein showed more antitumor activity compared to the mice treated with the anti-CD8a antibody.
- combined treatment with the anti-CD8a antibody and the CD86-Fc-NKG2A chimeric protein extinguished the observed antitumor activity.
- the tumor volumes on day 18 were significantly smaller in mice treated with the CD86-Fc-NKG2A chimeric protein alone compared to the combination of the anti-CD8a antibody and the CD86-Fc-NKG2A chimeric protein.
- Example 42 Infiltration of Immune Cells in Tumor, Spleen, and Lymph Node During the Treatment with the Chimeric Proteins of the Present Disclosure
- mice were inoculated with WEHI-3 cells. After the tumors were established, the mice were randomly assigned to the following treatment groups: (1) untreated, (2) 100 ⁇ g/mouse of an anti-NKG2A antibody (BioXcell clone 20D5) and (3) 300 ⁇ g/mouse of the CD86-Fc-NKG2A chimeric protein. The mice were treated on days 1, 3, 5, and 7 post-inoculation.
- an anti-NKG2A antibody, and mCD86-Fc-NKG2A mice were sacrificed, and the tumor, lymph node, and spleen were isolated, digested and analyzed for the amounts of the different immune cells in each of these environments using an NK panel and a T cell panel of antibodies.
- the NK panel comprised NKG2A-PeCy7 (Biolegend 142809 Clone 16A11), CD107-PE (Biolegend: 121611 Clone 1D4B), CD137-APC (Biolegend:106109 Clone 17B5), Granzyme B-Fitc (Biolegend 515402 Clone GB11), NKP46-BV421 (Biolegend 137611 Clone 29A1.4), CD16-BV510 (Biolegend 149531 Clone 9E9), CD27-PerCPCy5.5 (Biolegend 124213 Clone LG.3A10), KLRG1-BV605 (Biolegend 138419 Clone 2F1/KLRG1), CD11b-APC/Cy7 (Biolegend 101225 Clone M1/70), and CD3-AF700 (Biolegend 100215 Clone 17A2).
- the T Cell panel comprised NKG2A-PeCy7 (Biolegend 142809 Clone 16A11), CD3-Fitc (Biolegend 100306 Clone 145-2C11), CD8a-AF700 (Biolegend 100729 Clone 54-6.7), CD62L-BV421 (Biolegend 104435 Clone MEL-14), CD44-PeCy5 (Biolegend 103009 Clone IM7), Perforin: PE (Biolegend 154305 Clone S16009A), IAIE-BV605 (Biolegend 107639 Clone M5/114.15.2), PD1-BV510 (Biolegend 135241 Clone 29F.1A12), IFN-g-APC/Cy7 (Biolegend 505849 Clone XMG1.2), and CD137-APC (Biolegend 106109 Clone 17B5).
- PE Biolegend 154305 Clone S16009A
- IAIE-BV605 Biolegend 107639 Clone M5/114.15.2
- the cytokine secretory CD3 ⁇ CD11b+CD27+ splenocytes significantly increased in the mice treated with the CD86-Fc-NKG2A chimeric protein compared to the untreated mice and the mice treated with the anti-NKG2A antibody.
- the CD3 ⁇ NKP46+CD11b+CD27+ cytokine secretory NK cells in spleen FIG. 101B
- the CD3 ⁇ KLRG1+CD11b+CD27+NK cytokine secretory cells in spleen FIG.
- the spleens were isolated, digested and analyzed for the amounts of the different immune cells.
- the PD-1+ cytotoxic T lymphocytes (CTLs) in the spleens significantly increased in the mice treated with the CD86-Fc-NKG2A chimeric protein and the mice treated with the anti-NKG2A antibody compared to the untreated mice.
- the CD107+ cells in the spleens of the mice significantly increased in the mice treated with the CD86-Fc-NKG2A chimeric protein compared to the untreated mice.
- the CD86-Fc-NKG2A chimetric protein induced the growth of activated cytotoxic T cells and CD107+ cell (a marker for enhanced cytotoxicity).
- the effects of the CD86-Fc-NKG2A chimeric protein and anti-NKG2A antibody were equivalent in this system.
- the tumors were isolated, digested and analyzed for the amounts of granzyme B+ cells in the tumors.
- the granzyme B+ cells in the tumors significantly increased in the mice treated with the CD86-Fc-NKG2A chimeric protein and the mice treated with the anti-NKG2A antibody compared to the untreated mice. Therefore, the CD86-Fc-NKG2A chimetric protein induced the enhanced infiltration of immune cells into the tumor with the cytolytic marker Granzyme B.
- the effects of the CD86-Fc-NKG2A chimeric protein and anti-NKG2A antibody were equivalent in this system.
- the CD137+ cells in the tumors significantly increased in mice treated with the CD86-Fc-NKG2A chimeric protein and the mice treated with the anti-NKG2A antibody compared to the untreated mice.
- the IFN ⁇ + cells in the tumors significantly increased in mice treated with the CD86-Fc-NKG2A chimeric protein and the mice treated with the anti-NKG2A antibody compared to the untreated mice ( FIG. 104B ).
- the PD-1+ cytotoxic T lymphocytes (CTLs) in the tumors significantly increased in mice treated with the CD86-Fc-NKG2A chimeric protein compared to the untreated mice ( FIG. 104C ).
- the CD86-Fc-NKG2A chimeric protein induced enhanced infiltration of immune cells into the tumor that express potent activation markers (CD137, IFN- ⁇ , and PD1).
- potent activation markers CD137, IFN- ⁇ , and PD1.
- the effects of the CD86-Fc-NKG2A chimeric protein and anti-NKG2A antibody were equivalent in this system.
- the lymph nodes were isolated, digested and analyzed for the amounts of the different immune cells.
- the effector memory T cells in the lymph nodes significantly increased in the mice treated with the CD86-Fc-NKG2A chimeric protein compared to the untreated mice and the mice treated with the anti-NKG2A antibody.
- the central memory T cells significantly increased in the lymph nodes of the mice treated with the CD86-Fc-NKG2A chimeric protein compared to the untreated mice ( FIG. 105B ).
- the NKG2a+ cytotoxic T lymphocytes (CTLs) in the lymph nodes of the mice increased in the mice treated with the CD86-Fc-NKG2A chimeric protein compared to the untreated mice and the mice treated with the anti-NKG2A antibody ( FIG. 105C ). Therefore, the CD86-Fc-NKG2A chimeric protein induced enhanced infiltration of immune cells in the draining lymph node of effector memory T cells, central memory t cells, and NKG2A+CD8+ T cells indicating mCD86-Fc-NKG2A was able to induce the infiltration and proliferation of these important effector immune cells.
- CTLs cytotoxic T lymphocytes
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US17/017,117 US20200399344A1 (en) | 2019-05-16 | 2020-09-10 | Nk cell-directed chimeric proteins |
| US17/720,771 US20230045794A1 (en) | 2019-05-16 | 2022-04-14 | Nk cell-directed chimeric proteins |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962848915P | 2019-05-16 | 2019-05-16 | |
| PCT/US2020/033169 WO2020232365A1 (en) | 2019-05-16 | 2020-05-15 | Nk cell-directed chimeric proteins |
| US17/017,117 US20200399344A1 (en) | 2019-05-16 | 2020-09-10 | Nk cell-directed chimeric proteins |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/033169 Continuation WO2020232365A1 (en) | 2019-05-16 | 2020-05-15 | Nk cell-directed chimeric proteins |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/720,771 Continuation US20230045794A1 (en) | 2019-05-16 | 2022-04-14 | Nk cell-directed chimeric proteins |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20200399344A1 true US20200399344A1 (en) | 2020-12-24 |
Family
ID=73289381
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/017,117 Abandoned US20200399344A1 (en) | 2019-05-16 | 2020-09-10 | Nk cell-directed chimeric proteins |
| US17/720,771 Abandoned US20230045794A1 (en) | 2019-05-16 | 2022-04-14 | Nk cell-directed chimeric proteins |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/720,771 Abandoned US20230045794A1 (en) | 2019-05-16 | 2022-04-14 | Nk cell-directed chimeric proteins |
Country Status (7)
| Country | Link |
|---|---|
| US (2) | US20200399344A1 (enExample) |
| EP (1) | EP3969058A4 (enExample) |
| JP (1) | JP2022532430A (enExample) |
| CN (1) | CN114126663A (enExample) |
| AU (1) | AU2020276296A1 (enExample) |
| CA (1) | CA3140055A1 (enExample) |
| WO (1) | WO2020232365A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023274352A1 (en) * | 2021-07-02 | 2023-01-05 | Laekna Therapeutics Shanghai Co., Ltd. | Depletion of activated hepatic stellate cells (hscs) and uses thereof |
| WO2024073513A3 (en) * | 2022-09-27 | 2024-08-02 | Affini-T Therapeutics, Inc. | Chimeric receptors comprising interleukin 7 receptor (il7r) domains |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114853905B (zh) * | 2022-04-14 | 2022-11-22 | 呈诺再生医学科技(珠海横琴新区)有限公司 | 一种基因修饰nk细胞与抗体联合使用治疗肿瘤方案 |
| WO2024123812A1 (en) | 2022-12-05 | 2024-06-13 | Shattuck Labs, Inc. | Fusion proteins for the treatment of cardiometabolic diseases |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2035452B1 (en) * | 2006-06-22 | 2012-04-25 | Novo Nordisk A/S | Soluble heterodimeric receptors and uses thereof |
| WO2013112986A1 (en) * | 2012-01-27 | 2013-08-01 | Gliknik Inc. | Fusion proteins comprising igg2 hinge domains |
| JP6981973B2 (ja) * | 2015-10-01 | 2021-12-17 | ヒート バイオロジクス,インコーポレイテッド | I型及びii型細胞外ドメインを異種キメラタンパク質として連結する組成物及び方法 |
| BR112019005964A2 (pt) * | 2016-09-27 | 2019-06-18 | Epicentrx, Inc. | proteínas de fusão imunomoduladoras |
-
2020
- 2020-05-15 JP JP2021568608A patent/JP2022532430A/ja active Pending
- 2020-05-15 EP EP20805978.2A patent/EP3969058A4/en not_active Withdrawn
- 2020-05-15 CN CN202080051217.9A patent/CN114126663A/zh active Pending
- 2020-05-15 WO PCT/US2020/033169 patent/WO2020232365A1/en not_active Ceased
- 2020-05-15 AU AU2020276296A patent/AU2020276296A1/en not_active Abandoned
- 2020-05-15 CA CA3140055A patent/CA3140055A1/en active Pending
- 2020-09-10 US US17/017,117 patent/US20200399344A1/en not_active Abandoned
-
2022
- 2022-04-14 US US17/720,771 patent/US20230045794A1/en not_active Abandoned
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023274352A1 (en) * | 2021-07-02 | 2023-01-05 | Laekna Therapeutics Shanghai Co., Ltd. | Depletion of activated hepatic stellate cells (hscs) and uses thereof |
| WO2024073513A3 (en) * | 2022-09-27 | 2024-08-02 | Affini-T Therapeutics, Inc. | Chimeric receptors comprising interleukin 7 receptor (il7r) domains |
Also Published As
| Publication number | Publication date |
|---|---|
| EP3969058A1 (en) | 2022-03-23 |
| CN114126663A (zh) | 2022-03-01 |
| CA3140055A1 (en) | 2020-11-19 |
| JP2022532430A (ja) | 2022-07-14 |
| EP3969058A4 (en) | 2023-06-28 |
| US20230045794A1 (en) | 2023-02-16 |
| WO2020232365A1 (en) | 2020-11-19 |
| AU2020276296A1 (en) | 2021-11-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7260477B2 (ja) | Tigit及びlightベースのキメラタンパク質 | |
| US20230045794A1 (en) | Nk cell-directed chimeric proteins | |
| US20220306715A1 (en) | Chimeric proteins in autoimmunity | |
| CN116063567A (zh) | 作为异源嵌合蛋白邻接i型和ii型胞外结构域的组合物和方法 | |
| US20220185863A1 (en) | Combination therapies | |
| US20210379153A1 (en) | Combination therapies comprising sirp alpha-based chimeric proteins | |
| US20200071380A1 (en) | Combination therapies comprising sirp alpha-based chimeric proteins | |
| US20200071378A1 (en) | Vsig8-based chimeric proteins | |
| CN112888711A (zh) | 基于flt3l的嵌合蛋白 | |
| US20240141014A1 (en) | Mutant pd-1 extracellular domains | |
| US20240299492A1 (en) | Combination therapies with sirp alpha-based chimeric proteins | |
| WO2022187583A1 (en) | Combination therapies with tim-3-based chimeric proteins | |
| BR112021003683A2 (pt) | terapias de combinação | |
| US20230048633A1 (en) | Tgfbr2-based chimeric proteins | |
| US20210179689A1 (en) | Combination therapies comprising tim-3-based chimeric proteins | |
| HK40019689A (en) | Vsig8-based chimeric proteins | |
| HK40019689B (en) | Vsig8-based chimeric proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: SHATTUCK LABS, INC., TEXAS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:SCHREIBER, TAYLOR;SHUPTRINE, CASEY;FROMM, GEORGE;AND OTHERS;SIGNING DATES FROM 20200716 TO 20200720;REEL/FRAME:053742/0332 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |