US20200353091A1 - Elp fusion proteins for controlled and sustained release - Google Patents
Elp fusion proteins for controlled and sustained release Download PDFInfo
- Publication number
- US20200353091A1 US20200353091A1 US16/939,624 US202016939624A US2020353091A1 US 20200353091 A1 US20200353091 A1 US 20200353091A1 US 202016939624 A US202016939624 A US 202016939624A US 2020353091 A1 US2020353091 A1 US 2020353091A1
- Authority
- US
- United States
- Prior art keywords
- elp
- formulation
- seq
- glp
- pharmaceutical formulation
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000013268 sustained release Methods 0.000 title claims abstract description 29
- 239000012730 sustained-release form Substances 0.000 title claims abstract description 29
- 108020001507 fusion proteins Proteins 0.000 title description 21
- 102000037865 fusion proteins Human genes 0.000 title description 21
- 238000013270 controlled release Methods 0.000 title 1
- 239000000203 mixture Substances 0.000 claims abstract description 104
- 238000009472 formulation Methods 0.000 claims abstract description 97
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 74
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 56
- 238000000034 method Methods 0.000 claims abstract description 37
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims description 136
- 150000001413 amino acids Chemical group 0.000 claims description 91
- 102000004877 Insulin Human genes 0.000 claims description 68
- 108090001061 Insulin Proteins 0.000 claims description 68
- 229940125396 insulin Drugs 0.000 claims description 62
- 108090000623 proteins and genes Proteins 0.000 claims description 50
- 239000003814 drug Substances 0.000 claims description 49
- 102000004169 proteins and genes Human genes 0.000 claims description 49
- 239000013543 active substance Substances 0.000 claims description 48
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 46
- 229940124597 therapeutic agent Drugs 0.000 claims description 43
- 229940089838 Glucagon-like peptide 1 receptor agonist Drugs 0.000 claims description 42
- 239000003877 glucagon like peptide 1 receptor agonist Substances 0.000 claims description 40
- 239000011159 matrix material Substances 0.000 claims description 32
- 108010011459 Exenatide Proteins 0.000 claims description 29
- 229960001519 exenatide Drugs 0.000 claims description 28
- JUFFVKRROAPVBI-PVOYSMBESA-N chembl1210015 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N[C@H]1[C@@H]([C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO[C@]3(O[C@@H](C[C@H](O)[C@H](O)CO)[C@H](NC(C)=O)[C@@H](O)C3)C(O)=O)O2)O)[C@@H](CO)O1)NC(C)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 JUFFVKRROAPVBI-PVOYSMBESA-N 0.000 claims description 27
- 238000002347 injection Methods 0.000 claims description 26
- 239000007924 injection Substances 0.000 claims description 26
- 235000002639 sodium chloride Nutrition 0.000 claims description 26
- 239000011780 sodium chloride Substances 0.000 claims description 22
- 230000036760 body temperature Effects 0.000 claims description 19
- 238000010521 absorption reaction Methods 0.000 claims description 17
- 241000282414 Homo sapiens Species 0.000 claims description 16
- 230000015572 biosynthetic process Effects 0.000 claims description 16
- -1 democolcine Chemical compound 0.000 claims description 13
- 230000002441 reversible effect Effects 0.000 claims description 11
- 102100038286 Vasoactive intestinal polypeptide receptor 2 Human genes 0.000 claims description 10
- 101000666868 Homo sapiens Vasoactive intestinal polypeptide receptor 2 Proteins 0.000 claims description 9
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 9
- 238000003860 storage Methods 0.000 claims description 9
- 229920001213 Polysorbate 20 Polymers 0.000 claims description 8
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 claims description 8
- 229910000397 disodium phosphate Inorganic materials 0.000 claims description 8
- 235000019800 disodium phosphate Nutrition 0.000 claims description 8
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 claims description 8
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 claims description 8
- 229940068977 polysorbate 20 Drugs 0.000 claims description 8
- 239000001488 sodium phosphate Substances 0.000 claims description 8
- 229910000162 sodium phosphate Inorganic materials 0.000 claims description 8
- 235000011008 sodium phosphates Nutrition 0.000 claims description 8
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 claims description 8
- 239000000556 agonist Substances 0.000 claims description 7
- 229940044601 receptor agonist Drugs 0.000 claims description 7
- 239000000018 receptor agonist Substances 0.000 claims description 7
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 claims description 7
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 claims description 6
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 claims description 6
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 claims description 6
- 108010036598 gastric inhibitory polypeptide receptor Proteins 0.000 claims description 6
- 239000000126 substance Substances 0.000 claims description 5
- 230000003442 weekly effect Effects 0.000 claims description 5
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 claims description 4
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 claims description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 claims description 4
- 229940123232 Glucagon receptor agonist Drugs 0.000 claims description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 claims description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 claims description 4
- 239000002246 antineoplastic agent Substances 0.000 claims description 4
- 229940127089 cytotoxic agent Drugs 0.000 claims description 4
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 claims description 4
- 229960004857 mitomycin Drugs 0.000 claims description 4
- 230000001575 pathological effect Effects 0.000 claims description 4
- 238000007910 systemic administration Methods 0.000 claims description 4
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 claims description 3
- 239000001110 calcium chloride Substances 0.000 claims description 3
- 229910001628 calcium chloride Inorganic materials 0.000 claims description 3
- 235000011148 calcium chloride Nutrition 0.000 claims description 3
- 229910001629 magnesium chloride Inorganic materials 0.000 claims description 3
- 235000011147 magnesium chloride Nutrition 0.000 claims description 3
- 239000001103 potassium chloride Substances 0.000 claims description 3
- 235000011164 potassium chloride Nutrition 0.000 claims description 3
- SGTNSNPWRIOYBX-UHFFFAOYSA-N 2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile Chemical compound C1=C(OC)C(OC)=CC=C1CCN(C)CCCC(C#N)(C(C)C)C1=CC=C(OC)C(OC)=C1 SGTNSNPWRIOYBX-UHFFFAOYSA-N 0.000 claims description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 claims description 2
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 claims description 2
- 108010006654 Bleomycin Proteins 0.000 claims description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 claims description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 claims description 2
- 108010092160 Dactinomycin Proteins 0.000 claims description 2
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 claims description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 claims description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 claims description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 claims description 2
- 229930192392 Mitomycin Natural products 0.000 claims description 2
- 229930012538 Paclitaxel Natural products 0.000 claims description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 claims description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 claims description 2
- 229960003896 aminopterin Drugs 0.000 claims description 2
- 229960001561 bleomycin Drugs 0.000 claims description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 claims description 2
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 claims description 2
- 229940127093 camptothecin Drugs 0.000 claims description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 claims description 2
- 229960004630 chlorambucil Drugs 0.000 claims description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 claims description 2
- 229960004316 cisplatin Drugs 0.000 claims description 2
- 229960004397 cyclophosphamide Drugs 0.000 claims description 2
- 229960000684 cytarabine Drugs 0.000 claims description 2
- 229960000640 dactinomycin Drugs 0.000 claims description 2
- 229960000975 daunorubicin Drugs 0.000 claims description 2
- 230000007423 decrease Effects 0.000 claims description 2
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 claims description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 claims description 2
- 229960004679 doxorubicin Drugs 0.000 claims description 2
- 229960001904 epirubicin Drugs 0.000 claims description 2
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 claims description 2
- 229960005420 etoposide Drugs 0.000 claims description 2
- 229960002949 fluorouracil Drugs 0.000 claims description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 claims description 2
- 229960001924 melphalan Drugs 0.000 claims description 2
- 229960000485 methotrexate Drugs 0.000 claims description 2
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 claims description 2
- 229910000402 monopotassium phosphate Inorganic materials 0.000 claims description 2
- 235000019796 monopotassium phosphate Nutrition 0.000 claims description 2
- 229960001592 paclitaxel Drugs 0.000 claims description 2
- 229960003171 plicamycin Drugs 0.000 claims description 2
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 claims description 2
- 229960001603 tamoxifen Drugs 0.000 claims description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 claims description 2
- 229960001722 verapamil Drugs 0.000 claims description 2
- 229960003048 vinblastine Drugs 0.000 claims description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 claims description 2
- 229960004528 vincristine Drugs 0.000 claims description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 claims description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 claims description 2
- 241000024188 Andala Species 0.000 claims 1
- 230000001976 improved effect Effects 0.000 abstract description 12
- 229940126586 small molecule drug Drugs 0.000 abstract description 6
- 238000011269 treatment regimen Methods 0.000 abstract description 4
- 235000001014 amino acid Nutrition 0.000 description 96
- 229940024606 amino acid Drugs 0.000 description 93
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 80
- 125000003275 alpha amino acid group Chemical group 0.000 description 78
- VBUWHHLIZKOSMS-RIWXPGAOSA-N invicorp Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 VBUWHHLIZKOSMS-RIWXPGAOSA-N 0.000 description 76
- 102100040918 Pro-glucagon Human genes 0.000 description 73
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 description 64
- 108010003205 Vasoactive Intestinal Peptide Proteins 0.000 description 58
- 102000055135 Vasoactive Intestinal Peptide Human genes 0.000 description 57
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 52
- 230000007704 transition Effects 0.000 description 46
- 235000018102 proteins Nutrition 0.000 description 44
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 32
- 239000013612 plasmid Substances 0.000 description 32
- 125000000539 amino acid group Chemical group 0.000 description 29
- 239000003795 chemical substances by application Substances 0.000 description 29
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 27
- 239000008103 glucose Substances 0.000 description 27
- 102100039246 Elongator complex protein 1 Human genes 0.000 description 24
- 101710167754 Elongator complex protein 1 Proteins 0.000 description 24
- 108010000521 Human Growth Hormone Proteins 0.000 description 23
- 239000000306 component Substances 0.000 description 23
- 102000002265 Human Growth Hormone Human genes 0.000 description 22
- 206010012601 diabetes mellitus Diseases 0.000 description 22
- 230000000694 effects Effects 0.000 description 22
- 210000001783 ELP Anatomy 0.000 description 21
- 239000000854 Human Growth Hormone Substances 0.000 description 21
- 229920000642 polymer Polymers 0.000 description 21
- 210000004027 cell Anatomy 0.000 description 20
- 102000004196 processed proteins & peptides Human genes 0.000 description 20
- 239000013598 vector Substances 0.000 description 20
- 108090001081 Dipeptidases Proteins 0.000 description 19
- 102000004860 Dipeptidases Human genes 0.000 description 19
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 19
- 229930182817 methionine Natural products 0.000 description 18
- 235000006109 methionine Nutrition 0.000 description 18
- 229960002885 histidine Drugs 0.000 description 17
- 230000001225 therapeutic effect Effects 0.000 description 17
- 108010051696 Growth Hormone Proteins 0.000 description 16
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 16
- 230000027455 binding Effects 0.000 description 16
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 16
- 235000014304 histidine Nutrition 0.000 description 16
- 125000005647 linker group Chemical group 0.000 description 15
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 14
- 229920001222 biopolymer Polymers 0.000 description 14
- 229920001184 polypeptide Polymers 0.000 description 14
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 14
- 239000004474 valine Substances 0.000 description 14
- 238000006467 substitution reaction Methods 0.000 description 13
- 241000282693 Cercopithecidae Species 0.000 description 12
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 12
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 12
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 12
- 230000002209 hydrophobic effect Effects 0.000 description 12
- 239000004471 Glycine Substances 0.000 description 11
- 108010058003 Proglucagon Proteins 0.000 description 11
- 230000009471 action Effects 0.000 description 11
- 229910052739 hydrogen Inorganic materials 0.000 description 11
- 239000001257 hydrogen Substances 0.000 description 11
- PBGKTOXHQIOBKM-FHFVDXKLSA-N insulin (human) Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 PBGKTOXHQIOBKM-FHFVDXKLSA-N 0.000 description 11
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 11
- 108010086246 Glucagon-Like Peptide-1 Receptor Proteins 0.000 description 10
- 101000976075 Homo sapiens Insulin Proteins 0.000 description 10
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 10
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 10
- 102000035195 Peptidases Human genes 0.000 description 10
- 108091005804 Peptidases Proteins 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 239000004026 insulin derivative Substances 0.000 description 10
- 102000005962 receptors Human genes 0.000 description 10
- 108020003175 receptors Proteins 0.000 description 10
- 238000011282 treatment Methods 0.000 description 10
- 108010079245 Cystic Fibrosis Transmembrane Conductance Regulator Proteins 0.000 description 9
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 9
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 9
- 239000004472 Lysine Substances 0.000 description 9
- 230000037396 body weight Effects 0.000 description 9
- 239000012634 fragment Substances 0.000 description 9
- 230000004927 fusion Effects 0.000 description 9
- 235000018977 lysine Nutrition 0.000 description 9
- 230000002035 prolonged effect Effects 0.000 description 9
- 102000012605 Cystic Fibrosis Transmembrane Conductance Regulator Human genes 0.000 description 8
- 102000051325 Glucagon Human genes 0.000 description 8
- 108060003199 Glucagon Proteins 0.000 description 8
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 230000004087 circulation Effects 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 238000012217 deletion Methods 0.000 description 8
- 230000037430 deletion Effects 0.000 description 8
- 230000029087 digestion Effects 0.000 description 8
- MASNOZXLGMXCHN-ZLPAWPGGSA-N glucagon Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 MASNOZXLGMXCHN-ZLPAWPGGSA-N 0.000 description 8
- 229960004666 glucagon Drugs 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- 108091008146 restriction endonucleases Proteins 0.000 description 8
- 230000028327 secretion Effects 0.000 description 8
- 238000007920 subcutaneous administration Methods 0.000 description 8
- 102000009027 Albumins Human genes 0.000 description 7
- 108010088751 Albumins Proteins 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 7
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 7
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 7
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 7
- XVVOERDUTLJJHN-UHFFFAOYSA-N Lixisenatide Chemical compound C=1NC2=CC=CC=C2C=1CC(C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(=O)NCC(=O)NCC(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N1C(CCC1)C(=O)N1C(CCC1)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)CC)NC(=O)C(NC(=O)C(CC(C)C)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCC(O)=O)NC(=O)C(CCSC)NC(=O)C(CCC(N)=O)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(O)=O)NC(=O)C(CO)NC(=O)C(NC(=O)C(CC=1C=CC=CC=1)NC(=O)C(NC(=O)CNC(=O)C(CCC(O)=O)NC(=O)CNC(=O)C(N)CC=1NC=NC=1)C(C)O)C(C)O)C(C)C)CC1=CC=CC=C1 XVVOERDUTLJJHN-UHFFFAOYSA-N 0.000 description 7
- 102000035554 Proglucagon Human genes 0.000 description 7
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 7
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 7
- 102100038388 Vasoactive intestinal polypeptide receptor 1 Human genes 0.000 description 7
- 101710137655 Vasoactive intestinal polypeptide receptor 1 Proteins 0.000 description 7
- 235000004279 alanine Nutrition 0.000 description 7
- 208000035475 disorder Diseases 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 239000000122 growth hormone Substances 0.000 description 7
- 238000003780 insertion Methods 0.000 description 7
- 230000037431 insertion Effects 0.000 description 7
- 108010004367 lixisenatide Proteins 0.000 description 7
- 230000036470 plasma concentration Effects 0.000 description 7
- 230000002829 reductive effect Effects 0.000 description 7
- 238000010254 subcutaneous injection Methods 0.000 description 7
- 239000007929 subcutaneous injection Substances 0.000 description 7
- 239000000758 substrate Substances 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 6
- 108010004460 Gastric Inhibitory Polypeptide Proteins 0.000 description 6
- 102100032882 Glucagon-like peptide 1 receptor Human genes 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 102000018997 Growth Hormone Human genes 0.000 description 6
- 108010057186 Insulin Glargine Proteins 0.000 description 6
- COCFEDIXXNGUNL-RFKWWTKHSA-N Insulin glargine Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3NC=NC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(=O)NCC(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 COCFEDIXXNGUNL-RFKWWTKHSA-N 0.000 description 6
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 6
- 108010019598 Liraglutide Proteins 0.000 description 6
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- 235000009697 arginine Nutrition 0.000 description 6
- 230000008859 change Effects 0.000 description 6
- 230000003914 insulin secretion Effects 0.000 description 6
- 229960002701 liraglutide Drugs 0.000 description 6
- 230000004048 modification Effects 0.000 description 6
- 238000012986 modification Methods 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- WRGVLTAWMNZWGT-VQSPYGJZSA-N taspoglutide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NC(C)(C)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 WRGVLTAWMNZWGT-VQSPYGJZSA-N 0.000 description 6
- 229950007151 taspoglutide Drugs 0.000 description 6
- 235000008521 threonine Nutrition 0.000 description 6
- 239000004475 Arginine Substances 0.000 description 5
- 101100501274 Caenorhabditis elegans elp-1 gene Proteins 0.000 description 5
- 108091006905 Human Serum Albumin Proteins 0.000 description 5
- 102000008100 Human Serum Albumin Human genes 0.000 description 5
- 102000003746 Insulin Receptor Human genes 0.000 description 5
- 108010001127 Insulin Receptor Proteins 0.000 description 5
- FYZPCMFQCNBYCY-WIWKJPBBSA-N Insulin degludec Chemical compound CC[C@H](C)[C@H](NC(=O)CN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H]1CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CSSC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc3c[nH]cn3)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc3ccccc3)C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](Cc3c[nH]cn3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc3ccc(O)cc3)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](Cc3ccc(O)cc3)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc3ccc(O)cc3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC2=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](Cc2ccccc2)C(=O)N[C@@H](Cc2ccc(O)cc2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC(O)=O)C(O)=O)C(O)=O)NC1=O)[C@@H](C)O)[C@@H](C)CC FYZPCMFQCNBYCY-WIWKJPBBSA-N 0.000 description 5
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 5
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 5
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 5
- 208000008589 Obesity Diseases 0.000 description 5
- 108010076181 Proinsulin Proteins 0.000 description 5
- 239000004365 Protease Substances 0.000 description 5
- 102100037790 VIP peptides Human genes 0.000 description 5
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 5
- 238000007385 chemical modification Methods 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 230000002641 glycemic effect Effects 0.000 description 5
- 229960002869 insulin glargine Drugs 0.000 description 5
- UGOZVNFCFYTPAZ-IOXYNQHNSA-N levemir Chemical compound CCCCCCCCCCCCCC(=O)NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)CNC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H]1NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2N=CNC=2)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=2N=CNC=2)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=2C=CC=CC=2)C(C)C)CSSC[C@@H]2NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(C)C)CSSC[C@H](NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC2=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H](CSSC1)C(=O)N[C@@H](CC(N)=O)C(O)=O)CC1=CC=C(O)C=C1 UGOZVNFCFYTPAZ-IOXYNQHNSA-N 0.000 description 5
- 229960001093 lixisenatide Drugs 0.000 description 5
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 210000004379 membrane Anatomy 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 235000020824 obesity Nutrition 0.000 description 5
- 230000000291 postprandial effect Effects 0.000 description 5
- 235000019833 protease Nutrition 0.000 description 5
- 230000002459 sustained effect Effects 0.000 description 5
- 125000002987 valine group Chemical group [H]N([H])C([H])(C(*)=O)C([H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 5
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- 108010075254 C-Peptide Proteins 0.000 description 4
- 108010055448 CJC 1131 Proteins 0.000 description 4
- 108010063919 Glucagon Receptors Proteins 0.000 description 4
- 102100040890 Glucagon receptor Human genes 0.000 description 4
- 108010089308 Insulin Detemir Proteins 0.000 description 4
- 108010065920 Insulin Lispro Proteins 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical group OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- 108010092217 Long-Acting Insulin Proteins 0.000 description 4
- 102000016261 Long-Acting Insulin Human genes 0.000 description 4
- 229940100066 Long-acting insulin Drugs 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- 101710128740 VIP peptides Proteins 0.000 description 4
- RCHHVVGSTHAVPF-ZPHPLDECSA-N apidra Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H]1CSSC[C@H]2C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=3C=CC(O)=CC=3)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3C=CC(O)=CC=3)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=3N=CNC=3)NC(=O)[C@H](CO)NC(=O)CNC1=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O)=O)CSSC[C@@H](C(N2)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CNC=N1 RCHHVVGSTHAVPF-ZPHPLDECSA-N 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 229960001230 asparagine Drugs 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- AIWAEWBZDJARBJ-PXUUZXDZSA-N fz7co35x2s Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCNC(=O)COCCOCCNC(=O)CCN1C(C=CC1=O)=O)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 AIWAEWBZDJARBJ-PXUUZXDZSA-N 0.000 description 4
- WNRQPCUGRUFHED-DETKDSODSA-N humalog Chemical compound C([C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(O)=O)C1=CC=C(O)C=C1.C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 WNRQPCUGRUFHED-DETKDSODSA-N 0.000 description 4
- 125000001165 hydrophobic group Chemical group 0.000 description 4
- 230000002218 hypoglycaemic effect Effects 0.000 description 4
- 108010050259 insulin degludec Proteins 0.000 description 4
- 229960004225 insulin degludec Drugs 0.000 description 4
- 229960003948 insulin detemir Drugs 0.000 description 4
- 108700039926 insulin glulisine Proteins 0.000 description 4
- 229960000310 isoleucine Drugs 0.000 description 4
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 230000007935 neutral effect Effects 0.000 description 4
- 210000000496 pancreas Anatomy 0.000 description 4
- 230000002093 peripheral effect Effects 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Chemical group OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- 238000012545 processing Methods 0.000 description 4
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 4
- 235000019419 proteases Nutrition 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000006722 reduction reaction Methods 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 150000003839 salts Chemical class 0.000 description 4
- 235000004400 serine Nutrition 0.000 description 4
- 125000001424 substituent group Chemical group 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- LFTRJWKKLPVMNE-RCBQFDQVSA-N 2-[[(2s)-2-[[2-[[(2s)-1-[(2s)-2-amino-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-3-methylbutanoyl]amino]acetic acid Chemical compound CC(C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O LFTRJWKKLPVMNE-RCBQFDQVSA-N 0.000 description 3
- 108010028091 Albulin Proteins 0.000 description 3
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 3
- 201000003883 Cystic fibrosis Diseases 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- 102000016942 Elastin Human genes 0.000 description 3
- 108010014258 Elastin Proteins 0.000 description 3
- 102100035090 Elongator complex protein 4 Human genes 0.000 description 3
- 101710167759 Elongator complex protein 4 Proteins 0.000 description 3
- 241000282326 Felis catus Species 0.000 description 3
- 108010088406 Glucagon-Like Peptides Proteins 0.000 description 3
- 101800004266 Glucagon-like peptide 1(7-37) Proteins 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 241000270431 Heloderma suspectum Species 0.000 description 3
- 101500027956 Homo sapiens Vasoactive intestinal peptide Proteins 0.000 description 3
- 208000013016 Hypoglycemia Diseases 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 101710181812 Methionine aminopeptidase Proteins 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 102400000319 Oxyntomodulin Human genes 0.000 description 3
- 101800001388 Oxyntomodulin Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 230000003111 delayed effect Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 230000009977 dual effect Effects 0.000 description 3
- 150000004665 fatty acids Chemical class 0.000 description 3
- 230000004190 glucose uptake Effects 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000004554 glutamine Nutrition 0.000 description 3
- 125000000267 glycino group Chemical group [H]N([*])C([H])([H])C(=O)O[H] 0.000 description 3
- 201000001421 hyperglycemia Diseases 0.000 description 3
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 description 3
- 239000000859 incretin Substances 0.000 description 3
- 229960004717 insulin aspart Drugs 0.000 description 3
- 229960000696 insulin glulisine Drugs 0.000 description 3
- 229960002068 insulin lispro Drugs 0.000 description 3
- 230000003993 interaction Effects 0.000 description 3
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- XZWYZXLIPXDOLR-UHFFFAOYSA-N metformin Chemical compound CN(C)C(=N)NC(N)=N XZWYZXLIPXDOLR-UHFFFAOYSA-N 0.000 description 3
- 229960003105 metformin Drugs 0.000 description 3
- PXZWGQLGAKCNKD-DPNMSELWSA-N molport-023-276-326 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)O)C(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 PXZWGQLGAKCNKD-DPNMSELWSA-N 0.000 description 3
- VOMXSOIBEJBQNF-UTTRGDHVSA-N novorapid Chemical compound C([C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(O)=O)C1=CC=C(O)C=C1.C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O)C(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C=CC=CC=1)C(C)C)C1=CN=CN1 VOMXSOIBEJBQNF-UTTRGDHVSA-N 0.000 description 3
- 230000006320 pegylation Effects 0.000 description 3
- 239000000902 placebo Substances 0.000 description 3
- 229940068196 placebo Drugs 0.000 description 3
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 3
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 3
- 229920000053 polysorbate 80 Polymers 0.000 description 3
- 229940068968 polysorbate 80 Drugs 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- GCYXWQUSHADNBF-AAEALURTSA-N preproglucagon 78-108 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 GCYXWQUSHADNBF-AAEALURTSA-N 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 150000003384 small molecules Chemical class 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 108010048573 taspoglutide Proteins 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 108010054022 valyl-prolyl-glycyl-valyl-glycine Proteins 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 2
- VOUAQYXWVJDEQY-QENPJCQMSA-N 33017-11-7 Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)CCC1 VOUAQYXWVJDEQY-QENPJCQMSA-N 0.000 description 2
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 2
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 2
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 2
- 208000032841 Bulimia Diseases 0.000 description 2
- 102100022641 Coagulation factor IX Human genes 0.000 description 2
- 102100023804 Coagulation factor VII Human genes 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 241000702141 Corynephage beta Species 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 102100036966 Dipeptidyl aminopeptidase-like protein 6 Human genes 0.000 description 2
- 102100029921 Dipeptidyl peptidase 1 Human genes 0.000 description 2
- 101710087078 Dipeptidyl peptidase 1 Proteins 0.000 description 2
- 102100020750 Dipeptidyl peptidase 3 Human genes 0.000 description 2
- 102100036968 Dipeptidyl peptidase 8 Human genes 0.000 description 2
- 102100036969 Dipeptidyl peptidase 9 Human genes 0.000 description 2
- 108090000194 Dipeptidyl-peptidases and tripeptidyl-peptidases Proteins 0.000 description 2
- 102000003779 Dipeptidyl-peptidases and tripeptidyl-peptidases Human genes 0.000 description 2
- 108010076282 Factor IX Proteins 0.000 description 2
- 108010023321 Factor VII Proteins 0.000 description 2
- 108010054218 Factor VIII Proteins 0.000 description 2
- 102000001690 Factor VIII Human genes 0.000 description 2
- 101800000221 Glucagon-like peptide 2 Proteins 0.000 description 2
- 102400000326 Glucagon-like peptide 2 Human genes 0.000 description 2
- 108091016366 Histone-lysine N-methyltransferase EHMT1 Proteins 0.000 description 2
- 101000788682 Homo sapiens GATA-type zinc finger protein 1 Proteins 0.000 description 2
- 101500025354 Homo sapiens Insulin B chain Proteins 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 102100040449 Inactive dipeptidyl peptidase 10 Human genes 0.000 description 2
- 108010073961 Insulin Aspart Proteins 0.000 description 2
- 206010022489 Insulin Resistance Diseases 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- 206010028813 Nausea Diseases 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 108010005991 Pork Regular Insulin Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 206010064911 Pulmonary arterial hypertension Diseases 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229940100389 Sulfonylurea Drugs 0.000 description 2
- 108090000901 Transferrin Proteins 0.000 description 2
- 102000004338 Transferrin Human genes 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- OIPILFWXSMYKGL-UHFFFAOYSA-N acetylcholine Chemical compound CC(=O)OCC[N+](C)(C)C OIPILFWXSMYKGL-UHFFFAOYSA-N 0.000 description 2
- 229960004373 acetylcholine Drugs 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 229940125708 antidiabetic agent Drugs 0.000 description 2
- 239000003472 antidiabetic agent Substances 0.000 description 2
- 229940009098 aspartate Drugs 0.000 description 2
- 235000003704 aspartic acid Nutrition 0.000 description 2
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 2
- 230000008033 biological extinction Effects 0.000 description 2
- 239000003114 blood coagulation factor Substances 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000005354 coacervation Methods 0.000 description 2
- OROGSEYTTFOCAN-DNJOTXNNSA-N codeine Chemical compound C([C@H]1[C@H](N(CC[C@@]112)C)C3)=C[C@H](O)[C@@H]1OC1=C2C3=CC=C1OC OROGSEYTTFOCAN-DNJOTXNNSA-N 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 229960004222 factor ix Drugs 0.000 description 2
- 229940012413 factor vii Drugs 0.000 description 2
- 229960000301 factor viii Drugs 0.000 description 2
- 239000012530 fluid Substances 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 230000030136 gastric emptying Effects 0.000 description 2
- 210000004907 gland Anatomy 0.000 description 2
- 108010063245 glucagon-like peptide 1 (7-36)amide Proteins 0.000 description 2
- TWSALRJGPBVBQU-PKQQPRCHSA-N glucagon-like peptide 2 Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O)[C@@H](C)CC)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=CC=C1 TWSALRJGPBVBQU-PKQQPRCHSA-N 0.000 description 2
- 230000009229 glucose formation Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 230000003345 hyperglycaemic effect Effects 0.000 description 2
- 201000008980 hyperinsulinism Diseases 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 108010033606 insulin dimers Proteins 0.000 description 2
- 230000002473 insulinotropic effect Effects 0.000 description 2
- 210000000936 intestine Anatomy 0.000 description 2
- 244000144972 livestock Species 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- BQJCRHHNABKAKU-KBQPJGBKSA-N morphine Chemical compound O([C@H]1[C@H](C=C[C@H]23)O)C4=C5[C@@]12CCN(C)[C@@H]3CC5=CC=C4O BQJCRHHNABKAKU-KBQPJGBKSA-N 0.000 description 2
- 230000008693 nausea Effects 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000009145 protein modification Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 210000004739 secretory vesicle Anatomy 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 150000005846 sugar alcohols Chemical class 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 239000012581 transferrin Substances 0.000 description 2
- 238000012384 transportation and delivery Methods 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- 239000002435 venom Substances 0.000 description 2
- 210000001048 venom Anatomy 0.000 description 2
- 231100000611 venom Toxicity 0.000 description 2
- KQMBIBBJWXGSEI-ROLXFIACSA-N (2s)-2-amino-3-hydroxy-3-(1h-imidazol-5-yl)propanoic acid Chemical compound OC(=O)[C@@H](N)C(O)C1=CNC=N1 KQMBIBBJWXGSEI-ROLXFIACSA-N 0.000 description 1
- AJFGLTPLWPTALJ-SSDOTTSWSA-N (2s)-2-azaniumyl-2-(fluoromethyl)-3-(1h-imidazol-5-yl)propanoate Chemical compound FC[C@@](N)(C(O)=O)CC1=CN=CN1 AJFGLTPLWPTALJ-SSDOTTSWSA-N 0.000 description 1
- MSECZMWQBBVGEN-LURJTMIESA-N (2s)-2-azaniumyl-4-(1h-imidazol-5-yl)butanoate Chemical compound OC(=O)[C@@H](N)CCC1=CN=CN1 MSECZMWQBBVGEN-LURJTMIESA-N 0.000 description 1
- UYEGXSNFZXWSDV-BYPYZUCNSA-N (2s)-3-(2-amino-1h-imidazol-5-yl)-2-azaniumylpropanoate Chemical compound OC(=O)[C@@H](N)CC1=CNC(N)=N1 UYEGXSNFZXWSDV-BYPYZUCNSA-N 0.000 description 1
- VRYALKFFQXWPIH-PBXRRBTRSA-N (3r,4s,5r)-3,4,5,6-tetrahydroxyhexanal Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)CC=O VRYALKFFQXWPIH-PBXRRBTRSA-N 0.000 description 1
- NGJOFQZEYQGZMB-KTKZVXAJSA-N (4S)-5-[[2-[[(2S,3R)-1-[[(2S)-1-[[(2S,3R)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[2-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-2-oxoethyl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-2-oxoethyl]amino]-4-carboxy-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-carboxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-2-oxoethyl]amino]-4-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-4-yl)propanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 NGJOFQZEYQGZMB-KTKZVXAJSA-N 0.000 description 1
- BDKLKNJTMLIAFE-UHFFFAOYSA-N 2-(3-fluorophenyl)-1,3-oxazole-4-carbaldehyde Chemical compound FC1=CC=CC(C=2OC=C(C=O)N=2)=C1 BDKLKNJTMLIAFE-UHFFFAOYSA-N 0.000 description 1
- HLPBVBAEIVCCLH-USJZOSNVSA-N 2-[[(2s)-2-[[2-[[(2s)-1-[(2s)-2-[[(2s)-2-amino-3-methylbutanoyl]amino]propanoyl]pyrrolidine-2-carbonyl]amino]acetyl]amino]-3-methylbutanoyl]amino]acetic acid Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O HLPBVBAEIVCCLH-USJZOSNVSA-N 0.000 description 1
- 125000001431 2-aminoisobutyric acid group Chemical group [#6]C([#6])(N*)C(*)=O 0.000 description 1
- LJGHYPLBDBRCRZ-UHFFFAOYSA-N 3-(3-aminophenyl)sulfonylaniline Chemical compound NC1=CC=CC(S(=O)(=O)C=2C=C(N)C=CC=2)=C1 LJGHYPLBDBRCRZ-UHFFFAOYSA-N 0.000 description 1
- SWLAMJPTOQZTAE-UHFFFAOYSA-N 4-[2-[(5-chloro-2-methoxybenzoyl)amino]ethyl]benzoic acid Chemical class COC1=CC=C(Cl)C=C1C(=O)NCCC1=CC=C(C(O)=O)C=C1 SWLAMJPTOQZTAE-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- 108700001281 BIM 51077 Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 206010004716 Binge eating Diseases 0.000 description 1
- 238000010599 BrdU assay Methods 0.000 description 1
- 206010006550 Bulimia nervosa Diseases 0.000 description 1
- 101100337060 Caenorhabditis elegans glp-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 208000031229 Cardiomyopathies Diseases 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- 241001543077 Chromis alpha Species 0.000 description 1
- 241001517241 Chromis delta Species 0.000 description 1
- 208000006545 Chronic Obstructive Pulmonary Disease Diseases 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000000454 Congenital Hyperinsulinism Diseases 0.000 description 1
- 244000265913 Crataegus laevigata Species 0.000 description 1
- 241000527994 Cyclotella gamma Species 0.000 description 1
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 description 1
- HNDVDQJCIGZPNO-RXMQYKEDSA-N D-histidine Chemical compound OC(=O)[C@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-RXMQYKEDSA-N 0.000 description 1
- 229930195721 D-histidine Natural products 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108010067722 Dipeptidyl Peptidase 4 Proteins 0.000 description 1
- 102100020751 Dipeptidyl peptidase 2 Human genes 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 101710087005 Dipeptidyl peptidase 9 Proteins 0.000 description 1
- 208000032928 Dyslipidaemia Diseases 0.000 description 1
- 101710167764 Elongator complex protein 2 Chemical group 0.000 description 1
- 102100034241 Elongator complex protein 2 Human genes 0.000 description 1
- 102100035074 Elongator complex protein 3 Human genes 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102100023374 Forkhead box protein M1 Human genes 0.000 description 1
- 101800004295 Glucagon-like peptide 1(7-36) Proteins 0.000 description 1
- 208000002705 Glucose Intolerance Diseases 0.000 description 1
- 229940103526 Growth hormone receptor agonist Drugs 0.000 description 1
- 241000270453 Heloderma horridum Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000804935 Homo sapiens Dipeptidyl aminopeptidase-like protein 6 Proteins 0.000 description 1
- 101000931864 Homo sapiens Dipeptidyl peptidase 2 Proteins 0.000 description 1
- 101000931862 Homo sapiens Dipeptidyl peptidase 3 Proteins 0.000 description 1
- 101000804947 Homo sapiens Dipeptidyl peptidase 8 Proteins 0.000 description 1
- 101000804945 Homo sapiens Dipeptidyl peptidase 9 Proteins 0.000 description 1
- 101000877382 Homo sapiens Elongator complex protein 3 Proteins 0.000 description 1
- 101000907578 Homo sapiens Forkhead box protein M1 Proteins 0.000 description 1
- 101000967820 Homo sapiens Inactive dipeptidyl peptidase 10 Proteins 0.000 description 1
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 1
- 101000805490 Homo sapiens VIP peptides Proteins 0.000 description 1
- 102000038455 IGF Type 1 Receptor Human genes 0.000 description 1
- 108010031794 IGF Type 1 Receptor Proteins 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010021518 Impaired gastric emptying Diseases 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 1
- 102100021496 Insulin-degrading enzyme Human genes 0.000 description 1
- 108090000828 Insulysin Proteins 0.000 description 1
- 229940122254 Intermediate acting insulin Drugs 0.000 description 1
- 102000011782 Keratins Human genes 0.000 description 1
- 108010076876 Keratins Proteins 0.000 description 1
- 208000017170 Lipid metabolism disease Diseases 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 1
- 102000003797 Neuropeptides Human genes 0.000 description 1
- 108090000189 Neuropeptides Proteins 0.000 description 1
- BRUQQQPBMZOVGD-XFKAJCMBSA-N Oxycodone Chemical compound O=C([C@@H]1O2)CC[C@@]3(O)[C@H]4CC5=CC=C(OC)C2=C5[C@@]13CCN4C BRUQQQPBMZOVGD-XFKAJCMBSA-N 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000015731 Peptide Hormones Human genes 0.000 description 1
- 108010038988 Peptide Hormones Proteins 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 102000007327 Protamines Human genes 0.000 description 1
- 108010007568 Protamines Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 101000993800 Sus scrofa Insulin Proteins 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 101710137651 Vasoactive intestinal polypeptide receptor 2 Proteins 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- PTFCDOFLOPIGGS-UHFFFAOYSA-N Zinc dication Chemical compound [Zn+2] PTFCDOFLOPIGGS-UHFFFAOYSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 229960000583 acetic acid Drugs 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 210000001552 airway epithelial cell Anatomy 0.000 description 1
- 210000005091 airway smooth muscle Anatomy 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- PMMURAAUARKVCB-UHFFFAOYSA-N alpha-D-ara-dHexp Natural products OCC1OC(O)CC(O)C1O PMMURAAUARKVCB-UHFFFAOYSA-N 0.000 description 1
- HRRYYCWYCMJNGA-ZETCQYMHSA-N alpha-methyl-L-histidine Chemical group OC(=O)[C@](N)(C)CC1=CN=CN1 HRRYYCWYCMJNGA-ZETCQYMHSA-N 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 239000000883 anti-obesity agent Substances 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 229940030600 antihypertensive agent Drugs 0.000 description 1
- 229940125710 antiobesity agent Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 229940112930 apidra Drugs 0.000 description 1
- 230000036528 appetite Effects 0.000 description 1
- 235000019789 appetite Nutrition 0.000 description 1
- 125000000637 arginyl group Chemical class N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 150000001507 asparagine derivatives Chemical group 0.000 description 1
- 208000014679 binge eating disease Diseases 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 239000012503 blood component Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229940124630 bronchodilator Drugs 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 229940084891 byetta Drugs 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 238000004422 calculation algorithm Methods 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229940105329 carboxymethylcellulose Drugs 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- WDRMVIMVHHWVBI-STCSGHEYSA-N chembl1222074 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)N[C@@H](CC=1NC=NC=1)C(O)=O)[C@@H](C)O)[C@H](C)O)C(C)C)C1=CC=CC=C1 WDRMVIMVHHWVBI-STCSGHEYSA-N 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229960004126 codeine Drugs 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- ZCKYOWGFRHAZIQ-UHFFFAOYSA-N dihydrourocanic acid Chemical compound OC(=O)CCC1=CNC=N1 ZCKYOWGFRHAZIQ-UHFFFAOYSA-N 0.000 description 1
- 230000000447 dimerizing effect Effects 0.000 description 1
- PYLIXCKOHOHGKQ-UHFFFAOYSA-L disodium;hydrogen phosphate;heptahydrate Chemical compound O.O.O.O.O.O.O.[Na+].[Na+].OP([O-])([O-])=O PYLIXCKOHOHGKQ-UHFFFAOYSA-L 0.000 description 1
- 230000010078 dual agonism Effects 0.000 description 1
- 229940125542 dual agonist Drugs 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 210000003158 enteroendocrine cell Anatomy 0.000 description 1
- 230000007515 enzymatic degradation Effects 0.000 description 1
- 210000003499 exocrine gland Anatomy 0.000 description 1
- 230000028023 exocytosis Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 208000033442 familial 1 hyperinsulinemic hypoglycemia Diseases 0.000 description 1
- 208000033961 familial 2 hyperinsulinemic hypoglycemia Diseases 0.000 description 1
- 208000011532 familial hyperinsulinism Diseases 0.000 description 1
- 208000010706 fatty liver disease Diseases 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000012631 food intake Nutrition 0.000 description 1
- 235000021588 free fatty acids Nutrition 0.000 description 1
- 210000001035 gastrointestinal tract Anatomy 0.000 description 1
- 239000012362 glacial acetic acid Substances 0.000 description 1
- UKVFVQPAANCXIL-FJVFSOETSA-N glp-1 (1-37) amide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 UKVFVQPAANCXIL-FJVFSOETSA-N 0.000 description 1
- 101150102822 glp-1 gene Proteins 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 210000002175 goblet cell Anatomy 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229940121366 growth hormone derivative Drugs 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- 229940038661 humalog Drugs 0.000 description 1
- 102000047882 human INSR Human genes 0.000 description 1
- OROGSEYTTFOCAN-UHFFFAOYSA-N hydrocodone Natural products C1C(N(CCC234)C)C2C=CC(O)C3OC2=C4C1=CC=C2OC OROGSEYTTFOCAN-UHFFFAOYSA-N 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 210000003405 ileum Anatomy 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000003999 initiator Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 210000002660 insulin-secreting cell Anatomy 0.000 description 1
- 206010022498 insulinoma Diseases 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229940060975 lantus Drugs 0.000 description 1
- 229940102988 levemir Drugs 0.000 description 1
- 230000029226 lipidation Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 235000012054 meals Nutrition 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 229950004994 meglitinide Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229940100630 metacresol Drugs 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 229960005181 morphine Drugs 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 239000013560 multireceptor agonist Substances 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 210000004897 n-terminal region Anatomy 0.000 description 1
- 230000003880 negative regulation of appetite Effects 0.000 description 1
- 210000004126 nerve fiber Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000000422 nocturnal effect Effects 0.000 description 1
- 229940112879 novolog Drugs 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 229960002085 oxycodone Drugs 0.000 description 1
- 208000021255 pancreatic insulinoma Diseases 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000008289 pathophysiological mechanism Effects 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 201000009104 prediabetes syndrome Diseases 0.000 description 1
- 108010066381 preproinsulin Proteins 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical class [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 229940048914 protamine Drugs 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 238000012887 quadratic function Methods 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000005932 reductive alkylation reaction Methods 0.000 description 1
- 230000002040 relaxant effect Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 208000015658 resistant hypertension Diseases 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000010572 single replacement reaction Methods 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 229940087562 sodium acetate trihydrate Drugs 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- BBMHARZCALWXSL-UHFFFAOYSA-M sodium dihydrogenphosphate monohydrate Chemical compound O.[Na+].OP(O)([O-])=O BBMHARZCALWXSL-UHFFFAOYSA-M 0.000 description 1
- 229960002920 sorbitol Drugs 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000004878 submucosal gland Anatomy 0.000 description 1
- 230000035322 succinylation Effects 0.000 description 1
- 238000010613 succinylation reaction Methods 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000001839 systemic circulation Effects 0.000 description 1
- 238000012385 systemic delivery Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 229940026454 tresiba Drugs 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 239000013559 triple agonist Substances 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 108010003885 valyl-prolyl-glycyl-glycine Proteins 0.000 description 1
- 230000002227 vasoactive effect Effects 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6435—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the peptide or protein in the drug conjugate being a connective tissue peptide, e.g. collagen, fibronectin or gelatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/14—Peptides containing saccharide radicals; Derivatives thereof, e.g. bleomycin, phleomycin, muramylpeptides or vancomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/26—Glucagons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/27—Growth hormone [GH], i.e. somatotropin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/28—Insulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/08—Solutions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/19—Carboxylic acids, e.g. valproic acid
- A61K31/195—Carboxylic acids, e.g. valproic acid having an amino group
- A61K31/196—Carboxylic acids, e.g. valproic acid having an amino group the amino group being directly attached to a ring, e.g. anthranilic acid, mefenamic acid, diclofenac, chlorambucil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/275—Nitriles; Isonitriles
- A61K31/277—Nitriles; Isonitriles having a ring, e.g. verapamil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/335—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
- A61K31/337—Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin having four-membered rings, e.g. taxol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/475—Quinolines; Isoquinolines having an indole ring, e.g. yohimbine, reserpine, strychnine, vinblastine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7028—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages
- A61K31/7034—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin
- A61K31/704—Compounds having saccharide radicals attached to non-saccharide compounds by glycosidic linkages attached to a carbocyclic compound, e.g. phloridzin attached to a condensed carbocyclic ring system, e.g. sennosides, thiocolchicosides, escin, daunorubicin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
Definitions
- the present disclosure relates to pharmaceutical formulations for sustained release, and methods for delivering a treatment regimen with the sustained release formulations.
- peptide and small molecule drugs are often limited by the half-life of such drugs in the circulation, as well as difficulties in obtaining substantially constant plasma levels.
- the incretin GLP-1 must be administered at relatively high doses to counter its short half-life in the circulation, and these high doses are associated with nausea, among other things. Murphy and Bloom, Nonpeptidic glucagon - like peptide 1 receptor agonists: A magic bullet for diabetes? PNAS 104 (3):689-690 (2007).
- the peptide agent vasoactive intestinal peptide (VIP) exhibits a half-life, in some estimates, of less than one minute, making this agent impractical for pharmaceutical use.
- a short plasma half life for peptide drugs is often due to fast renal clearance as well as to enzymatic degradation during systemic circulation.
- the present disclosure provides pharmaceutical formulations for sustained release, and methods for delivering a treatment regimen with the sustained release formulations.
- the disclosure thereby provides improved pharmacokinetics for peptide and small molecule drugs.
- the disclosure provides a sustained release pharmaceutical formulation.
- the formulation includes a therapeutic agent for systemic administration, where the therapeutic agent includes an active agent and an amino acid sequence capable of forming a reversible matrix at the body temperature of a subject.
- the reversible matrix is formed from hydrogen bonds (e.g., intra- and/or intermolecular hydrogen bonds) as well as from hydrophobic contributions.
- the formulation further includes one or more pharmaceutically acceptable excipients and/or diluents.
- the matrix provides for a slow absorption to the circulation from an injection site.
- the sustained release, or slow absorption from the injection site is due to a slow reversal of the matrix as the concentration dissipates at the injection site.
- the formulation confers long half-life and improved stability.
- a unique combination of slow absorption and long half-life is achieved leading to a desirable PK profile with a shallow peak to trough ratio and/or long Tmax.
- the amino acid sequence capable of forming a reversible matrix at the body temperature of a subject is an Elastin-Like-Protein (ELP) sequence.
- ELP sequence includes or consists of structural peptide units or sequences that are related to, or mimics of, the elastin protein.
- the ELP amino acid sequence may exhibit a visible and reversible inverse phase transition with the selected formulation. That is, the amino acid sequence may be structurally disordered and highly soluble in the formulation below a transition temperature (Tt), but exhibit a sharp (2-3° C. range) disorder-to-order phase transition when the temperature of the formulation is raised above the Tt.
- Tt transition temperature
- the present disclosure provides therapeutic agents having transition temperatures between about 26° C.
- ELP polymer length of the ELP polymer, amino acid composition of the ELP, ionic strength, pH, pressure, selected solvents, presence of organic solutes, and protein concentration may also affect the transition properties, and these may be tailored for the desired absorption profile.
- protein concentration and salt concentration affect the transition properties (e.g. transition temperature).
- Exemplary sequences or structures for the ELP amino acid sequence forming the matrix are disclosed herein.
- the active agent for systemic administration is a protein or peptide, which may have a short circulatory half-life, such as from about 30 seconds to about 1 hour, to about 2 hours, or to about 5 hours. In some embodiments, the protein or peptide has a circulatory half-life of from 30 seconds to about 10 hours.
- the therapeutic agent may be a recombinant fusion protein between the protein active agent and the amino acid sequence capable of forming the matrix.
- Exemplary peptide active agents include GLP-1 receptor agonists (e.g., GLP-1 or derivative thereof), exendin-4 or derivatives thereof, glucagon receptor agonists (e.g.
- VPAC2 selective agonists e.g. vasoactive intestinal peptide (VIP) or derivatives thereof
- GIP receptor agonists e.g. glucose-dependent insulinotropic peptide (GIP) or derivatives thereof
- insulin or derivatives thereof e.g., a clotting factor, such as Factor VII, Factor VIII, or Factor IX, or a growth hormone receptor agonist (e.g., human growth hormone (hGH), or functional derivatives thereof).
- a clotting factor such as Factor VII, Factor VIII, or Factor IX
- hGH human growth hormone
- Peptide active agents include sequences that activate more than one receptor, for instance dual agonists of GLP-1 and glucagon receptors, dual agonists of GLP-1 and GIP receptors, or triple agonists able to activate GLP-1, GIP and glucagon receptors.
- Other protein and small molecule drugs for delivery in accordance with the disclosure are disclosed herein.
- the disclosure provides methods for delivering a sustained release regimen of an active agent.
- the methods include administering the formulation described herein to a subject in need, wherein the formulation is administered from about 1 to about 8 times per month.
- the formulation is administered about weekly, and may be administered subcutaneously or intramuscularly (for example).
- the site of administration is not a pathological site, that is, the therapeutic agent is not administered directly to the intended site of action.
- FIG. 1 shows the phase transition (as shown by an increase in turbidity) of an ELP1 protein, induced by a change in temperature to 37° C. or above. This property provides for a slow absorption from an injection site.
- FIG. 2 shows the phase transition (as shown by an increase in turbidity) of an ELP4 protein, induced by a change in temperature to 25° C. or above. This property provides for a depot-like delivery.
- FIG. 3 illustrates, without wishing to be bound by theory, a potential mechanism for the observed transition, in which a water shell is excluded under certain conditions, allowing for hydrogen bonds to form.
- FIG. 4 shows the amino acid alignment of ELP 9mers (alpha, beta V1, betaV2, and delta).
- each ELP unit consists of nine copies of the VPGXG SEQ ID NO: 3) ELP pentamer motif, or the XPGVG (SEQ ID NO: 13) ELP pentamer motif with three guest residue amino acids in different ratios.
- FIG. 5 shows a recursive ligation strategy used to make ELP polymers.
- the ELP pentamer polymer insert can continually be doubled in size using recursive ligation.
- the PflMI and BglI sites have homologous overhangs but when ligated the PflMI site is destroyed. This allows the newly constructed ELP to be doubled again using the same digestion strategy.
- FIG. 6 shows the pPE0248 plasmid map.
- FIG. 7 shows the pPE0248 linker.
- This linker allows the insertion of a VPGXG (SEQ ID NO:3) repeat polymer in frame of an initiator methionine and two stop codons for expression and termination using the unique Bgl I restriction enzyme site. N-terminal fusions can be subsequently added using the unique Xba I and Acc65i sites.
- FIG. 8 shows the amino acid sequence of the ELP alpha 144mer biopolymer.
- FIG. 9 shows the pPE0249 plasmid map.
- FIG. 10 shows the amino acid sequence of the ELP beta v1 144mer biopolymer.
- FIG. 11 shows the pPE0250 plasmid map.
- FIG. 12 shows the amino acid sequence of the ELP beta v2 144mer biopolymer.
- FIG. 13 shows the pPE0362 plasmid map.
- FIG. 14 shows the amino acid sequence of the ELP gamma 144mer biopolymer.
- FIG. 15 shows the pPE0251 plasmid map.
- FIG. 16 shows the amino acid sequence of the ELP delta 144mer biopolymer.
- FIG. 17 shows the pPE0252 plasmid map.
- FIG. 18 shows the raw Cary turbidity data of the different ELP biopolymers after administration at 10 mg/mL.
- FIG. 19 shows the PK results from non-na ⁇ ve monkeys, 1 male and 1 female per group, each dosed with a single subcutaneous injection of 20 mg/kg of either PE0253 (alpha), PE0254 (beta v1), PE0255 (gamma), or PE0256 (delta).
- FIGS. 20A and B show the PK results of a single subcutaneous dose of PE0256 (delta) at 10 mg/kg into four protein na ⁇ ve monkeys, 2 male and 2 female.
- Figure A shows the data from the individual animals while Figure B shows the mean.
- FIGS. 21A and B show the PK results of a single subcutaneous dose of PE0311 (beta v2) at 10 mg/kg into three protein na ⁇ ve monkeys, all male.
- Figure A shows the data from the individual animals while Figure B shows the mean.
- FIG. 22 shows the PK results of non-na ⁇ ve monkeys dosed with a single IV injection of PE0256 (delta) at 2 mg/kg.
- FIG. 23 shows a plasmid map of the vector pPE0429, which contains an hGH sequence inserted into plasmid pPE0362.
- the synthesized hGH sequence was digested with restriction enzymes PflMI/Bgl I and sub cloned into the Bgl I site in plasmid pPE0362.
- FIG. 24 shows an amino acid sequence for an ELPbetaV2-144-hGH fusion protein (SEQ ID NO:14).
- the hGH (underlined) is fused to the ELP beta v2-144 sequence (bold).
- a single ELP pentamer (italics) remains on the C-terminus and conserves a Bgl I restriction site. The site may be used for further cloning steps.
- FIG. 25 shows a plasmid map of the vector pPE0431, which contains an ELP1 series 30mer sequence inserted into plasmid pPE0429, which places the ELP1 series 120mer at the N-terminus of the hGH sequence.
- FIG. 26 shows the amino acid sequence of the ELP1-120mer hGH fusion protein (SEQ ID NO:15).
- the hGH sequence (underlined) is fused to the ELP 1 series 120mer sequence (bold).
- FIG. 27 shows a plasmid map of the vector pPE0430, which contains an ELP1 series 30mer sequence inserted into plasmid pPE0429, which places the ELP1 series 30mer at the C-terminus of the ELPbetaV2-144-hGH sequence. Adding the ELP1 series 30mer disrupts receptor mediated clearance and thus further increases circulatory half-life of the ELPbetaV2-144 hGH fusion protein.
- FIG. 28 shows an amino acid sequence for an ELPbetaV2-144-hGH fusion protein with an ELP1 series 30mer (SEQ ID NO:16).
- the hGH (underlined) is fused to the ELP beta v2-144 sequence (bold).
- the ELP1 series 30mer (italics) is at the C-terminus of the ELPbetaV2-144-hGH sequence.
- FIG. 29 shows a plasmid map of the vector pPE0432, which contains an ELP1 series 30mer sequence inserted into plasmid pPE0431, which places the ELP1 series 30mer at the C-terminus of the ELP1-120-hGH sequence. Adding the ELP1 series 30mer disrupts receptor mediated clearance and thus further increases circulatory half-life of the ELP1 series hGH fusion protein.
- FIG. 30 shows the amino acid sequence of the ELP1-120 hGH fusion protein with an ELP1-30mer on the C-terminus (SEQ ID NO:17).
- the hGH sequence (underlined) is fused to the ELP 1 series 120mer sequence (bold) and the ELP1-30 sequence (italics).
- FIG. 31 shows a plasmid map of the vector pPE0364, which contains a beta v2 series 144mer sequence.
- the synthesized exendin-4 sequence was digested with restriction enzymes XbaI/BsrGI and sub cloned into the plasmid pPE0362 digested XbaI/Acc65i.
- FIG. 32 shows the amino acid sequence of the exendin-4 ELPbeta V2 fusion protein with an ELPbeta V2-144mer on the C-terminus (SEQ ID NO:18).
- the exendin-4 sequence (underlined) is fused to the ELPbeta V2-144mer sequence.
- the present disclosure provides pharmaceutical formulations for sustained release, and methods for delivering a treatment regimen with the sustained release formulations.
- the pharmaceutical compositions disclosed herein have enhanced efficacy, bioavailability, therapeutic half-life, persistence, degradation assistance, etc.
- the disclosure thereby provides improved pharmacokinetics for active agents, such as peptides and small molecule drugs, including a relatively flat PK profile with a low ratio of peak to trough, and/or a long Tmax.
- the PK profile can be maintained with a relatively infrequent administration schedule, such as from one to eight injections per month in some embodiments.
- the disclosure provides sustained release pharmaceutical formulations.
- the formulation includes therapeutic agents for systemic administration, where the therapeutic agent includes an active agent and an amino acid sequence capable of forming a matrix at the body temperature of a subject.
- the reversible matrix is formed from hydrogen bonds (e.g., intra- and/or intermolecular hydrogen bonds) as well as from hydrophobic contributions.
- the formulation further includes one or more pharmaceutically acceptable excipients and/or diluents.
- the matrix provides for a slow absorption to the circulation from an injection site. Without being bound by theory, this slow absorption is due to the slow reversal of the matrix as protein concentration decreases at the injection site.
- the slow absorption profile provides for a flat PK profile, as well as convenient and comfortable administration regimen.
- the plasma concentration of the active agent over the course of days does not change by more than a factor of 10, or by more than a factor of about 5, or by more than a factor of about 3.
- this flat PK profile is seen over a plurality of (substantially evenly spaced) administrations, such as at least about 2, at least about 5, or at least about 10 administrations of the formulation.
- the slow absorption is exhibited by a Tmax (time to maximum plasma concentration) of greater than about 5 hours, greater than about 10 hours, greater than about 20 hours, greater than about 30 hours, or greater than about 50 hours.
- the sustained release, or slow absorption from the injection site is controlled by the amino acid sequence capable of forming a hydrogen-bonded matrix at the body temperature of the subject, as well as the components of the formulation.
- the amino acid sequence contains structural units that form hydrogen-bonds through protein backbone groups and/or side chain groups, and which may contribute hydrophobic interactions to matrix formation.
- the amino acid side chains do not contain hydrogen bond donor groups, with hydrogen bonds being formed substantially through the protein backbone.
- Exemplary amino acids include proline, alanine, valine, glycine, and isoleucine, and similar amino acids.
- the structural units are substantially repeating structural units, so as to create a substantially repeating structural motif, and substantially repeating hydrogen-bonding capability.
- the amino acid sequence contains at least about 10%, at least about 20%, at least about 40%, or at least about 50% proline, which may be positioned in a substantially repeating pattern.
- a substantially repeating pattern means that at least about 50% or at least about 75% of the proline residues of the amino acid sequence are part of a definable structural unit.
- the amino acid sequence contains amino acids with hydrogen-bond donor side chains, such as serine, threonine, and/or tyrosine.
- the repeating sequence may contain from one to about four proline residues, with remaining residues independently selected from non-polar residues, such as glycine, alanine, leucine, isoleucine, and valine. Non-polar or hydrophobic residues may contribute hydrophobic interactions to the formation of the matrix.
- the amino acid sequence capable of forming the matrix at body temperature may include a random coil or non-globular extended structure.
- the amino acid sequence capable of forming the matrix at body temperature may comprise an amino acid sequence disclosed in U.S. Patent Publication No. 2008/0286808, WIPO Patent Publication No. 2008/155134, and U.S. Patent Publication No. 2011/0123487, each of which is hereby incorporated by reference.
- the amino acid sequence includes an unstructured recombinant polymer of at least 40 amino acids.
- the unstructured polymer may include more than about 100, about 150, about 200 or more contiguous amino acids.
- the amino acid sequence forms a random coil domain.
- a polypeptide or amino acid polymer having or forming “random coil conformation” substantially lacks a defined secondary and tertiary structure.
- the unstructured polymer is defined as a polymer having at least 40 amino acids where the total number of glycine (G), aspartate (D), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) residues constitutes more than about 80% of the total amino acids in the polymer.
- at least 50% of the amino acids are devoid of secondary structure as determined by the Chou-Fasman algorithm.
- amino acid sequences may form a “gel-like” state upon injection at a temperature higher than the storage temperature.
- Exemplary sequences have repeating peptide units, and/or may be relatively unstructured at the lower temperature, and achieve a hydrogen-bonded, structured, state at the higher temperature.
- Elastin-Like Peptides Elastin-Like Peptides
- the amino acid sequence capable of forming a matrix at body temperature is a peptide having repeating units of from four to ten amino acids.
- the repeating unit may form one, two, or three hydrogen bonds in the formation of the matrix.
- the amino acid sequence capable of forming a matrix at body temperature is an amino acid sequence of silk, elastin, collagen, keratin, or mimic thereof, or an amino acid sequence disclosed in U.S. Pat. No. 6,355,776, which is hereby incorporated by reference.
- the amino acid sequence is an Elastin-Like-Protein (ELP) sequence.
- ELP sequence includes or consists of structural peptide units or sequences that are related to, or mimics of, the elastin protein.
- the ELP sequence is constructed from structural units of from three to about twenty amino acids, or in some embodiments, from about four to about ten amino acids, such as about four, about five or about six amino acids.
- the length of the individual structural units may vary or may be uniform.
- Exemplary structural units are defined by SEQ ID NOS: 1-13 (below), which may be employed as repeating structural units, including tandem-repeating units, or may be employed in some combination.
- the ELP may comprise or consist essentially of structural unit(s) selected from SEQ ID NOS: 1-13, as defined below.
- the amino acid sequence includes or consists essentially of from about 1 to about 500 structural units, or in certain embodiments about 9 to about 200 structural units, or in certain embodiments about 10 to 200 structural units, or in certain embodiments about 50 to about 200 structural units, or in certain embodiments from about 80 to about 200 structural units, or from about 80 to about 150 structural units.
- the structural units are ELP units defined by one or more of SEQ ID NOs: 1-13.
- the ELP includes a combination of units defined by SEQ ID NOS: 1-13.
- the structural units collectively may have a length of from about 50 to about 2000 amino acid residues, or from about 100 to about 800 amino acid residues, or from about 200 to about 700 amino acid residues, or from about 400 to about 600 amino acid residues.
- the amino acid sequence of the ELP structural unit includes or consists essentially of about 3 structural units, of about 7 structural units, of about 9 structural units, of about 10 structural units, of about 15 structural units, of about 20 structural units, of about 40 structural units, of about 80 structural units, of about 90 structural units, of about 100 structural units, of about 120 structural units, of about 140 structural units, about 144 structural units, of about 160 structural units, of about 180 structural units, of about 200 structural units, or of about 500 structural units.
- the structural units collectively have a length of about 45 amino acid residues, of about 90 amino acid residues, of about 100 amino acid residues, of about 200 amino acid residues, of about 300 amino acid residues, of about 400 amino acid residues, of about 500 amino acid residues, of about 600 amino acid residues, of about 700 amino acid residues, of about 800 amino acid residues, or of about 1000 amino acid residues.
- the amino acid sequence may exhibit a visible and reversible inverse phase transition with the selected formulation. That is, the amino acid sequence may be structurally disordered and highly soluble in the formulation below a transition temperature (Tt), but exhibit a sharp (2-3° C. range) disorder-to-order phase transition, or coacervation, when the temperature of the formulation is raised above the Tt.
- Tt transition temperature
- length of the amino acid polymer, amino acid composition, ionic strength, pH, pressure, selected solvents, presence of organic solutes, and protein concentration may also affect the transition properties, and these may be tailored in the formulation for the desired absorption profile. Absorption profile can be easily tested by determining plasma concentration or activity of the active agent over time.
- the ELP component(s) may be formed of structural units, including but not limited to:
- Such structural units defined by SEQ ID NOS: 1-13 may form structural repeating units, or may be used in combination to form an ELP.
- the ELP component is formed entirely (or almost entirely) of one or a combination of (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10) structural units selected from SEQ ID NOS: 1-13.
- at least about 75%, or at least about 80%, or at least about 90% of the ELP component is formed from one or a combination of structural units selected from SEQ ID NOS: 1-13, and which may be present as repeating units.
- the ELP contains repeat units, including tandem repeating units, of Val-Pro-Gly-X-Gly (SEQ ID NO: 3), where X is as defined above, and where the percentage of Val-Pro-Gly-X-Gly (SEQ ID NO: 3) units taken with respect to the entire ELP component (which may comprise structural units other than VPGXG (SEQ ID NO: 3)) is greater than about 50%, or greater than about 75%, or greater than about 85%, or greater than about 95% of the ELP.
- the ELP may contain motifs of 5 to 15 structural units (e.g. about 9 or about 10 structural units) of SEQ ID NO: 3, with the guest residue X varying among at least 2 or at least 3 of the units in the motif.
- the guest residues may be independently selected, such as from non-polar or hydrophobic residues, such as the amino acids V, I, L, A, G, and W (and may be selected so as to retain a desired inverse phase transition property).
- the guest residues are selected from V, G, and A.
- the ELP contains repeat units, including tandem repeating units, of Xaa-Pro-Gly-Val-Gly (SEQ ID NO: 13), where X is as defined above, and where the percentage of Xaa-Pro-Gly-Val-Gly (SEQ ID NO: 13) units taken with respect to the entire ELP component (which may comprise structural units other than XPGVG (SEQ ID NO: 13)) is greater than about 50%, or greater than about 75%, or greater than about 85%, or greater than about 95% of the ELP.
- the ELP may contain motifs of 5 to 15 structural units (e.g.
- the guest residues may be independently selected, such as from non-polar or hydrophobic residues, such as the amino acids V, I, L, A, G, and W (and may be selected so as to retain a desired inverse phase transition property).
- the guest residues are selected from V and A.
- the ELP contains repeating units, including tandem repeating units of any of SEQ ID NOs: 1-13 either alone or in combination. In some embodiments, the ELP contains repeats of two or more of any of SEQ ID NOs: 1-13 in combination. In certain embodiments, the ELP contains repeats of SEQ ID NO: 3 and SEQ ID NO: 13. In some embodiments, the ELP contains repeats of SEQ ID NO: 3 and SEQ ID NO: 13, wherein the guest residues are independently selected, such as from non-polar or hydrophobic residues, such as the amino acids V, I, L, A, G, and W (and may be selected so as to retain a desired inverse phase transition property). In certain embodiments, the guest residues are selected from V, G, and A.
- the ELP includes 9mers including nine copies of one or more ELP structural units disclosed herein. In some embodiments, the ELP includes 9mers including nine copies of a pentapeptide disclosed herein. In some embodiments, the ELP includes 9mers including SEQ ID NOs: 3 and 13 in any combination. In some embodiments, the ELP includes a sequence alternating between SEQ ID NOs: 3 and 13. ELPs of varying numbers of 9mers can be combined to produce ELPs with, for instance, 18, 27, 36, 45, 54, 63, 72, 81, 90, 99, 108, 117, 126, 135, 144, 153, 162, 171, or 180 copies of the 9mer.
- the ELP includes 9mers including SEQ ID NO: 3, wherein the guest residue is selected from V, G, and A. In certain embodiments, the ELP includes 9 mers including SEQ ID NO: 3, wherein V, G, and A are in the ratio of 7:2:0 (alpha). In certain embodiments, the ELP includes 9mers including SEQ ID NO:3, wherein V, G, and A are in the ratio of 7:0:2 (beta v1). In certain embodiments, the ELP includes 9mers including SEQ ID NO:3, wherein V, G, and A are in the ratio of 6:0:3 (beta v2).
- the ELP includes 9mers including SEQ ID NO:3, wherein V, G, and A are in the ratio of 5:2:2 (gamma). In certain embodiments, the ELP includes 9mers including SEQ ID NO: 13, wherein the guest residue is selected from V, G, and A. In certain embodiments, the ELP includes 9mers including SEQ ID NO:13, wherein V, G, and A are in the ratio of 5:0:4 (delta). Exemplary 9mers are disclosed in Table 1. Table 2 demonstrates the transition temperatures of several exemplary 9mers.
- ELP polymers have hydrophobicities between the ELP 1 series (least hydrophobic) and the ELP 4 series (most hydrophobic).
- ELP series Pentamer motif Guest residue ratio 1 series VPG X G (SEQ ID NO: 3) 5 Val:3 Gly:2 Ala alpha VPG X G (SEQ ID NO: 3) 7 Val:2 Gly:0 Ala beta v1 VPG X G (SEQ ID NO: 3) 7 Val:0 Gly:2 Ala beta v2 VPG X G (SEQ ID NO: 3) 6 Val:0 Gly:3 Ala gamma VPG X G (SEQ ID NO: 3) 5 Val:2 Gly:2 Ala delta X PGVG (SEQ ID NO: 13) 5 Val:0 Gly:4 Ala VPG X G (SEQ ID NO: 3) 6 Val:3 Gly:0 Ala VPG X G (SEQ ID NO: 3) 6 Val:2 Gly:3 Gly:0 Ala VPG
- the ELP includes combinations of the 9mers listed in Table 1. In some embodiments, the ELP includes combinations of the alpha, beta v1, beta v2, and/or delta 9mers. For example, the gamma ELP is constructed by alternating between an alpha 9mer and a beta v1 9mer for 16 copies until a 144mer is constructed. In certain embodiments, the ELP includes combinations of alpha and beta v1 9mers. In certain embodiments, the ELP includes combinations of alpha and beta v2 9mers. In certain embodiments, the ELP includes combinations of alpha and delta 9mers. In certain embodiments, the ELP includes combinations of beta v1 and beta v2 9mers.
- the ELP includes combinations of beta v1 and delta 9mers. In certain embodiments, the ELP includes combinations of beta v2 and delta 9mers. In certain embodiments, the ELP includes combinations of alpha, beta v1, and beta v2 9mers. In certain embodiments, the ELP includes combinations of alpha, beta v1, and delta 9mers. In certain embodiments, the ELP includes combinations of alpha, beta v2, and delta 9mers.
- the ELPbeta v2 may include the following guest residues in structural units iterated in the following sequence: A-V-A-V-V-A-V-A-V-A-V (e.g. amino acid residues 2-10 of SEQ ID NO: 14).
- the iterated sequence may be repeated sequentially in the ELP about 10 times, about 15 times, about 16 times, about 20 times, about 25 times, about 30 times, or about 35 times or more.
- the ELP contains about 10 to about 20 iterated sequences. In other aspects, the ELP contains about 15 to 20 iterated sequences. In some aspects, the ELP contains about 16 iterated sequences.
- the ELP includes 10mers including ten copies of one or more ELP structural units disclosed herein. In some embodiments, the ELP includes 10mers including ten copies of a pentapeptide disclosed herein. In some embodiments, the ELP includes 10mers including SEQ ID NOs: 3 and 13 in any combination, In some embodiments, the ELP includes a sequence alternating between SEQ ID NOs: 3 and 13. ELPs of varying numbers of 10mers can be combined to produce ELPs with, for instance, 20, 30, 40, 60, 90, 100, 120, 150, 160, or 200 copies of the 10mer. Exemplary 10mers are disclosed in Table 3.
- ELP series Pentamer motif Guest residue ratio 1 series VPG X G (SEQ ID NO: 3) 5 Val:3 Gly:2 Ala VPG X G (SEQ ID NO: 3) 5 Val:4 Gly:1 Ala VPG X G (SEQ ID NO: 3) 5 Val:5 Gly:0 Ala VPG X G (SEQ ID NO: 3) 5 Val:2 Gly:3 Ala VPG X G (SEQ ID NO: 3) 5 Val:1 Gly:4 Ala VPG X G (SEQ ID NO: 3) 5 Val:0 Gly:5 Ala VPG X G (SEQ ID NO: 3) 6 Val:4 Gly:0 Ala VPG X G (SEQ ID NO: 3) 6 Val:3 Gly:1 Ala VPG X G (SEQ ID NO: 3) 6 Val:3 Gly:1 Ala VPG X G (SEQ ID NO: 3) 6 Val:3 Gly:1 Ala VPG X G (SEQ ID NO:
- the ELP may form a ⁇ -turn structure.
- Exemplary peptide sequences suitable for creating a ⁇ -turn structure are described in International Patent Application PCT/US96/05186, which is hereby incorporated by reference in its entirety.
- the fourth residue (X) in the sequence VPGXG (SEQ ID NO: 3) can be varied without eliminating the formation of a ⁇ -turn.
- ELP k [X i Y j -n]
- bracketed capital letters are single letter amino acid codes
- n describes the total length of the ELP in number of the structural repeats.
- ELP1 [V 5 A 2 G 3-10 ] designates an ELP component containing 10 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is valine, alanine, and glycine at a relative ratio of about 5:2:3;
- ELP1 [K 1 V 2 F 1-4 ] designates an ELP component containing 4 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is lysine, valine, and phenylalanine at a relative ratio of about 1:2:1;
- ELP1 [K 1 V 7 F 1-9 ] designates a polypeptide containing 9 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is lysine, valine, and phenylalanine at a relative ratio of about 1:7:1;
- ELP1 [V-5] designates a polypeptide containing 5 repeating units of the pen
- the Tt is a function of the hydrophobicity of the guest residue.
- ELPs can be synthesized that exhibit an inverse transition over a broad range.
- the Tt at a given ELP length may be decreased by incorporating a larger fraction of hydrophobic guest residues in the ELP sequence.
- suitable hydrophobic guest residues include valine, leucine, isoleucine, phenylalanine, tryptophan and methionine. Tyrosine, which is moderately hydrophobic, may also be used.
- the Tt may be increased by incorporating residues, such as those selected from: glutamic acid, cysteine, lysine, aspartate, alanine, asparagine, serine, threonine, glycine, arginine, and glutamine.
- residues such as those selected from: glutamic acid, cysteine, lysine, aspartate, alanine, asparagine, serine, threonine, glycine, arginine, and glutamine.
- the hydrophobicity scale disclosed in PCT/US96/05186 provides one means for predicting the approximate Tt of a specific ELP sequence.
- the ELP in some embodiments is selected or designed to provide a Tt ranging from about 10 to about 37° C. at formulation conditions, such as from about 20 to about 37° C., or from about 25° C. to about 37° C.
- the transition temperature at physiological conditions e.g., 0.9% saline
- the ELP includes [VPGXG] m , (SEQ ID NO:3) where m is any number from 1 to 200. In certain embodiments, the ELP includes [VPGXG] m (SEQ ID NO:3), where m is any number from 1 to 200, and each X is selected from V, G, and A. In certain embodiments, the ELP includes [VPGXG] m (SEQ ID NO:3), where m is any number from 1 to 200, each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2.
- the ELP includes [VPGXG] 90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2.
- the amino acid sequence capable of forming the hydrogen-bonded matrix at body temperature includes [VPGXG] 120 (SEQ ID NO: 19), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2.
- 120 structural units of this ELP can provide a transition temperature at about 37° C. with about 5 to 15 mg/ml (e.g., about 10 mg/ml) of protein.
- the phase transition temperature is about 35.5 degrees centigrade (just below body temperature), which allows for peripheral body temperature to be just less than 37° C.
- the ELP may include [VPGXG] 144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2.
- the ELP includes [VPGXG] 180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2.
- the ELP includes [VPGXG] m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0.
- the ELP includes [VPGXG] 90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0.
- the ELP includes [VPGXG] 120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0.
- the ELP includes [VPGXG] 144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0.
- the ELP includes [VPGXG] 180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0.
- the ELP includes [VPGXG] m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2.
- the ELP includes [VPGXG] 90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2.
- the ELP includes [VPGXG] 120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2.
- the ELP includes [VPGXG] 144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2.
- the ELP includes [VPGXG] 180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2.
- the ELP includes [VPGXG] m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3.
- the ELP includes [VPGXG] 90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3.
- the ELP includes [VPGXG] 120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3.
- the ELP includes [VPGXG] 144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3.
- the ELP includes [VPGXG] 180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3.
- the ELP includes [VPGXG] m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2.
- the ELP includes [VPGXG] 90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2.
- the ELP includes [VPGXG] 120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2.
- the ELP includes [VPGXG] 144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2.
- the ELP includes [VPGXG] 180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2.
- the ELP includes [XPGVG] m (SEQ ID NO:3), where m is any number from 1 to 200. In certain embodiments, the ELP includes [XPGVG] m (SEQ ID NO:3), where m is any number from 1 to 200, and each X is selected from V, G, and A. In certain embodiments, the ELP includes [XPGVG] m (SEQ ID NO:3), where m is any number from 1 to 200, each X is selected from V, G, and A and wherein the ratio of V:G:A is about 5:0:4.
- the ELP includes [XPGVG] 90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4.
- the ELP includes [XPGVG] 120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4.
- the ELP includes [XPGVG] 144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4.
- the ELP includes [XPGVG] 180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4.
- the ELP includes [VPGVG] m (SEQ ID NO:3) where m is any number from 1 to 200.
- the ELP includes [VPGVG] 90 (SEQ ID NO:3), or [VPGVG] 120 (SEQ ID NO:3).
- 120 structural units of this ELP can provide a transition temperature at about 37° C. with about 0.005 to about 0.05 mg/ml (e.g., about 0.01 mg/ml) of protein.
- the ELP includes [VPGXG] 144 (SEQ ID NO:3) or [XPGVG] 144 (SEQ ID NO:3).
- Table 2 144 structural units of either of these ELPs can provide a transition temperature at 28° C. to 35° C. inclusive.
- the intended subject is human, and the body temperature is about 37° C., and thus the therapeutic agent is designed to provide a sustained release at or near this temperature (e.g. between about 28° C. to about 37° C.).
- a sustained release at or near this temperature (e.g. between about 28° C. to about 37° C.).
- a slow release into the circulation with reversal of hydrogen bonding and/or hydrophobic interactions is driven by a drop in concentration as the product diffuses at the injection site, even though body temperature remains constant.
- the subject is a non-human mammal, and the therapeutic agent is designed to exhibit a sustained release at the body temperature of the mammal, which may be from about 30 to about 40° C.
- the Tt is higher than the storage conditions of the formulation (which may be from 10 to about 25° C., or from 15 to 22° C.), such that the therapeutic agent remains in solution for injection.
- the ELP can provide a transition temperature at a range of 27° C. to 36° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 28° C. to 35° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 29° C. to 34° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 27° C. to 33° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 30° C. to 33° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 31° C. to 31° C. inclusive.
- the ELP can provide a transition temperature of 27° C., 28° C., 29° C., 30° C., 31° C., 32° C., 33° C., 34° C., 35° C., or 36° C. In some embodiments, the ELP can provide a transition temperature at a range of 28° C. to 35° C. inclusive at a protein concentration of 10 mg/mL in 110 mM NaCl.
- ELP protein polymers and recombinant fusion proteins can be prepared as described in U.S. Patent Publication No. 2010/0022455, which is hereby incorporated by reference.
- the ELP protein polymers are constructed through recursive ligation to rapidly clone DNA encoding highly repetitive polypeptides of any sequence and specified length over a large range of molecular weights. In a single cycle, two halves of a parent plasmid, each containing a copy of an oligomer, are ligated together, thereby dimerizing the oligomer and reconstituting a functional plasmid.
- This process is carried out recursively to assemble an oligomeric gene with the desired number of repeats.
- one ELP structural subunit e.g. a pentapeptide or a 9mer of pentapeptides
- the vector is digested, and another ELP structural unit (e.g. a pentapeptide or a 9mer of pentapeptides) is inserted.
- Each subsequent round of digestion and ligation doubles the number of ELP structural units contained in the resulting vector until the ELP polymer is the desired length.
- ELPs of varying length can easily be constructed.
- Alternative means of construction i.e. other than recursive ligation
- the vector contains one or more additional amino acids or ELP structural unit repeats.
- pPE0248 FIG. 6 adds an additional pentamer repeat to the N terminus of the 144mer with valine in the guest position and an additional pentamer to the C terminus with a tryptophan in the guest residue.
- the tryptophan may be used as a means to increase the extinction coefficient of the molecule, allowing for better measurement of absorbance, for instance at 280 nm, which can be useful for determination of protein concentration, or for monitoring protein content during purification.
- the pentamers added to either end can also be designed so as the encoding DNA contains restriction enzyme recognition sites for cloning of fusion partners on to either end of the ELP coding sequence.
- the therapeutic agent includes an active agent and one or more ELPs. In some embodiments, the therapeutic agent includes an active agent with one or more ELPs at either the N- or C-terminus. In some embodiments, the therapeutic agent includes an active agent with one or more ELPs at both the N- or C-termini. In some embodiments, the ELPs are approximately the same size. In some embodiments, the ELPs differ in size. In some embodiments, an ELP at one terminus is larger than an ELP at the other terminus. In some embodiments, an ELP at the N-terminus is larger than an ELP at the C-terminus. In some embodiments, an ELP at the C-terminus is larger than an ELP at the N-terminus.
- the active agent is a protein or peptide, which by itself may have a short circulatory half-life, such as from about 30 seconds to about 1 hour.
- the therapeutic agent may be a recombinant fusion protein between the protein active agent and the amino acid sequence capable of forming the hydrogen-bonded matrix at the body temperature of the subject (e.g. an ELP).
- ELP e.g. an ELP
- Any appropriate peptide active agent may be used in the therapeutic agents of the present disclosure.
- Exemplary peptide active agents include GIP receptor agonists such as glucose-dependent insulinotropic peptide (GIP) or a derivative thereof.
- GIP glucose-dependent insulinotropic peptide
- exemplary peptide active agents include GLP1 receptor agonists such as GLP-1 or derivatives thereof (including GLP1 7-36 or GLP1 7-37), or exendin-4 or derivatives thereof.
- the protein or peptide agent is, a glucagon receptor agonist (including glucagon, oxyntomodulin or derivatives thereof).
- the disclosure provides for a co-formulation of any two of a GLP1 receptor agonist, a glucagon receptor agonist, a GIP receptor agonist, a VPAC2 selective agonist, such as vasoactive intestinal peptide (VIP) or a derivative thereof, a clotting factor, such as Factor VII, Factor VIII, or Factor IX, insulin (e.g., single chain insulin or an A chain or a B chain fusion protein, as described in U.S. Patent Publication No. 2013/0150291, which is hereby incorporated by reference), or a monoclonal antibody or single chain antibody.
- the active agent is as described in U.S. Patent Publication No. 2011/0123487, which is hereby incorporated by reference.
- the half-life of protein therapeutics can be extended by a variety of means, including increasing the size and thus the hydrodynamic volume of the protein therapeutic, adding modified or unnatural amino acids, conjugation of moieties (e.g. pegylation), the addition of synthetic sequences (e.g. XTEN® sequences, PASylation®), carboxy-terminal extension from hCG (CTP), addition of albumin-binding sequences (e.g. AlbudAb®), conjugation of albumin-binding fatty acids, post-translational modifications such as N-glycosylation and fusion to other peptides, or fusion with a mammalian heterologous protein, such as albumin, transferrin, or antibody Fc sequences.
- moieties e.g. pegylation
- synthetic sequences e.g. XTEN® sequences, PASylation®
- CTP carboxy-terminal extension from hCG
- albumin-binding sequences e.g. AlbudAb®
- the disclosure provides derivatives, variants, or mutants of one or more active peptide agents disclosed herein.
- the derivative, variant, or mutant contains one or more amino acid substitutions compared to the amino acid sequence of the native therapeutic peptide agent.
- one to 20 amino acids are substituted.
- the derivative, variant, or mutant contains about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, or about 10 amino acid substitutions compared to the amino acid sequence of the native therapeutic peptide agent.
- the derivative, variant, or mutant contains one or more amino acid deletions compared to the amino acid sequence of the native therapeutic peptide agent.
- one to 20 amino acids are deleted compared to the amino acid sequence of the native therapeutic peptide agent.
- the derivative, variant, or mutant has about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, or about 10 amino acid deletions compared to the amino acid sequence of the native therapeutic peptide agent.
- one to ten amino acids are deleted at either terminus compared to the amino acid sequence of the native therapeutic peptide agent.
- one to ten amino acids are deleted from both termini compared to the amino acid sequence of the native therapeutic peptide agent.
- the amino acid sequence of the derivative, variant, or mutant is at least about 70% identical to the amino acid sequence of the native peptide therapeutic agent.
- the amino acid sequence of the derivative, variant, or mutant is about 70%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence of the native therapeutic peptide agent.
- Methods to determine identity are well-known in the art. Preferred methods to determine identity are designed to give the best match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Sequence alignments and percent identity calculations may be performed using the “Clustal W method of alignment” (described by Higgins and Sharp, CABIOS. 5:151-153 (1989); Higgins, D. G. et al., Comput. Appl. Biosci. 8:189-191 (1992)) and found in the MegAlignTM v6.1 program of the LASERGENE bioinformatics computing suite (DNASTAR Inc.).
- the disclosure provides for co-formulation of any two or more active agents disclosed herein.
- the co-formulation includes two or more peptide active agents and small molecule active agents.
- the co-formulation includes two or more small molecule active agents.
- the co-formulation includes two or more peptide active agents.
- the peptide active agents are insulin or derivatives thereof and a GLP-1 receptor agonist or derivatives thereof.
- the peptide active agents are insulin or derivatives thereof and exendin-4 or derivatives thereof.
- one or more of the active agents in the co-formulation is not conjugated to an ELP. In some embodiments, all of the active agents in the co-formulation are conjugated to an ELP.
- the therapeutic agent includes an ELP component fused or conjugated to a GLP-1 receptor agonist, such as GLP-1, exendin-4, or functional analogs thereof.
- Human GLP-1 is a 37 amino acid residue peptide originating from preproglucagon which is synthesized in the L-cells in the distal ileum, in the pancreas, and in the brain.
- GLP-1 (7-36)amide, GLP-1 (7-37) and GLP-2 occurs mainly in the L-cells.
- a simple system is used to describe fragments and analogs of this peptide.
- Gly 8 -GLP-1 (7-37) designates a fragment of GLP-1 formally derived from GLP-1 by deleting the amino acid residues Nos. 1 to 6 and substituting the naturally occurring amino acid residue in position 8 (Ala) by Gly.
- Lys 34 (N ⁇ -tetradecanoyl)-GLP-1(7-37) designates GLP-1 (7-37) wherein the ⁇ -amino group of the Lys residue in position 34 has been tetradecanoylated.
- the amino acid residue in position 38 is Arg unless otherwise indicated
- the optional amino acid residue in position 39 is also Arg unless otherwise indicated
- the optional amino acid residue in position 40 is Asp unless otherwise indicated.
- the amino acid sequence of this extension is as in the corresponding sequence in human preproglucagon unless otherwise indicated.
- the parent peptide of GLP-1, proglucagon (PG), has several cleavage sites that produce various peptide products dependent on the tissue of origin including glucagon (PG[32-62]) and GLP-1[7-36]NH 2 (PG[72-107]) in the pancreas, and GLP-1[7-37] (PG[78-108]) and GLP-1[7-36]NH 2 (PG [78-107]) in the L cells of the intestine where GLP-1[7-36]NH 2 (78-107 PG) is the major product.
- the GLP-1 component in accordance with the disclosure may be any biologically active product or derivative of proglocagon, or functional analog thereof, including: GLP-1 (1-35), GLP-1(1-36), GLP-1 (1-36)amide, GLP-1 (1-37), GLP-1 (1-38), GLP-1 (1-39), GLP-1 (1-40), GLP-1 (1-41), GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)amide, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40) and GLP-1 (7-41), or a analog of the foregoing.
- GLP-1 component in some embodiments may be expressed as GLP-1 (A-B), where A is an integer from 1 to 7 and B is an integer from 38 to 45, optionally with one or more amino acid substitutions as defined below.
- GLP-1 After processing in the intestinal L-cells, GLP-1 is released into the circulation, most notably in response to a meal.
- the plasma concentration of GLP-1 rises from a fasting level of approximately 15 pmol/L to a peak postprandial level of 40 pmol/L.
- the increase in plasma insulin is approximately threefold greater when glucose is administered orally compared with intravenously (Kreymann et al., 1987 , Lancet 2(8571): 1300-4).
- This alimentary enhancement of insulin release known as the incretin effect, is primarily humoral and GLP-1 is now thought to be the most potent physiological incretin in humans.
- GLP-1 mediates insulin production via binding to the GLP-1 receptor, known to be expressed in pancreatic ⁇ cells. In addition to the insulinotropic effect, GLP-1 suppresses glucagon secretion, delays gastric emptying (Wettergen et al., 1993 , Dig Dis Sci 38: 665-73) and may enhance peripheral glucose disposal (D'Alessio et al., 1994 , J. Clin Invest 93: 2293-6).
- GLP-1 non-insulin-dependent diabetes mellitus
- NIDDM non-insulin-dependent diabetes mellitus
- a single subcutaneous dose of GLP-1 can completely normalize post prandial glucose levels in patients with NIDDM (Gutniak et al., 1994 , Diabetes Care 17: 1039-44). This effect may be mediated both by increased insulin release and by a reduction in glucagon secretion.
- intravenous infusion of GLP-1 can delay postprandial gastric emptying in patients with NIDDM (Williams et al., 1996 , J. Clin Endo Metab 81: 327-32).
- GLP-1 insulinotropic action of GLP-1 is dependent on plasma glucose concentration (Holz et al., 1993 , Nature 361:362-5). Thus, the loss of GLP-1-mediated insulin release at low plasma glucose concentration protects against severe hypoglycemia.
- GLP-1 When given to healthy subjects, GLP-1 potently influences glycemic levels as well as insulin and glucagon concentrations (Orskov, 1992 , Diabetologia 35:701-11), effects which are glucose dependent (Weir et al., 1989 , Diabetes 38: 338-342). Moreover, it is also effective in patients with diabetes (Gutniak, M., 1992 , N. Engl J Med 226: 1316-22), normalizing blood glucose levels in type 2 diabetic subjects and improving glycemic control in type 1 patients (Nauck et al., 1993 , Diabetologia 36: 741-4, Creutzfeldt et al., 1996 , Diabetes Care 19:580-6).
- GLP-1 is, however, metabolically unstable, having a plasma half-life (tv2) of only 1-2 minutes in vivo. Moreover, exogenously administered GLP-1 is also rapidly degraded (Deacon et al., 1995 , Diabetes 44: 1126-31). This metabolic instability has limited the therapeutic potential of native GLP-1.
- GLP-1[7-36]NH 2 has the following amino acid sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: 38), which may be employed as the GLP-1 component in accordance with the disclosure.
- the GLP-1 component may contain glycine (G) at the second position, giving, for example, the sequence HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: 39).
- GLP-1 component may be a biologically active fragment of GLP-1, for example, as disclosed in US 2007/0041951, which is hereby incorporated by reference in its entirety. Other fragments and modified sequences of GLP-1 are known in the art (U.S. Pat. Nos.
- GLP-1 Certain structural and functional analogs of GLP-1 have been isolated from the venom of the Gila monster lizards ( Heloderma suspectum and Heloderma horridum ) and have shown clinical utility. Such molecules find use in accordance with the present disclosure.
- exendin-4 is a 39 amino acid residue peptide isolated from the venom of Heloderma suspectum and shares approximately 52% homology with human GLP-1.
- Exendin-4 is a potent GLP-1 receptor agonist that stimulates insulin release, thereby lowering blood glucose levels.
- Exendin-4 has the following amino acid sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO: 23).
- exenatide marketed as Byetta®
- exenatide is structurally analogous to native GLP-1, it has a longer half-life after injection.
- exenatide has the ability to lower blood glucose levels on its own, it can also be combined with other medications such as metformin, a thiozolidinedione, a sulfonylureas, and/or insulin to improve glucose control.
- Exenatide is administered by injection subcutaneously twice per day using a pre-filled pen device.
- Typical human responses to exenatide include improvements in the initial rapid release of endogenous insulin, an increase in ⁇ -cell growth and replication, suppression of pancreatic glucagon release, delayed gastric emptying, and reduced appetite—all of which function to lower blood glucose.
- exenatide increases insulin synthesis and secretion in the presence of glucose only, thus lessening the risk of hypoglycemia.
- exenatide has certain undesirable traits, including the requirement of twice daily injections, gastrointestional side effects, and similar to native GLP-1, a relatively short half-life (i.e. approximately 2 hr).
- GLP-1 and exendin-4 are known, and which find use in accordance with the disclosure. These include liraglutide (Novo Nordisk, WO98/008871), R1583/taspoglutide (Roche, WO00/034331), CJC-1131 (ConjuChem, WO00/069911), ZP-10/AVE0010 (Zealand Pharma, Sanofi-Aventis, WO01/004156), and LY548806 (Eli Lilly, WO03/018516).
- Liraglutide also known as NN2211, is a GLP-1 receptor agonist analog that has been designed for once-daily injection (Harder et al., 2004 , Diabetes Care 27: 1915-21). Liraglutide has been tested in patients with type-2 diabetes in a number of studies and has been shown to be effective over a variety of durations. In one study, treatment with liraglutide improved glycemic control, improved ⁇ -cell function, and reduced endogenous glucose release in patients with type-2 diabetes after one week of treatment (Degn et al., 2004 , Diabetes 53: 1187-94).
- the GLP-1 receptor agonist in accordance with the disclosure is as described in WO98/008871, which is hereby incorporated by reference in its entirety.
- the GLP-1 receptor agonist may have at least one lipophilic substituent, in addition to one, two, or more amino acid substitutions with respect to native GLP-1.
- the lipophilic substituent may be an acyl group selected from CH 3 (CH 2 ) n CO—, wherein n is an integer from 4 to 38, such as an integer from 4 to 24.
- the lipophilic substituent may be an acyl group of a straight-chain or branched alkyl or fatty acid (for example, as described in WO98/008871, which description is hereby incorporated by reference).
- the GLP-1 component is Arg 26 -GLP-1 (7-37), Arg 34 -GLP-1(7-37), Lys 36 -GLP-1 (7-37), Arg 26,34 Lys 36 -GLP-1 (7-37), Arg 26,34 Lys 38 -GLP-1 (7-38), Arg 28,34 Lys 39 -GLP-1 (7-39), Arg 26,34 Lys 40 -GLP-1(7-40), Arg 26 Lys 36 -GLP-1(7-37), Arg 34 Lys 36 -GLP-1(7-37), Arg 26 Lys 39 -GLP-1(7-39), Arg 34 Lys 40 -GLP-1(7-40), Arg 26,34 Lys 36,39 -GLP-I (7-39), Arg 26,34 Lys 36,40 -GLP-1(7-40), Gly 8 Arg 26 -GLP-1(7-37); Gly 8 Arg 34 -GLP-1(7-37); Gly 8 Arg 34 -GLP-1(7-37
- Taspoglutide also known as R1583 or BIM 51077, is a GLP-1 receptor agonist that has been shown to improve glycemic control and lower body weight in subjects with type 2 diabetes mellitus treated with metformin (Abstract No. A-1604, Jun. 7, 2008, 68th American Diabetes Association Meeting, San Francisco, Calif.).
- the GLP-1 receptor agonist is as described in WO00/034331, which is hereby incorporated by reference in its entirety.
- the GLP-1 receptor agonist has the sequence [Aib 8,35 ]hGLP-1(7-36)NH 2 (e.g. taspoglutide), wherein Aib is alpha-aminoisobutyric acid.
- CJC-1131 is a GLP-1 analog that consists of a DPP-IV-resistant form of GLP-1 joined to a reactive chemical linker group that allows GLP-1 to form a covalent and irreversible bond with serum albumin following subcutaneous injection (Kim et al., 2003 , Diabetes 52: 751-9).
- CJC-1131 and metformin treatment was effective in reducing fasting blood glucose levels in type 2 diabetes patients (Ratner et al., Abstract No. 10-OR, Jun. 10-14, 2005, 65th American Diabetes Association Meeting, San Francisco, Calif.).
- the GLP-1 receptor agonist is as described in WO00/069911, which is hereby incorporated by reference in its entirety.
- the GLP-1 receptor agonist is modified with a reactive group which reacts with amino groups, hydroxyl groups or thiol groups on blood components to form a stable covalent bond.
- the GLP-1 receptor agonist is modified with a reactive group selected from the group consisting of succinimidyl and maleimido groups.
- the GLP-1 receptor agonist has the sequence/structure: D-Ala 8 Lys 37 -(2-(2-(2-(2-maleimidopropionamido(ethoxy)ethoxy)acetamide))-GLP-1(7-37) (e.g. CJC-1131).
- AVE0010 also known as ZP-10, is a GLP-1 receptor agonist that may be employed in connection with the disclosure.
- ZP-10 is a GLP-1 receptor agonist that may be employed in connection with the disclosure.
- HbA1c HbA1c levels
- AVE0010 treated patients showed dose-dependent reductions in weight and post-prandial plasma glucose.
- the GLP-1 receptor agonist is as described in WO01/004156, which is hereby incorporated by reference in its entirety.
- the GLP-1 receptor agonist may have the sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 (SEQ ID NO: 41) (e.g. AVE0010).
- LY548806 is a GLP-1 derivative designed to be resistant to proteolysis by dipeptidase-peptidyl IV (DPP-IV) (Jackson et al., Abstract No. 562, Jun. 10-14, 2005, 65th American Diabetes Association Meeting, San Francisco, Calif.).
- DPP-IV dipeptidase-peptidyl IV
- LY548806 has been shown to produce a significant lowering of blood glucose levels during the hyperglycemic phase (Saha et al., 2006, J. Pharm. Exp. Ther. 316: 1159-64).
- LY548806 was shown to produce a significant increase in insulin levels consistent with its known mechanism of action, namely stimulation of insulin release in the presence of hyperglycemia.
- the GLP-1 receptor agonist is as described in WO03/018516, which is hereby incorporated by reference in its entirety.
- the therapeutic agents of the present disclosure comprise GLP-1 analogs wherein the backbone for such analogs or fragments contains an amino acid other than alanine at position 8 (position 8 analogs).
- the backbone may also include L-histidine, D-histidine, or modified forms of histidine such as desamino-histidine, 2-amino-histidine, ⁇ -hydroxy-histidine, homohistidine, ⁇ -fluoromethyl-histidine, or ⁇ -methyl-histidine at position 7.
- these position 8 analogs may contain one or more additional changes at positions 12, 16, 18, 19, 20, 22, 25, 27, 30, 33, and 37 compared to the corresponding amino acid of native GLP-1. In other embodiments, these position 8 analogs may contain one or more additional changes at positions 16, 18, 22, 25 and 33 compared to the corresponding amino acid of native GLP-1.
- the GLP-1 receptor agonist has the sequence: HVEGTFTSDVSSYLEEQAAKEFIAWLIKGRG-OH (SEQ ID NO: 42) (e.g. LY548806).
- the mature form of such fusion protein when processed, will begin with the His 7 of GLP.
- the present disclosure provides therapeutic agents including an elastin-like peptide (ELP) and a GLP-1 receptor agonist.
- the GLP-1 receptor agonist is GLP-1 (SEQ ID NOs: 37, 38, or 39) or a functional analog thereof.
- the GLP-1 receptor agonist is exendin-4 (SEQ ID NO: 23) or a functional analog thereof.
- Such functional analogs of GLP-1 or exendin-4 include functional fragments truncated at the C-terminus by from 1 to 10 amino acids, including by 1, 2, 3, or up to about 5 amino acids (with respect to SEQ ID NOs: 23, 37, 38, or 39).
- Such functional analogs may contain from 1 to 10 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (e.g., SEQ ID NOs: 23, 37, 38, or 39), and in each case retaining the activity of the peptide.
- the functional analog of GLP-1 or exendin-4 may have from 1 to about 3, 4, or 5 insertions, deletions and/or substitutions (collectively) with respect to SEQ ID NOS: 23, 37, 38, or 39.
- the exendin-4 variant is exendin-4 (9-39) (SEQ ID NO: 33), exendin-4 (9-31) (SEQ ID NO: 34), or exendin-4 (9-30) (SEQ ID NO: 56).
- the GLP-1 receptor agonist component has at least about 50%, 75%, 80%, 85%, 90%, 95%, or 99% identity with the native sequence (SEQ ID NOS: 23, 37, 38, or 39).
- Such functional analogs may further comprise additional chemical modifications, such as those described in this section and/or others known in the art.
- the GLP-1 receptor agonist is a dual agonist having an amino acid sequence described in US 2011/0257092, which is hereby incorporated by reference in its entirety.
- Other dual or multi receptor agonists are described in US 2011/016602 and US 2010/00190701, each of which is hereby incorporated by reference, in particular with regard to the structures and sequences of GLP-1 receptor co-agonists described therein.
- GLP-1 receptor co-agonists can be found in Pocai A et al., Glucagon-Like Peptide 1/Glucagon Receptor Dual Agonism Reverses Obesity in Mice, Diabetes 58:2258-2266 (2009) and Patterson J T, et al., Functional association of the N-terminal residues with the central region in glucagon-related peptides, J. Pept. Sci. 17:659-666 (2011), Finan et al., A rationally designed monomeric peptide triagonist corrects obesity and diabetes in rodents, Nature Medicine 21:27-36, each of which are hereby incorporated by reference in their entirety.
- the present disclosure provides methods for treating or preventing type 2 diabetes, impaired glucose tolerance, type 1 diabetes, hyperglycemia, obesity, binge eating, bulimia, hypertension, syndrome X, dyslipidemia, cognitive disorders, atheroschlerosis, non-fatty liver disease, myocardial infarction, coronary heart disease and other cardiovascular disorders, or hyperinsulinism, such as congenital hyperinsulinism or acquired hyperinsulinism following gastric surgery, for instance gastric surgery to treat obesity.
- the methods include administering a therapeutic agent including the elastin-like peptide (ELP) and an GLP-1 receptor agonist (as described above) to a patient in need of such treatment.
- a therapeutic agent including the elastin-like peptide (ELP) and an GLP-1 receptor agonist (as described above)
- ELP elastin-like peptide
- GLP-1 receptor agonist as described above
- the present disclosure provides methods for decreasing food intake, decreasing ⁇ -cell apoptosis, increasing ⁇ -cell function and ⁇ -cell mass, and/or for restoring glucose sensitivity to ⁇ -cells.
- the patient may be a human or non-human animal patient (e.g., dog, cat, cow, or horse).
- the patient is human.
- the treatment with a ELP/GLP-1 receptor agonist compound according to the present disclosure may also be combined with one or more pharmacologically active substances, e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity.
- antidiabetic agent includes compounds for the treatment and/or prophylaxis of insulin resistance and diseases wherein insulin resistance is the pathophysiological mechanism.
- the ability of a GLP-1 or exendin-4 analog, or an GLP-1 receptor agonist/ELP compound, to bind the GLP-1 receptor may be determined by standard methods, for example, by receptor-binding activity screening procedures which involve providing appropriate cells that express the GLP-1 receptor on their surface, for example, insulinoma cell lines such as RINmSF cells or INS-1 cells.
- receptor-binding activity screening procedures which involve providing appropriate cells that express the GLP-1 receptor on their surface, for example, insulinoma cell lines such as RINmSF cells or INS-1 cells.
- cAMP activity or glucose dependent insulin production can also be measured.
- cells recombinantly expressing the GLP-1 receptor may also be used to measure the GLP-1 receptor agonist activity. Thus, these methods may be employed for testing or confirming whether a suspected GLP-1 receptor agonist is active.
- GLP-1 receptor agonists or GLP-1 receptor agonist/ELP compounds can be assessed for their ability to induce the production of insulin in vivo using a variety of known assays for measuring GLP-1 activity.
- an ELP/GLP-1 receptor agonist compound can be introduced into a cell, such as an immortalized ⁇ -cell, and the resulting cell can be contacted with glucose.
- the modified GLP-1 is generally considered biologically active in vivo (Fehmann et al., 1992 , Endocrinology 130: 159-166).
- An exemplary assay is described in greater detail herein.
- pancreatic ⁇ -cell proliferation may be assessed by 3 H-tymidine or BrdU incorporation assays (See e.g. Buteau et al., 2003 , Diabetes 52: 124-32), wherein pancreatic ⁇ -cells such as INS(832/13) cells are contacted with an ELP/GLP-1 receptor agonist compound and analyzed for increases in 3 H-thymidine or BrdU incorporation.
- the antiapoptotic activity of an ELP/GLP-1 receptor agonist compound can be measured in cultured insulin-secreting cells and/or in animal models where diabetes occurs as a consequence of an excessive rate of beta-cell apoptosis (See e.g. Bulotta et al., 2004 , Cell Biochem Biophys 40(3 suppl): 65-78).
- GLP-1 In addition to GLP-1, other peptides of this family, such as those derived from processing of the pro-glucagon gene, such as GLP-2, GIP, and oxyntomodulin, can be conjugated or fused to the ELP component (as described herein) to enhance the therapeutic potential.
- the disclosure encompasses doses and/or regimens such as those that do not induce substantial appetite suppression in a patient and/or those that do not induce substantial nausea in the patient, such as those described in PCT/US12/44383, which is hereby incorporated by reference.
- the protein active agent is a growth hormone.
- An exemplary growth hormone sequences includes the sequence underlined in FIGS. 24, 26, 28, and 30 (e.g. SEQ ID NO: 22). Additional suitable sequences include those described in Seeburg et al., “The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone: DNA 1 (3), 239-249 (1982), which includes the sequence associated with Accession No. AAA98618. In addition to the exact sequence of AAA98616, other derivatives may be used.
- the growth hormone may be truncated at the N-terminus by up to 3 amino acids, up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 25 amino acids, up to 30 amino acids, up to 35 amino acids, or up to 40 amino acids. In particular aspects about 15 to about 30 amino acids may be deleted from the N-terminus.
- the growth hormone may be truncated at the C-terminus by up to 3 amino acids, up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 25 amino acids, up to 30 amino acids, up to 35 amino acids, or up to 40 amino acids. In particular aspects about 20 to about 30 amino acids may be deleted from the C-terminus.
- growth hormone derivatives include those having certain sequence identity to SEQ ID NO: 22.
- growth hormones include amino acids sequences that share at least about 75% identity, about 80% identity, about 90% identity, about 95% identity, about 96% identity, about 97% identity, about 98% identity, or about 99% identity, with SEQ ID NO: 22.
- the deleted portions may be replaced with one or more amino acids, such as methionine or glycine, which may serve functions such as initiating expression or providing spatial separation.
- the N- and C-terminal truncations may be combined to arrive at a particular growth hormone.
- the growth hormone peptide is in a fusion protein with more than one ELP sequence. In some embodiments, the growth hormone peptide has one or more ELPs at both the N- and C-termini. In some embodiments, the two or more ELPs at the N- and C-termini are approximately the same size. In some embodiments, the two or more ELPs at the N- and C-termini differ in size. In some embodiments, the ELP at the N-terminus of the growth hormone peptide is larger than the ELP at the C-terminus of the growth hormone peptide. In some embodiments, the ELP at the N-terminus of the growth hormone peptide includes about 90 to about 120 repeating structural units.
- the ELP at the C-terminus of the growth hormone peptide includes about 5 to about 20 repeating structural units. In some embodiments, the ELP at the C-terminus of the growth hormone peptide is larger than the ELP at the N-terminus of the growth hormone peptide. In some embodiments, the ELP at the C-terminus of the growth hormone peptide includes about 90 to about 120 repeating structural units. In some embodiments, the ELP at the N-terminus of the growth hormone peptide includes about 5 to about 20 repeating structural units.
- Human proinsulin consists of A and B chains linked together with the 31 amino acid C peptide (SEQ ID NOs: 44 or 46). Once the preproinsulin reaches the endoplasmic reticulum, a protease cleaves off the signal peptide to create proinsulin. Specifically, once disulfide bonds are formed between the A and B chains the proinsulin is converted into mature insulin in vivo by removal of the C peptide by a trypsin/carboxypeptidase B-like system.
- Human insulin is composed of two chains of amino acids named chain A (21 amino acids—GIVEQCCTSICSLYQLENYCN) (SEQ ID NO: 47) and chain B (30 amino acids FVNQHLCGSHLVEALYLVCGERGFFYTPKT) (SEQ ID NO: 48) that are linked together by two disulfide bridges. There is a 3rd disulfide bridge within the A chain that links the 6th and 11th residues of the A chain together. In most species, the length and amino acid compositions of chains A and B are similar, and the positions of the three disulfide bonds are highly conserved. For this reason, pig insulin can replace deficient human insulin levels in diabetes patients. Today, porcine insulin has largely been replaced by the mass production of human proinsulin by bacteria (recombinant insulin).
- Insulin molecules have a tendency to form dimers in solution, and in the presence of zinc ions, insulin dimers associate into hexamers. Whereas monomers of insulin readily diffuse through the blood and have a rapid effect, hexamers diffuse slowly and have a delayed onset of action.
- the structure of insulin can be modified in a way that reduces the tendency of the insulin molecule to form dimers and hexamers but that does not interrupt binding to the insulin receptor. In this way, a range of preparations are made, varying from short acting to long acting.
- proinsulin is exposed to several specific peptidases that remove the C-peptide and generate the mature and active form of insulin.
- insulin and free C-peptide are packaged into secretory granules, which accumulate in the cytoplasm of the ⁇ -cells. Exocytosis of the granules is triggered by the entry of glucose into the beta cells. The secretion of insulin has a broad impact on metabolism.
- insulin is active for only a brief time before it is degraded by enzymes. Insulinase found in the liver and kidneys breaks down insulin circulating in the plasma, and as a result, insulin has a half-life of only about 6 minutes. This short duration of action results in rapid changes in the circulating levels of insulin.
- Insulin analogs have been developed with improved therapeutic properties (Owens et al., 2001, Lancet 358: 739-46; Vajo et al., 2001, Endocr Rev 22: 706-17), and such analogs may be employed in connection with the present disclosure.
- Various strategies including elongation of the COOH-terminal end of the insulin B-chain and engineering of fatty acid-acylated insulins with substantial affinity for albumin are used to generate longer-acting insulin analogs.
- in vivo treatments with available longer-acting insulin compounds still result in a high frequency of hypo- and hyperglycemic excursions and modest reduction in HbA1c. Accordingly, development of a truly long-acting and stable human insulin analog still remains an important task.
- Functional analogs of insulin that may be employed in accordance with the disclosure include rapid acting analogs such as insulin lispro, insulin aspart and insulin glulisine, which are absorbed rapidly ( ⁇ 30 minutes) after subcutaneous injection, peak at one hour, and have a relatively short duration of action (3 to 4 hours).
- rapid acting analogs such as insulin lispro, insulin aspart and insulin glulisine
- insulin glargine three long acting insulin analogs have been developed: insulin glargine, insulin detemir, and insulin degludec, and which may be employed in connection with the disclosure.
- the long acting insulin analogs have an onset of action of approximately two hours and reach a plateau of biological action at 4 to 6 hours, and may last up to 24 hours.
- the insulin amino acid sequence may contain the A and/or B chain of insulin lispro (also known as HUMALOG, Eli Lilly).
- Insulin lispro differs from human insulin by the substitution of proline with lysine at position 28 and the substitution of lysine with proline at position 29 of the insulin B chain. Although these modifications do not alter receptor binding, they help to block the formation of insulin dimers and hexamers, allowing for larger amounts of active monomeric insulin to be available for postprandial injections.
- the insulin amino acid sequence may contain an A and/or B chain of aspart (also known as NOVOLOG®, Novo Nordisk).
- Insulin aspart is designed with the single replacement of the amino acid proline by aspartic acid at position 28 of the human insulin B chain. This modification helps block the formation for insulin hexamers, creating a faster acting insulin.
- the insulin amino acid sequence may contain an A and/or B chain of glulisine (also known as APIDRA®, Sanofi-Aventis).
- Insulin glulisine is a short acting analog created by substitution of asparagine at position 3 by lysine and lysine at position 29 by glutamine of human insulin B chain. Insulin glulisine has more rapid onset of action and shorter duration of action compared to regular human insulin.
- the insulin amino acid sequence may contain an A and/or B chain of insulin glargine (also known as LANTUS®, Sanofi-Aventis).
- Insulin glargine has delayed absorption due to its acidic pH that causes microprecipitate formation of insulin crystals in the presence of neutral physiologic pH.
- Insulin glargine differs from human insulin in that the amino acid asparagine at position 21 of the A chain is replaced by glycine and two arginines are added to the C-terminus of the B-chain.
- NPH bedtime neutral protamine Hagedorn
- insulin glargine is associated with less nocturnal hypoglycemia in patients with type 2 diabetes.
- the insulin amino acid sequence may contain an A and/or B chain from insulin detemir (also known as LEVEMIR®, Novo Nordisk).
- Insulin detemir is a soluble (at neutral pH) long-acting insulin analog, in which the amino acid threonine at B30 is removed and a 14-carbon, myristoyl fatty acid is acetylated to the epsilon-amino group of LysB29. After subcutaneous injection, detemir dissociates, thereby exposing the free fatty acid which enables reversible binding to albumin molecules. So at steady state, the concentration of free unbound insulin is greatly reduced resulting in stable plasma glucose levels.
- the insulin amino acid sequence may contain an A and/or B chain from insulin degludec (also known as TRESIBA®, Novo Nordisk).
- Insulin degludec is a soluble (at neutral pH) long-acting insulin analog, in which the amino acid threonine at B30 is removed and a side-chain consisting of glutamic acid and a C16 fatty acid has been attached. After subcutaneous injection, insulin degludec dissociates, thereby exposing the fatty acid which enables reversible binding to albumin molecules. So at steady state, the concentration of free unbound insulin is greatly reduced resulting in stable plasma glucose levels.
- the insulin amino acid sequence may be a single-chain insulin analog (SIA) (e.g. as described in U.S. Pat. No. 6,630,438 and WO 2008/019368, which are hereby incorporated by reference in their entirety).
- Single-chain insulin analogs encompass a group of structurally-related proteins wherein the A and B chains are covalently linked by a polypeptide linker.
- the polypeptide linker connects the C-terminus of the B chain to the N-terminus of the A chain.
- the linker may be of any length so long as the linker provides the structural conformation necessary for the SIA to have a glucose uptake and insulin receptor binding effect. In some embodiments, the linker is about 5-18 amino acids in length.
- the linker is about 9-15 amino acids in length. In certain embodiments, the linker is about 12 amino acids long. In certain exemplary embodiments, the linker has the sequence KDDNPNLPRLVR (SEQ ID NO.: 51) or GAGSSSRRAPQT (SEQ ID NO.: 52). However, it should be understood that many variations of this sequence are possible such as in the length (both addition and deletion) and substitutions of amino acids without substantially compromising the effectiveness of the produced SIA in glucose uptake and insulin receptor binding activities. For example, several different amino acid residues may be added or removed from either end without substantially decreasing the activity of the produced SIA.
- albulin An exemplary single-chain insulin analog currently in clinical development is albulin (Duttaroy et al., 2005, Diabetes 54: 251-8).
- Albulin can be produced in yeast or in mammalian cells. It consists of the B and A chain of human insulin (100% identity to native human insulin) linked together by a dodecapeptide linker and fused to the NH2 terminals of the native human serum albumin.
- Duttaroy et al. constructed a synthetic gene construct encoding a single-chain insulin containing the B- and A-chain of mature human insulin linked together by a dodecapeptide linker using four overlapping primers and PCR amplification.
- the resulting PCR product was ligated in-frame between the signal peptide of human serum albumin (HSA) and the NH2 terminus of mature HSA, contained within a pSAC35 vector for expression in yeast.
- HSA human serum albumin
- the HSA component of abulin may be replaced with an amino acid sequence providing a sustained release as described herein.
- the present disclosure provides therapeutic agents including an amino acid sequence providing a sustained release, including, for example, an elastin-like peptide (ELP), and an insulin amino acid sequence.
- the insulin is a mammalian insulin, such as human insulin or porcine insulin.
- the amino acid sequence providing a sustained release component may be coupled (e.g., via recombinant fusion or chemical conjugation) to the insulin A chain, or B chain, or both.
- the amino acid sequence that provides a slow absorption from the injection site is covalently bound to the insulin A chain.
- the insulin may comprise each of chains A, B, and C (e.g.
- SEQ ID NOs: 44 or 46 may contain a processed form, containing only chains A and B.
- chains A and B are connected by a short linking peptide, to create a single chain insulin.
- the insulin may be a functional analog of human insulin, including functional fragments truncated at the N-terminus and/or C-terminus (of either or both of chains A and B) by from 1 to 10 amino acids, including by 1, 2, 3, or about 5 amino acids.
- Functional analogs may contain from 1 to 10 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (e.g., SEQ ID NOs: 44, 46, 47 or 48), and in each case retaining the activity of the peptide.
- functional analogs may have 1, 2, 3, 4, or 5 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (which may contain chains A and B, or chains A, B, and C). Such activity may be confirmed or assayed using any available assay, including those described herein.
- the insulin component has at least about 75%, about 80%, about 85%, about 90%, about 95%, or about 98% identity with each of the native sequences for chains A and B (SEQ ID NOs: 47 or 48).
- sequence identity between two sequences can be accomplished using any alignment tool, including Tatusova et al., Blast 2 sequences—a new tool for comparing protein and nucleotide sequences, FEMS Microbiol Lett. 174:247-250 (1999).
- the insulin component may contain additional chemical modifications known in the art.
- competition binding assays may be performed in various cell lines that express the insulin receptor (Jehle et al., 1996, Diabetologia 39: 421-432). For example, competition binding assays using CHO cells overexpressing the human insulin receptor may be employed. Insulin can also bind to the IGF-1 receptor with a lower affinity than the insulin receptor. To determine the binding affinity of an amino acid sequence providing a sustained release-containing insulin analog, a competition binding assay can be performed using 125 I-labeled IGF-1 in L6 cells.
- the activities of insulin include stimulation of peripheral glucose disposal and inhibition of hepatic glucose production.
- the ability of an amino acid sequence providing a sustained release-containing insulin analog to mediate these biological activities can be assayed in vitro using known methodologies. For example, the effect of an amino acid sequence providing a sustained release-containing analog on glucose uptake in 3T3-L1 adipocytes can be measured and compared with that of insulin.
- Pretreatment of the cells with a biologically active analog will generally produce a dose-dependent increase in 2-deoxyglucose uptake.
- the ability of an amino acid sequence providing a sustained release-containing insulin analog to regulate glucose production may be measured in any number of cells types, for example, H4IIe hepatoma cells. In this assay, pretreatment with a biologically active analog will generally result in a dose-dependent inhibition of the amount of glucose released.
- Vasoactive intestinal peptide is a 28 amino acid neuropeptide which binds to two receptors, VPAC1 and VPAC2, found in a variety of tissues including the airway, small intestine, testes, and pancreas.
- VIP and its functionally and structurally related analogs are known to have many physiological functions, including, relaxing airway smooth muscle thereby acting as a bronchodilator, stimulating fluid secretion in airway submucosal glands, and regulating water and electrolyte secretion in the intestines and pancreas (Wine (2007); Wu (2011); Derand (2004)).
- VIP-producing nerve fibers are co-localized with acetylcholine secreting neurons surrounding exocrine glands (Lundberg (1980); Heinz-Erian (1986)).
- VIP induces fluid secretion, but this induction is impaired or absent in Cystic Fibrosis patients (Joo (2002); Joo (2012)).
- administration of low concentrations of both VIP and acetylcholine stimulates the secretion mucus, but this synergism is lost in cystic fibrosis patients (Choi (2007)).
- VIP increases CFTR membrane insertion, stability, and function in human airway epithelial cells (Alshafie (2014)).
- CFTR does not localize to the apical cell membrane, but instead remains mainly intracellular (Chappe and Said (2012)).
- the absence of CFTR from the apical membrane is associated with a lung pathology similar to that seen in Cystic Fibrosis patients, with inflammatory cell infiltration, thickening of the alveolar wall and the bronchiolar mucosa, and goblet cell hyperplasia.
- Administration of VIP intraperitoneally for three weeks restores CFTR apical membrane localization, and prolonged VIP stimulation increases the number of CFTR channels at the cell membrane (Chappe (2008)).
- This increase in apical CFTR density which occurs via stabilization of CFTR at the membrane, is associated with an increase in CFTR-dependent function as measured by iodide efflux assays (Chappe (2008)).
- the disclosure provides therapeutic compositions that may include one or more various VIP peptides.
- the VIP peptide may comprise or consist of a polypeptide having SEQ ID NO: 53, SEQ ID NO: 54, or SEQ ID NO: 55.
- the present disclosure provides a VIP without the N-terminal Methionine (e.g. SEQ ID NO: 55).
- the present disclosure provides a VIP with the N-terminal Methionine (e.g. SEQ ID NO: 53).
- Mature human VIP has 28 amino acid residues with the following sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN (SEQ ID NO: 55).
- VIP results from processing of the 170-amino acid precursor molecule prepro-VIP. Structures of VIP and exemplary analogs have been described in U.S. Pat. Nos. 4,835,252, 4,939,224, 5,141,924, 4,734,400, 4,605,641, 6,080,837, 6,316,593, 5,677,419, 5,972,883, 6,489,297, 7,094,755, and 6,608,174.
- modified VIP peptides include the sequences of SEQ ID NOs: 53, 54, or 55
- the present disclosure provides modified VIP peptides that include one or more of these modifications.
- the present disclosure provides modified VIP peptides that include one or more of these modifications and further include additional VIP modifications described herein.
- the present disclosure provides a modified VIP (e.g., including SEQ ID NO: 55) or a functional analog as described herein.
- functional analogs of VIP include functional fragments truncated at the N- or C-terminus by from 1 to 10 amino acids, including by 1, 2, 3, or up to about 5 amino acids (with respect to SEQ ID NO: 55).
- Such functional analogs may contain from 1 to 5 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (e.g., SEQ ID NO: 55), and in each case retain the activity of the native peptide (e.g., through VPAC2 and/or VPAC1 binding).
- the VIP component of the modified VIP has at least about 50%, about 75%, about 80%, about 85%, about 90%, about 95%, about 97% identity, about 98% identity, or about 99% identity with the native mature sequence (SEQ ID NO: 55).
- sequence identity between two sequences can be accomplished using any alignment tool, including for example, that disclosed in Tatusova et al., Blast 2 sequences—a new tool for comparing protein and nucleotide sequences, FEMS Microbiol Lett. 174:247-250 (1999).
- the present disclosure provides a modified VIP molecule having receptor preference for VPAC2 or VPAC1, as compared to unmodified VIP (e.g., a peptide consisting of the amino acid sequence of SEQ ID NO: 55).
- the modified VIP may have a relative binding preference for VPAC2 over VPAC1 of at least about 2:1, about 5:1, about 10:1, about 25:1, about 50:1, about 100:1, about 500:1 or more.
- the modified VIP may have a relative binding preference for VPAC1 over VPAC2 of at least about 2:1, about 5:1, about 10:1, about 25:1, about 50:1, about 100:1, about 500:1, or more.
- the modified VIP activates the VPAC2 receptor with an EC50 within a factor of about 2 of mature, unmodified, human VIP (SEQ ID NO: 55).
- this same modified VIP is 50- or 100-fold or more less potent than mature, unmodified, human VIP in activating the VPAC1 receptor.
- the modified VIP may have relatively equipotent binding preferences for VPAC1 and VPAC2.
- modified VIP molecules may contain modified N-terminal regions, such as an addition of from 1 to about 500 amino acids to the N-terminal histidine of VIP, which may include heterologous mammalian amino acid sequences.
- the modified VIP may contain a single methionine at the N-terminal side of the natural N-terminal histidine of mature VIP. This can be prepared in E. coli or other bacterial expression system, since the methionine will not be removed by E coli when the adjacent amino acid is histidine.
- the N-terminal amino acid may be any of the naturally-occurring amino acids, namely alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, serine, threonine, tryptophan, tyrosine, valine, and proline.
- amino acids namely alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, serine, threonine, tryptophan, tyrosine, valine, and proline.
- the additional sequence added to the N-terminus of VIP may be of any sequence, including biologically active and biologically inert sequences of from 1 to about 100, 1 to about 50, 1 to about 20, 1 to about 10, and 1 to about 5 amino acids.
- the N-terminus of the modified VIP may have the structure M-N, where M is methionine, and N is the N-terminus of the VIP molecule (e.g., SEQ ID NO. 53).
- M methionine
- N the N-terminus of the VIP molecule
- This methionine supports translation of the protein in a bacterial or eukaryotic host cell.
- the modified VIP can be made in a biological system, including bacterial and yeast expression systems (e.g., E. coli ). While methionine can sometimes be removed by methionine aminopeptidase (MA) in bacterial expression systems, histidine (H) is one of the least favored residues at position 2 for MA.
- MA methionine aminopeptidase
- H histidine
- the VIP is modified at the N-terminus. In some embodiments, the VIP is modified at the C-terminus.
- VIP is activatable by a peptidase or protease, such as an endogenous peptidase or protease.
- a peptidase or protease such as an endogenous peptidase or protease.
- Such activatable sequences are described in International Application No. PCT/US2009/068656.
- the terms “peptidase” and “protease” are interchangeable.
- the VIP may be designed to be activatable by a dipeptidyl peptidase.
- Exemplary dipeptidyl peptidases include dipeptidyl peptidase-1 (DPP-I), dipeptidyl peptidase-3 (DPP-III), dipeptidyl peptidase-4 (DPP-IV), dipeptidyl peptidase-6 (DPP-VI), dipeptidyl peptidase-7 (DPP-VII), dipeptidyl peptidase-8 (DPP-VIII), dipeptidyl peptidase-9 (DPP-IX), dipeptidyl peptidase-10 (DPP-X). Substrate sequences for such dipeptidases are known.
- the N-terminus of an activatable VIP may have the structure Z-N, where Z is a substrate for a dipeptidase (e.g., Z is removed by dipeptidase exposure), and N is the N-terminus of VIP.
- the activatable VIP may have an N-terminal sequence with the formula M-X-N where M is methionine, X is Pro, Ala, or Ser, and N is the N-terminal of VIP or VIP analog. In this manner, M and X will be sensitive to, and removed by a host cell (e.g., E. coli ), and/or a dipeptidase (e.g., DPP-IV), subsequently.
- the N-terminal sequence of the activatable VIP may be X1-X2-N, where X1 is Gly, Ala, Ser, Cys, Thr, Val, or Pro; X2 is Pro, Ala, or Ser; and N is the N-terminal of VIP.
- X1-X2 is a substrate for dipeptidase (e.g., DPP-IV), and dipeptidase digestion will expose N, the desired N-terminus of the VIP or the VIP analog.
- the protein may be produced by expression of a construct encoding M-X1-X2-N (where M is methionine) in a host cell (e.g., E.
- X1-X2 on the N-terminus, which can be activated by a dipeptidase (e.g., DPP-IV) in vivo.
- the peptidase may be present in the body and act on the activatable VIP after injection.
- the N-terminus of the modified activatable VIP has the structure M-Z-N, where M is methionine, Z is a substrate for a dipeptidase (e.g., Z is removed by dipeptidase exposure), and N is a non-His N-terminal of an active VIP (modified VIP).
- the modified activatable VIP may have an N-terminal sequence with the formula M-X-N where M is methionine; X is Pro, Ala, or Ser; and N is a non-His N-terminal of the active VIP.
- M and X will be sensitive to, and removed by a host cell (e.g., E. coli .), and/or a dipeptidase (e.g., DPP-IV), subsequently.
- the N-terminal sequence of the activatable VIP may be X1-X2-N, where X1 is Gly, Ala, Ser, Cys, Thr, Val, or Pro; X2 is Pro, Ala, or Ser; and N is a non-His N-terminal of the active VIP.
- X1-X2 is a substrate for dipeptidase (e.g., DPP-IV), and dipeptidase digestion will expose N, the desired non-His N-terminus of the VIP.
- the N-terminus of a modified activatable VIP has the structure M-Z-S-N, where M is methionine; Z is a substrate for a dipeptidase (e.g., Z is removed by dipeptidase exposure); N is the N-terminus of mature VIP (His); and S is one or more amino acids which will be exposed after dipeptidase digestion, and which provide a modified VIP as previously described.
- the modified activatable VIP may have an N-terminal sequence with the formula M-X-S-N where M is methionine, X is Pro, Ala, or Ser; N is the N-terminal of mature VIP; and S is one or more amino acids which will be exposed after dipeptidase digestion, and will provide receptor preference.
- the N-terminal sequence of the activatable VIP may be X1-X2-S-N, where X1 is Gly, Ala, Ser, Cys, Thr, Val, or Pro; X2 is Pro, Ala, or Ser; N is a non-His N-terminal of VIP; and S is one or more amino acids which will be exposed after dipeptidase digestion.
- X1-X2 is a substrate for dipeptidase (e.g., DPP-IV), and dipeptidase digestion will expose S.
- N-terminal chemical modifications to the VIP N-terminus provides receptor preference.
- Chemical modification of proteins and methods thereof are well known in the art.
- Non-limiting exemplary chemical modifications are PEGylation, methylglyoxalation, reductive alkylation, performic acid oxidation, succinylation, aminoethylation, and lipidation (Clifton, New Protein Techniques, New Jersey: Humana Press, 1985. ISBX. 0-89603-126-8. Volume. 3 of Methods in Molecular Biology).
- Chemical groups such as PEGylation, may be attached by modifications of cysteine, methionine, histidine, lysine, arginine, tryptophan, tyrosine, carboxyl groups have been described previously (see Lundblad, Techniques in Protein Modification, CRC Press, 1995).
- the VIP active agent finds use in a method of treating a condition selected from uncontrolled or resistant hypertension, or pulmonary arterial hypertension (PAH), or chronic obstructive pulmonary disease (COPD), or cardiomyopathy secondary to muscular dystrophy, among others.
- a condition selected from uncontrolled or resistant hypertension, or pulmonary arterial hypertension (PAH), or chronic obstructive pulmonary disease (COPD), or cardiomyopathy secondary to muscular dystrophy, among others.
- the therapeutic agent is a chemical conjugate between the active agent and the amino acid sequence capable of forming the matrix at the body temperature of the subject (e.g. an ELP).
- the active agent may be a chemotherapeutic agent, such as a chemotherapeutic agent selected from methotrexate, daunomycin, mitomycin, cisplatin, vincristine, epirubicin, fluorouracil, verapamil, cyclophosphamide, cytosine arabinoside, aminopterin, bleomycin, mitomycin C, democolcine, etoposide, mithramycin, chlorambucil, melphalan, daunorubicin, doxorubicin, tamoxifen, paclitaxel, vinblastine, camptothecin, actinomycin D, cytarabine, and combrestatin.
- a chemotherapeutic agent selected from methotrexate, daunomycin, mitomycin,
- the agent may be an immunogenic molecule, or an immunomodulator, or an anti-inflammatory agent, such as an agent described in U.S. Patent Publication No. 2009/0004104, which is hereby incorporated by reference in its entirety.
- the agent may be an opioid molecule, such as, for example oxycodone, morphine, or codeine, such as described in U.S. Provisional Application No. 61/597,898, which is hereby incorporated by reference.
- the chemical conjugate may be through a cleavable linker, for which numerous types are known in the art. See U.S. Pat. No. 6,328,996, which is hereby incorporated by reference in its entirety.
- sustained release formulations including a therapeutic agent disclosed herein and one or more pharmaceutically acceptable excipients and/or diluents.
- excipients include salts, and other excipients that may act to stabilize hydrogen bonding.
- Any appropriate excipient known in the art may be used.
- Exemplary excipients include, but are not limited to, amino acids such as histidine, glycine, or arginine; glycerol; sugars, such as sucrose; surface active agents such as polysorbate 20 and polysorbate 80; citric acid; sodium citrate; antioxidants; salts including alkaline earth metal salts such as sodium, potassium, and calcium; counter ions such as chloride and phosphate; sugar alcohols (e.g.
- mannitol e.g. mannitol
- preservatives e.g. sugar alcohols
- sugar alcohols e.g. mannitol, sorbitol
- buffering agents e.g. mannitol, sorbitol
- Exemplary salts include sodium chloride, potassium chloride, magnesium chloride, calcium chloride, sodium phosphate dibasic, sodium phosphate monobasic, sodium phosphate, and potassium phosphate.
- the therapeutic agent is formulated at a pH, ionic strength, and generally with excipients sufficient to enable the formation of the matrix at body temperature (e.g., 37° C., or at from 34 to 36° C. in some embodiments).
- the therapeutic agent is generally prepared such that it does not form the matrix at storage conditions.
- the formulation can be stored frozen, refrigerated or at room temperature. Storage conditions are generally less than the transition temperature of the formulation, such as less than about 32° C., or less than about 30° C., or less than about 27° C., or less than about 25° C., or less than about 20° C., or less than about 15° C.
- the formulation may be isotonic with blood or have an ionic strength that mimics physiological conditions.
- the formulation may have an ionic strength of at least that of 25 mM Sodium Chloride, or at least that of 30 mM Sodium chloride, or at least that of 40 mM Sodium Chloride, or at least that of 50 mM Sodium Chloride, or at least that of 75 mM Sodium Chloride, or at least that of 100 mM Sodium Chloride, or at least that of 150 mM Sodium Chloride.
- the formulation has an ionic strength equivalent to that of 0.9% saline (154 mM sodium chloride).
- the formulation is stable at storage conditions. Stability can be measured using any appropriate means in the art. Generally, a stable formulation is one that shows less than a 5% increase in degradation products or impurities. In some embodiments, the formulation is stable for at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, or at least about one year or more at the storage conditions. In some embodiments, the formulation is stable for at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, or at least about one year or more at 25° C.
- the formulation includes two or more of calcium chloride, magnesium chloride, potassium chloride, potassium phosphate monobasic, sodium chloride, sodium phosphate dibasic, sodium phosphate monobasic, histidine, arginine, glycine, glycerol, antimicrobial preservative (e.g. metacresol), tonicity-adjusting agent (e.g. mannitol), glacial acetic acid, sodium acetate trihydrate; sucrose, carboxymethylcellulose sodium, sodium phosphate monobasic monohydrate, sodium phosphate dibasic heptahydrate, zinc, m-cresol, phenol, sorbitol, polysorbate 80, and polysorbate 20.
- the formulation does not include carboxymethylcellulose.
- the formulation includes histidine or another amino acid at a range of about 10 mM to about 100 mM histidine. In some embodiments, the formulation includes histidine or another amino acid at a range of about 10 mM to about 30 mM histidine. In some embodiments, the formulation includes histidine or another amino acid at a range of about 15 mM to about 25 mM histidine. In some embodiments, the formulation includes NaCl at a range of about 10 mM to about 165 mM NaCl. In some embodiments, the formulation includes between about 50 mM and about 165 mM NaCl. In some embodiments, the formulation includes between about 54 mM and about 162 mM NaCl.
- the formulation includes between about 110 mM and about 162 mM NaCl. In some embodiments, the formulation includes sodium phosphate at a range of about 1 mM to about 20 mM. In some embodiments, the formulation includes sodium phosphate at a range of about 5 mM to about 15 mM. In some embodiments, the formulation includes sodium phosphate monobasic at a range of about 2 mM to about 10 mM. In some embodiments, the formulation includes sodium phosphate monobasic at a range of about 4 mM to about 8 mM. In some embodiments, the formulation includes sodium phosphate dibasic at a range of about 1 mM to about 10 mM.
- the formulation includes sodium phosphate dibasic at a range of about 2 mM to about 7 mM. In some embodiments, the formulation includes sodium phosphate dibasic at a range of about 2 mM to about 5 mM. In some embodiments, the formulation includes polysorbate 20 at a range of about 0.01% to about 0.2%. In some embodiments, the formulation includes polysorbate 80 at a range of about 0.01% to about 0.2%. In some embodiments, the formulation includes sodium phosphate, sodium chloride, sodium phosphate monobasic, sodium phosphate dibasic, and Polysorbate 20. In some embodiments, the formulation includes about 10 mM sodium phosphate (about 7 mM sodium phosphate monobasic and about 3 mM sodium phosphate dibasic), about 110 mM sodium chloride, and about 0.1% polysorbate 20.
- the formulation is formulated at physiological pH. In some embodiments, the formulation is formulated at a pH in the range of about 5.5 to about 7.5. In some embodiments, the formulation is formulated at a pH in the range of about 6.0 to about 7.0. In some embodiments, the formulation is formulated at a pH in the range of about 6.5 to about 7.0. In some embodiments, formulations with a lower pH demonstrate improved formulation stability compared to formulations at a higher pH. In some embodiments, formulations with a pH of about 6.5 demonstrate improved stability compared to formulations with a pH of about 7.0. In some embodiments, formulations with a pH of about 6.0 demonstrate improved stability compared to formulations with a pH of about 6.5.
- formulations with a lower pH maintain a higher percentage of monomers compared to formulations at a higher pH.
- formulations with a pH of about 6.5 maintain a higher percentage of monomers compared to formulations with a pH of about 7.0.
- formulations with a pH of about 6.0 maintain a higher percentage of monomers compared to formulations with a pH of about 6.5.
- the protein concentration of the therapeutic agent in the formulation is tailored to drive the formation of the matrix at the temperature of administration. For example, higher protein concentrations help drive the formation of the matrix, and the protein concentration needed for this purpose varies depending on the ELP series used.
- the protein in embodiments using an ELP1-120, or amino acid sequences with comparable transition temperatures, is present in the range of about 1 mg/mL to about 200 mg/mL, or is present in the range of about 30 mg/mL to about 150 mg/mL.
- the protein is present in the range of about 0.005 mg/mL to about 10 mg/mL, or is present in the range of about 0.01 mg/mL to about 5 mg/mL.
- the therapeutic agent may be present in the range of about 0.5 mg/mL to about 200 mg/mL, or is present in the range of about 30 mg/mL to about 150 mg/mL. In some embodiments, the therapeutic agent is present in the range of about 50 mg/mL to about 125 mg/mL, or the range of about 75 mg/mL to about 110 mg/mL. In some embodiments, the therapeutic agent is present at a concentration of about 100 mg/mL.
- the disclosure provides a method for delivering a sustained release regimen of an active agent disclosed herein.
- the method includes administering the pharmaceutical composition described herein to a subject in need, wherein the pharmaceutical composition is administered from about 1 to about 8 times per month.
- the pharmaceutical composition is administered about 1 time, about 2 times, about 3 times, and/or about 4 times per month.
- the pharmaceutical composition is administered weekly.
- the pharmaceutical composition is administered daily.
- the pharmaceutical composition is administered from one to three times weekly.
- the pharmaceutical composition is administered once every two weeks.
- the pharmaceutical composition is administered from one to two times a month.
- the pharmaceutical composition is administered about 1 time per month.
- the pharmaceutical composition is administered about once every 2 months, about once every 3 months, about once every 4 months, about once every 5 months, and/or about once every 6 months.
- the pharmaceutical composition can be packaged in the form of pre-filled pens or syringes for administration once per week, twice per week, or from one to eight times per month, or alternatively filled in conventional vials and the like.
- the formulation is administered about monthly, and may be administered subcutaneously or intramuscularly. In some embodiments, the formulation is administered about weekly, and may be administered subcutaneously or intramuscularly.
- the site of administration is not a pathological site, for example, is not the intended site of action.
- the pharmaceutical compositions disclosed herein are administered chronically. In some embodiments, the pharmaceutical compositions disclosed herein are administered for about 6 months, for about 7 months, for about 8 months, for about 9 months, for about 10 months, for about 11 months, for about 1 year, for about 2 years, for about 3 years, for about 4 years, for about 5 years, for about 10 years or more.
- the pharmaceutical compositions may be administered at any required dose and/or frequency disclosed herein.
- the pharmaceutical compositions disclosed herein are administered until disease or disorder symptoms improve. In some embodiments, the pharmaceutical compositions disclosed herein are administered until disease or disorder symptoms are ameliorated, delayed, and/or cured.
- the pharmaceutical compositions disclosed herein are administered before the patient begins to exhibit one or more disease or disorder symptoms. In some embodiments, the pharmaceutical compositions disclosed herein are administered at the onset of disease or disorder symptoms.
- the therapeutic agent is formulated generally for “systemic delivery,” meaning that the agent is not delivered locally to a pathological site or a site of action. Instead, the agent is absorbed into the bloodstream from the injection site, where the agent acts systemically or is transported to a site of action via the circulation.
- the therapeutic agent may be administered by any known route, such as for example, orally, intravenously, intramuscularly, nasally, subcutaneously, intra-vaginally, and intra-rectally.
- the formulation is generally for subcutaneous administration.
- the pharmacokinetic (PK) parameters are prolonged when the agent is administered subcutaneously.
- the half-life of the fusion protein is prolonged.
- the PK parameters when the agent is administered subcutaneously are prolonged compared with the agent administered by other means (e.g. intravenously).
- the depot of the agent is prolonged when the agent is administered subcutaneously compared with the agent administered by other means (e.g. intravenously).
- the compositions provide for prolonged pharmacokinetic exposure due to sustained release of the active agent.
- the maximal exposure level may be achieved at about 10 hours, about 24 hours, about 48 hours or about 72 hours after administration; typically the maximum exposure level is achieved between about 10 hours and about 48 hours after administration.
- the compositions may achieve a sustained rate of release whereby a substantial percentage of the maximal level is obtained for a period of time.
- the sustained rate may about 50%, about 60%, about 70%, about 80%, about 90% or about 100% of the maximal exposure level.
- Exemplary periods of time for maintaining the sustained rate are about 3 days, about 4 days, about 5 days, about 6 days, about 1 week, about 2 weeks, about 4 weeks, about 6 weeks, or about 8 weeks, after the maximal exposure level is achieved. Subsequently, the sustained rate may lower to a reduced exposure rate. Such reduced exposure rates may be about 5%, about 10%, about 20%, about 30%, about 40%, about 50% or about 60% of the maximal exposure level.
- FIG. 20B illustrates an embodiment (PE0256) whereby a maximal exposure level of 1000 ng/mL is obtained within about 1-2 days. After this period, a sustained rate of about 70-100% of the maximal exposure level is maintained until about days 10-12 whereupon a reduced exposure rate from about 60% decreasing down to about 10% is obtained for the remainder of the study.
- the plasma concentration of the active agent does not change by more than a factor of about 20, or a factor of about 10, or a factor of about 5, or a factor of about 3 over the course of a plurality of administrations, such as at least 2, at least about 5, or at least about 10 administrations of the formulation. In some embodiments, the plasma concentration of the active agent does not change by more than a factor of about 20, or a factor of about 10, or a factor of about 5, or a factor of about 3 between each administration. In some embodiments, there is some accumulation until steady state is reached (e.g. after about 3 to about 4 administrations).
- the administrations are substantially evenly spaced, such as, for example, about daily, or about once per week, or from one to about five times per month, or about once every two months, or about once every three months.
- the dose may be steadily increased over several administrations, so steady state is reached after 5 or more administrations.
- a suitable dose of the therapeutic agent for achievement of therapeutic benefit may, for example, be in a range of about 1 microgram ( ⁇ g) to about 100 milligrams (mg) per kilogram body weight of the recipient per dose, preferably in a range of about 10 ⁇ g to about 50 mg per kilogram body weight per dose and most preferably in a range of about 10 ⁇ g to about 50 mg per kilogram body weight per dose.
- the pharmaceutical composition is administered at a low dose.
- the pharmaceutical composition is administered at a dose between 1 mg per kilogram per body weight per dose to about 9 mg per kilogram per body weight per dose. In some embodiments, the pharmaceutical composition is administered at about 1 mg per kilogram body weight per dose, about 3 mg per kilogram body weight per dose, and/or about 9 mg per kilogram body weight per dose.
- the desired dose may be presented as one dose or two or more sub-doses administered at appropriate intervals throughout the day. These sub-doses can be administered in unit dosage forms, for example, containing from about 10 ⁇ g to about 1000 mg, preferably from about 50 ⁇ g to about 500 mg, and most preferably from about 50 ⁇ g to about 250 mg of active ingredient per unit dosage form. Alternatively, if the condition of the recipient so requires, the doses may be administered as a continuous infusion.
- the subject is a human, but in other embodiments may be a non-human mammal, such as a domesticated pet (e.g., dog or cat), or livestock or farm animal (e.g., horse, cow, sheep, or pig).
- a domesticated pet e.g., dog or cat
- livestock or farm animal e.g., horse, cow, sheep, or pig
- the word “include,” and its variants, is intended to be non-limiting, such that recitation of items in a list is not to the exclusion of other like items that may also be useful in the materials, compositions, devices, and methods of this technology.
- the terms “can” and “may” and their variants are intended to be non-limiting, such that recitation that an embodiment can or may comprise certain elements or features does not exclude other embodiments of the present technology that do not contain those elements or features.
- half-life (which generally refers to in vivo half-life or circulatory half-life) is the period of time that is required for a 50% diminution of bioactivity of the active agent to occur. In some embodiments, this term includes both prolonged exposure and a long half-life (e.g. both a slow uptake from the injection site and retardation of clearance compared to the unconjugated peptide).
- FIG. 1 illustrates the phase transition property exhibited by certain amino acid sequences.
- FIG. 2 illustrates the phase transition property exhibited by certain amino acid sequences.
- Phase transition can be observed as an increase in turbidity.
- FIG. 3 illustrates, without wishing to be bound by theory, a potential mechanism for phase transition, driven by exclusion of a water shell and formation of hydrogen bonds at a temperature above the phase transition temperature for a given concentration.
- Changing the amino acid in the guest residue position X in the VPGXG (SEQ ID NO:3) sequence of the ELP motif can change stability or strength of a coacervate of an ELP biopolymer in the transitioned state, resulting in slower release of drug and a prolonged depot when dosed subcutaneously.
- a collection of ELP biopolymers with different coacervation strengths was built by changing the ratio of guest amino acids used in nine VPGXG (SEQ ID NO:3) pentamer (9mer) blocks (alpha, beta, and beta v2).
- a pentamer with the motif XPGVG (SEQ ID NO:3) was also constructed (delta).
- the ELP pentamers can be combined to any length but for exemplification and ease of DNA synthesis and manipulation subunits of 9 ELP pentamers (9mers) were constructed. These 9mers can be combined to make polymers of any length but the overall ratio of valine to other amino acids at the guest residue position will remain the same.
- FIG. 4 shows an alignment of these 9mers (alpha, beta, beta v2, and delta).
- the 9mers were designed to create ELP biopolymers with hydrophobicity and thus transition temperatures between the ELP 1 series (VPGXG (SEQ ID NO:3): V5A2G3) and ELP 4 series (VPGXG (SEQ ID NO:3): V-5) biopolymers previously examined. Another ELP polymer was developed which is not depicted in FIG.
- This polymer includes the VPGXG pentamer motif with a ratio of V5:A2:G2.
- Table 1 compares the ratios of guest residue occupancy between 9mers of the new ELP series and the 1 and 4 series.
- FIG. 5 illustrates this ligation technique.
- the 9mers were synthesized (Integrated DNA Technologies, Coralville, Iowa) in a background vector (pIDT) to create synthesis vectors. These synthesis vectors were cut with BglI/PflMI restriction enzymes and sub-cloned back into the same synthesis vector cut with BglI and dephosphorylated. This gives a vector containing two copies of the 9mer. This doubling technique was continued until vectors containing 16 copies of the 9mer (144mer) were built.
- ELPs of varying numbers of 9mers can be combined to produce ELPs with, for instance, 18, 27, 36, 45, 54, 63, 72, 81, 90, 99, 108, 117, 126, 135, 144, 153, 162, 171, 180 copies of the 9mer.
- the units described in Table 1 can also be combined in various ratios to produce additional ELP biopolymers with intermediate characteristics.
- the gamma ELP polymer was constructed by alternating between an alpha 9mer and a beta 9mer until a 144mer was constructed. These ELP 144mers were then sub-cloned into a pET-based intermediate vector, pPE0248 ( FIG. 6 ) which contains a linker region ( FIG.
- pPE0248 adds an additional pentamer repeat to the N terminus of the 144mer with valine in the guest position and an additional pentamer to the C terminus with a tryptophan in the guest residue.
- the tryptophan may be used as a means to increase the extinction coefficient of the molecule, allowing for better measurement of absorbance, for instance at 280 nm, which can be useful for determination of protein concentration, or for monitoring protein content during purification.
- the pentamers added to either end can also be designed so as the encoding DNA contains restriction enzyme recognition sites for cloning of fusion partners on to either end of the ELP coding sequence.
- FIGS. 8 through 17 contain the ELP amino acid sequences of the biopolymers and maps of the vectors.
- the GLP-1 peptide was cloned onto the N-terminus of different ELP sequences.
- a synthesized GLP-1 gene was digested XbaI/BsrGI and cloned XbaI/Acc65i into pPE0249, pPE0250, pPE0362, pPE0251, and pPE0252 making vectors pPE0253 (GLP-1:ELPalpha-144), pPE254 (GLP-1:ELPbetaV1-144), pPE0311 (GLP-1:ELPbetaV2-144), pPE0255 (GLP-1:ELPgamma-144), pPE0256 (GLP-1:ELPdelta-144) respectively.
- ELPalpha-144, ELPbetaV1-144, ELPbetaV2-144, ELPgamma-144, and ELPdelta-144 fall between, but do not include, the temperatures for the series 4 ELPs (PE0002) and the series 1 ELPs (PB1023).
- FIG. 19 and Table 4 display the PK results of non-na ⁇ ve monkeys, 1 male and 1 female per group, each dosed with a single subcutaneous injection of 20 mg/kg of either PE0253, PE0254, PE0255, or PE0256.
- FIG. 20 and Table 5 show the PK results of a single subcutaneous dose of PE0256 at 10 mg/kg into four protein na ⁇ ve monkeys, 2 male and 2 female.
- FIG. 21 and Table 6 demonstrate the PK results of a single subcutaneous dose of PE0311 at 10 mg/kg into three protein na ⁇ ve monkeys, all male.
- FIG. 22 and Table 7 show the PK results of non-na ⁇ ve monkeys dosed with a single IV injection of PE0256 at 2 mg/kg.
- hGH human growth hormone
- an ELP1 30mer was appended to the C-terminus of the fusion protein in pPE0429 to provide plasmid pPE0430. Adding the ELP1 30mer disrupts receptor mediated clearance and thus further increases circulatory half-life of the hGH fusion protein.
- FIG. 27 shows the plasmid map for plasmid pPE0430.
- FIG. 28 shows the sequence of the fusion protein.
- FIG. 25 shows the plasmid map for plasmid pPE0431, prepared by inserting hGH into the pPB1031, providing a ELP1 series 120mer with a C-terminal hGH sequence.
- FIG. 26 shows the sequence of the fusion protein.
- the ELP1 120mer protein was inserted into the plasmid pPE0431 to append an ELP1 30mer protein to the C-terminus of the ELP1-120 hGH fusion protein.
- the resulting plasmid was termed pPE0432.
- FIG. 29 The resulting amino acid sequence of the ELP1-120mer-hGH-ELP1 30mer is shown in FIG. 30 .
- FIG. 31 shows the plasmid map of pPE0364.
- FIG. 32 shows the sequence of the fusion protein. This construct provides an ELP with 16 repeats of the ELPbetaV2 9mer.
- PK results from non-na ⁇ ve monkeys 1 male and 1 female per group, each dosed with a single subcutaneous injection of 20 mg/kg of either PE0253 (alpha), PE0254 (beta v1), PE0255 (gamma), or PE0256 (delta).
- PK results (ng/mL) from of a single subcutaneous dose of PE0256 (delta) at 10 mg/kg into four protein naive monkeys, 2 male and 2 female.
- PK results (ng/mL) Hours Days M1 M2 F1 F2 0 0 blq 17 blq blq 1 0.042 232 94 52.9 241 3 0.125 482 217 176 596 6 0.25 492 257 277 831 24 1 997 374 1030 1610 48 2 1260 677 1630 1640 72 3 1130 875 1780 1660 168 7 1230 1140 1620 1210 240 10 1540 783 1220 1030 336 14 27 617 440 758 408 17 blq 395 102 587 504 21 blq 128 16.6 383 576 24 blq 38.3 blq 348 672 28 blq 5.6 3.6 230 720 30 blq blq blq 97.5
- PK Results (ng/mL) Time (hrs) Days 1M1 1M2 1M3 Average SD 0 0 BLQ BLQ BLQ 0 0 1 0.042 230 206 181 205.7 24.5 3 0.125 826 426 368 540.0 249.4 6 0.25 1050 360 355 588.3 399.8 24 1 619 333 533 495.0 146.7 48 2 702 548 621 623.7 77.0 72 3 1340 695 799 944.7 346.3 168 7 2110 1270 1640 1673.3 421.0 240 10 1370 1130 726 1075.3 325.5 336 14 1150 224 393 589.0 493.1 408 17 1690 24.8 290 668.3 894.7 504 21 908 BLQ 133 520.5 548.0 576 24 289 BLQ 68.9 179.
- PE0256 (delta) Time (Hours) 914 915 Average 0 BLQ BLQ BLQ 0.083 31300 30400 30850 0.25 28600 29400 29000 0.5 30400 29000 29700 0.75 25500 26500 26000 1 25900 23600 24750 2 22200 18800 20500 3 19300 16400 17850 6 15500 12000 13750 24 4700 2960 3830 48 1120 434 777 72 334 48.6 191.3 96 57.6 5.38 31.49 120 9.81 BLQ 9.81 144 BLQ BLQ BLQ 168 BLQ BLQ BLQ
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Endocrinology (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Inorganic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Diabetes (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Epoxy Compounds (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
- Saccharide Compounds (AREA)
Abstract
Description
- This application is a continuation of U.S. application Ser. No. 15/527,985, filed May 18, 2017; which is a U.S. National Phase of PCT/US2015/061955, filed Nov. 20, 2015; which claims benefit of Provisional U.S. Application No. 62/082,945, filed Nov. 21, 2014 and Provisional U.S. Application No. 62/098,624 filed Dec. 31, 2014, the contents of each of which are incorporated by reference in their entireties for all purposes.
- The present disclosure relates to pharmaceutical formulations for sustained release, and methods for delivering a treatment regimen with the sustained release formulations.
- The contents of the text file submitted electronically herewith are incorporated herein by reference in their entirety: a computer readable format copy of the sequence listing (filename: PHAS_031_03US_SEQLIST_ST25.TXT, date recorded: Jul. 27, 2020, file size 69 kilobytes).
- The effectiveness of peptide and small molecule drugs is often limited by the half-life of such drugs in the circulation, as well as difficulties in obtaining substantially constant plasma levels. For example, the incretin GLP-1 must be administered at relatively high doses to counter its short half-life in the circulation, and these high doses are associated with nausea, among other things. Murphy and Bloom, Nonpeptidic glucagon-
like peptide 1 receptor agonists: A magic bullet for diabetes? PNAS 104 (3):689-690 (2007). Further, the peptide agent vasoactive intestinal peptide (VIP) exhibits a half-life, in some estimates, of less than one minute, making this agent impractical for pharmaceutical use. Domschke et al., Vasoactive intestinal peptide in man: pharmacokinetics, metabolic and circulatory effects, Gut 19:1049-1053 (1978); Henning and Sawmiller, Vasoactive intestinal peptide: cardiovascular effects, Cardiovascular Research 49:27-37 (2001). A short plasma half life for peptide drugs is often due to fast renal clearance as well as to enzymatic degradation during systemic circulation. - Strategies for improving the pharmacokinetics of peptide and small molecule drugs are in great demand.
- The present disclosure provides pharmaceutical formulations for sustained release, and methods for delivering a treatment regimen with the sustained release formulations. The disclosure thereby provides improved pharmacokinetics for peptide and small molecule drugs.
- In some aspects, the disclosure provides a sustained release pharmaceutical formulation. The formulation includes a therapeutic agent for systemic administration, where the therapeutic agent includes an active agent and an amino acid sequence capable of forming a reversible matrix at the body temperature of a subject. The reversible matrix is formed from hydrogen bonds (e.g., intra- and/or intermolecular hydrogen bonds) as well as from hydrophobic contributions. The formulation further includes one or more pharmaceutically acceptable excipients and/or diluents. The matrix provides for a slow absorption to the circulation from an injection site. The sustained release, or slow absorption from the injection site, is due to a slow reversal of the matrix as the concentration dissipates at the injection site. Once product moves into the circulation, the formulation confers long half-life and improved stability. Thus, a unique combination of slow absorption and long half-life is achieved leading to a desirable PK profile with a shallow peak to trough ratio and/or long Tmax.
- In certain embodiments, the amino acid sequence capable of forming a reversible matrix at the body temperature of a subject is an Elastin-Like-Protein (ELP) sequence. The ELP sequence includes or consists of structural peptide units or sequences that are related to, or mimics of, the elastin protein. The ELP amino acid sequence may exhibit a visible and reversible inverse phase transition with the selected formulation. That is, the amino acid sequence may be structurally disordered and highly soluble in the formulation below a transition temperature (Tt), but exhibit a sharp (2-3° C. range) disorder-to-order phase transition when the temperature of the formulation is raised above the Tt. In some embodiments, the present disclosure provides therapeutic agents having transition temperatures between about 26° C. and about 37° C. In addition to temperature, length of the ELP polymer, amino acid composition of the ELP, ionic strength, pH, pressure, selected solvents, presence of organic solutes, and protein concentration may also affect the transition properties, and these may be tailored for the desired absorption profile. In some embodiments the protein concentration and salt concentration affect the transition properties (e.g. transition temperature). Exemplary sequences or structures for the ELP amino acid sequence forming the matrix are disclosed herein.
- In certain embodiments, the active agent for systemic administration is a protein or peptide, which may have a short circulatory half-life, such as from about 30 seconds to about 1 hour, to about 2 hours, or to about 5 hours. In some embodiments, the protein or peptide has a circulatory half-life of from 30 seconds to about 10 hours. The therapeutic agent may be a recombinant fusion protein between the protein active agent and the amino acid sequence capable of forming the matrix. Exemplary peptide active agents include GLP-1 receptor agonists (e.g., GLP-1 or derivative thereof), exendin-4 or derivatives thereof, glucagon receptor agonists (e.g. glucagon, oxyntomodulin or derivatives thereof), VPAC2 selective agonists (e.g. vasoactive intestinal peptide (VIP) or derivatives thereof), GIP receptor agonists (e.g. glucose-dependent insulinotropic peptide (GIP) or derivatives thereof), insulin or derivatives thereof, a clotting factor, such as Factor VII, Factor VIII, or Factor IX, or a growth hormone receptor agonist (e.g., human growth hormone (hGH), or functional derivatives thereof). Peptide active agents include sequences that activate more than one receptor, for instance dual agonists of GLP-1 and glucagon receptors, dual agonists of GLP-1 and GIP receptors, or triple agonists able to activate GLP-1, GIP and glucagon receptors. Other protein and small molecule drugs for delivery in accordance with the disclosure are disclosed herein. By providing a slow absorption from the injection site, renal clearance and degradation can be controlled, thereby achieving the desired PK profile.
- In other aspects, the disclosure provides methods for delivering a sustained release regimen of an active agent. The methods include administering the formulation described herein to a subject in need, wherein the formulation is administered from about 1 to about 8 times per month. In some embodiments, the formulation is administered about weekly, and may be administered subcutaneously or intramuscularly (for example). In some embodiments, the site of administration is not a pathological site, that is, the therapeutic agent is not administered directly to the intended site of action.
-
FIG. 1 shows the phase transition (as shown by an increase in turbidity) of an ELP1 protein, induced by a change in temperature to 37° C. or above. This property provides for a slow absorption from an injection site. -
FIG. 2 shows the phase transition (as shown by an increase in turbidity) of an ELP4 protein, induced by a change in temperature to 25° C. or above. This property provides for a depot-like delivery. -
FIG. 3 illustrates, without wishing to be bound by theory, a potential mechanism for the observed transition, in which a water shell is excluded under certain conditions, allowing for hydrogen bonds to form. -
FIG. 4 shows the amino acid alignment of ELP 9mers (alpha, beta V1, betaV2, and delta). In this example, each ELP unit consists of nine copies of the VPGXG SEQ ID NO: 3) ELP pentamer motif, or the XPGVG (SEQ ID NO: 13) ELP pentamer motif with three guest residue amino acids in different ratios. -
FIG. 5 shows a recursive ligation strategy used to make ELP polymers. The ELP pentamer polymer insert can continually be doubled in size using recursive ligation. The PflMI and BglI sites have homologous overhangs but when ligated the PflMI site is destroyed. This allows the newly constructed ELP to be doubled again using the same digestion strategy. -
FIG. 6 shows the pPE0248 plasmid map. -
FIG. 7 shows the pPE0248 linker. This linker allows the insertion of a VPGXG (SEQ ID NO:3) repeat polymer in frame of an initiator methionine and two stop codons for expression and termination using the unique Bgl I restriction enzyme site. N-terminal fusions can be subsequently added using the unique Xba I and Acc65i sites. -
FIG. 8 shows the amino acid sequence of the ELP alpha 144mer biopolymer. -
FIG. 9 shows the pPE0249 plasmid map. -
FIG. 10 shows the amino acid sequence of the ELP beta v1 144mer biopolymer. -
FIG. 11 shows the pPE0250 plasmid map. -
FIG. 12 shows the amino acid sequence of the ELP beta v2 144mer biopolymer. -
FIG. 13 shows the pPE0362 plasmid map. -
FIG. 14 shows the amino acid sequence of the ELP gamma 144mer biopolymer. -
FIG. 15 shows the pPE0251 plasmid map. -
FIG. 16 shows the amino acid sequence of the ELP delta 144mer biopolymer. -
FIG. 17 shows the pPE0252 plasmid map. -
FIG. 18 shows the raw Cary turbidity data of the different ELP biopolymers after administration at 10 mg/mL. -
FIG. 19 shows the PK results from non-naïve monkeys, 1 male and 1 female per group, each dosed with a single subcutaneous injection of 20 mg/kg of either PE0253 (alpha), PE0254 (beta v1), PE0255 (gamma), or PE0256 (delta). -
FIGS. 20A and B show the PK results of a single subcutaneous dose of PE0256 (delta) at 10 mg/kg into four protein naïve monkeys, 2 male and 2 female. Figure A shows the data from the individual animals while Figure B shows the mean. -
FIGS. 21A and B show the PK results of a single subcutaneous dose of PE0311 (beta v2) at 10 mg/kg into three protein naïve monkeys, all male. Figure A shows the data from the individual animals while Figure B shows the mean. -
FIG. 22 shows the PK results of non-naïve monkeys dosed with a single IV injection of PE0256 (delta) at 2 mg/kg. -
FIG. 23 shows a plasmid map of the vector pPE0429, which contains an hGH sequence inserted into plasmid pPE0362. The synthesized hGH sequence was digested with restriction enzymes PflMI/Bgl I and sub cloned into the Bgl I site in plasmid pPE0362. -
FIG. 24 shows an amino acid sequence for an ELPbetaV2-144-hGH fusion protein (SEQ ID NO:14). The hGH (underlined) is fused to the ELP beta v2-144 sequence (bold). A single ELP pentamer (italics) remains on the C-terminus and conserves a Bgl I restriction site. The site may be used for further cloning steps. -
FIG. 25 shows a plasmid map of the vector pPE0431, which contains an ELP1 series 30mer sequence inserted into plasmid pPE0429, which places the ELP1 series 120mer at the N-terminus of the hGH sequence. -
FIG. 26 shows the amino acid sequence of the ELP1-120mer hGH fusion protein (SEQ ID NO:15). The hGH sequence (underlined) is fused to theELP 1 series 120mer sequence (bold). -
FIG. 27 shows a plasmid map of the vector pPE0430, which contains an ELP1 series 30mer sequence inserted into plasmid pPE0429, which places the ELP1 series 30mer at the C-terminus of the ELPbetaV2-144-hGH sequence. Adding the ELP1 series 30mer disrupts receptor mediated clearance and thus further increases circulatory half-life of the ELPbetaV2-144 hGH fusion protein. -
FIG. 28 shows an amino acid sequence for an ELPbetaV2-144-hGH fusion protein with an ELP1 series 30mer (SEQ ID NO:16). The hGH (underlined) is fused to the ELP beta v2-144 sequence (bold). The ELP1 series 30mer (italics) is at the C-terminus of the ELPbetaV2-144-hGH sequence. -
FIG. 29 shows a plasmid map of the vector pPE0432, which contains an ELP1 series 30mer sequence inserted into plasmid pPE0431, which places the ELP1 series 30mer at the C-terminus of the ELP1-120-hGH sequence. Adding the ELP1 series 30mer disrupts receptor mediated clearance and thus further increases circulatory half-life of the ELP1 series hGH fusion protein. -
FIG. 30 shows the amino acid sequence of the ELP1-120 hGH fusion protein with an ELP1-30mer on the C-terminus (SEQ ID NO:17). The hGH sequence (underlined) is fused to theELP 1 series 120mer sequence (bold) and the ELP1-30 sequence (italics). -
FIG. 31 shows a plasmid map of the vector pPE0364, which contains a beta v2 series 144mer sequence. The synthesized exendin-4 sequence was digested with restriction enzymes XbaI/BsrGI and sub cloned into the plasmid pPE0362 digested XbaI/Acc65i. -
FIG. 32 shows the amino acid sequence of the exendin-4 ELPbeta V2 fusion protein with an ELPbeta V2-144mer on the C-terminus (SEQ ID NO:18). The exendin-4 sequence (underlined) is fused to the ELPbeta V2-144mer sequence. - The present disclosure provides pharmaceutical formulations for sustained release, and methods for delivering a treatment regimen with the sustained release formulations. In certain embodiments, the pharmaceutical compositions disclosed herein have enhanced efficacy, bioavailability, therapeutic half-life, persistence, degradation assistance, etc. The disclosure thereby provides improved pharmacokinetics for active agents, such as peptides and small molecule drugs, including a relatively flat PK profile with a low ratio of peak to trough, and/or a long Tmax. The PK profile can be maintained with a relatively infrequent administration schedule, such as from one to eight injections per month in some embodiments.
- In some aspects, the disclosure provides sustained release pharmaceutical formulations. The formulation includes therapeutic agents for systemic administration, where the therapeutic agent includes an active agent and an amino acid sequence capable of forming a matrix at the body temperature of a subject. The reversible matrix is formed from hydrogen bonds (e.g., intra- and/or intermolecular hydrogen bonds) as well as from hydrophobic contributions. The formulation further includes one or more pharmaceutically acceptable excipients and/or diluents. The matrix provides for a slow absorption to the circulation from an injection site. Without being bound by theory, this slow absorption is due to the slow reversal of the matrix as protein concentration decreases at the injection site. The slow absorption profile provides for a flat PK profile, as well as convenient and comfortable administration regimen. For example, in various embodiments, the plasma concentration of the active agent over the course of days (e.g., from 2 to about 60 days, or from about 4 to about 30 days) does not change by more than a factor of 10, or by more than a factor of about 5, or by more than a factor of about 3. Generally, this flat PK profile is seen over a plurality of (substantially evenly spaced) administrations, such as at least about 2, at least about 5, or at least about 10 administrations of the formulation. In some embodiments, the slow absorption is exhibited by a Tmax (time to maximum plasma concentration) of greater than about 5 hours, greater than about 10 hours, greater than about 20 hours, greater than about 30 hours, or greater than about 50 hours.
- Amino Acid Sequences Forming a Reversible Matrix
- The sustained release, or slow absorption from the injection site, is controlled by the amino acid sequence capable of forming a hydrogen-bonded matrix at the body temperature of the subject, as well as the components of the formulation.
- In some embodiments, the amino acid sequence contains structural units that form hydrogen-bonds through protein backbone groups and/or side chain groups, and which may contribute hydrophobic interactions to matrix formation. In some embodiments, the amino acid side chains do not contain hydrogen bond donor groups, with hydrogen bonds being formed substantially through the protein backbone. Exemplary amino acids include proline, alanine, valine, glycine, and isoleucine, and similar amino acids. In some embodiments, the structural units are substantially repeating structural units, so as to create a substantially repeating structural motif, and substantially repeating hydrogen-bonding capability. In these and other embodiments, the amino acid sequence contains at least about 10%, at least about 20%, at least about 40%, or at least about 50% proline, which may be positioned in a substantially repeating pattern. In this context, a substantially repeating pattern means that at least about 50% or at least about 75% of the proline residues of the amino acid sequence are part of a definable structural unit. In still other embodiments, the amino acid sequence contains amino acids with hydrogen-bond donor side chains, such as serine, threonine, and/or tyrosine. In some embodiments, the repeating sequence may contain from one to about four proline residues, with remaining residues independently selected from non-polar residues, such as glycine, alanine, leucine, isoleucine, and valine. Non-polar or hydrophobic residues may contribute hydrophobic interactions to the formation of the matrix.
- In other embodiments, the amino acid sequence capable of forming the matrix at body temperature may include a random coil or non-globular extended structure. For example, the amino acid sequence capable of forming the matrix at body temperature may comprise an amino acid sequence disclosed in U.S. Patent Publication No. 2008/0286808, WIPO Patent Publication No. 2008/155134, and U.S. Patent Publication No. 2011/0123487, each of which is hereby incorporated by reference.
- In some embodiments the amino acid sequence includes an unstructured recombinant polymer of at least 40 amino acids. The unstructured polymer may include more than about 100, about 150, about 200 or more contiguous amino acids. In some embodiments, the amino acid sequence forms a random coil domain. In particular, a polypeptide or amino acid polymer having or forming “random coil conformation” substantially lacks a defined secondary and tertiary structure. In some embodiments, the unstructured polymer is defined as a polymer having at least 40 amino acids where the total number of glycine (G), aspartate (D), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) residues constitutes more than about 80% of the total amino acids in the polymer. In some embodiments, at least 50% of the amino acids are devoid of secondary structure as determined by the Chou-Fasman algorithm.
- The amino acid sequences may form a “gel-like” state upon injection at a temperature higher than the storage temperature. Exemplary sequences have repeating peptide units, and/or may be relatively unstructured at the lower temperature, and achieve a hydrogen-bonded, structured, state at the higher temperature.
- Elastin-Like Peptides (ELPs)
- In some embodiments, the amino acid sequence capable of forming a matrix at body temperature is a peptide having repeating units of from four to ten amino acids. The repeating unit may form one, two, or three hydrogen bonds in the formation of the matrix. In certain embodiments, the amino acid sequence capable of forming a matrix at body temperature is an amino acid sequence of silk, elastin, collagen, keratin, or mimic thereof, or an amino acid sequence disclosed in U.S. Pat. No. 6,355,776, which is hereby incorporated by reference.
- In certain embodiments, the amino acid sequence is an Elastin-Like-Protein (ELP) sequence. The ELP sequence includes or consists of structural peptide units or sequences that are related to, or mimics of, the elastin protein. The ELP sequence is constructed from structural units of from three to about twenty amino acids, or in some embodiments, from about four to about ten amino acids, such as about four, about five or about six amino acids. The length of the individual structural units may vary or may be uniform. Exemplary structural units are defined by SEQ ID NOS: 1-13 (below), which may be employed as repeating structural units, including tandem-repeating units, or may be employed in some combination. Thus, the ELP may comprise or consist essentially of structural unit(s) selected from SEQ ID NOS: 1-13, as defined below.
- In some embodiments, including embodiments in which the structural units are ELP units, the amino acid sequence includes or consists essentially of from about 1 to about 500 structural units, or in certain embodiments about 9 to about 200 structural units, or in certain embodiments about 10 to 200 structural units, or in certain embodiments about 50 to about 200 structural units, or in certain embodiments from about 80 to about 200 structural units, or from about 80 to about 150 structural units. In some embodiments, the structural units are ELP units defined by one or more of SEQ ID NOs: 1-13. In some embodiments, the ELP includes a combination of units defined by SEQ ID NOS: 1-13.
- Thus, the structural units collectively may have a length of from about 50 to about 2000 amino acid residues, or from about 100 to about 800 amino acid residues, or from about 200 to about 700 amino acid residues, or from about 400 to about 600 amino acid residues. In exemplary embodiments, the amino acid sequence of the ELP structural unit includes or consists essentially of about 3 structural units, of about 7 structural units, of about 9 structural units, of about 10 structural units, of about 15 structural units, of about 20 structural units, of about 40 structural units, of about 80 structural units, of about 90 structural units, of about 100 structural units, of about 120 structural units, of about 140 structural units, about 144 structural units, of about 160 structural units, of about 180 structural units, of about 200 structural units, or of about 500 structural units. In exemplary embodiments, the structural units collectively have a length of about 45 amino acid residues, of about 90 amino acid residues, of about 100 amino acid residues, of about 200 amino acid residues, of about 300 amino acid residues, of about 400 amino acid residues, of about 500 amino acid residues, of about 600 amino acid residues, of about 700 amino acid residues, of about 800 amino acid residues, or of about 1000 amino acid residues.
- The amino acid sequence may exhibit a visible and reversible inverse phase transition with the selected formulation. That is, the amino acid sequence may be structurally disordered and highly soluble in the formulation below a transition temperature (Tt), but exhibit a sharp (2-3° C. range) disorder-to-order phase transition, or coacervation, when the temperature of the formulation is raised above the Tt. In addition to temperature, length of the amino acid polymer, amino acid composition, ionic strength, pH, pressure, selected solvents, presence of organic solutes, and protein concentration may also affect the transition properties, and these may be tailored in the formulation for the desired absorption profile. Absorption profile can be easily tested by determining plasma concentration or activity of the active agent over time.
- In certain embodiments, the ELP component(s) may be formed of structural units, including but not limited to:
-
- (a) the tetrapeptide Val-Pro-Gly-Gly, or VPGG (SEQ ID NO: 1);
- (b) the tetrapeptide Ile-Pro-Gly-Gly, or IPGG (SEQ ID NO: 2);
- (c) the pentapeptide Val-Pro-Gly-X-Gly (SEQ ID NO: 3), or VPGXG, where X is any natural or non-natural amino acid residue, and where X optionally varies among polymeric or oligomeric repeats;
- (d) the pentapeptide Ala-Val-Gly-Val-Pro, or AVGVP (SEQ ID NO: 4);
- (e) the pentapeptide Ile-Pro-Gly-X-Gly, or IPGXG (SEQ ID NO: 5), where X is any natural or non-natural amino acid residue, and where X optionally varies among polymeric or oligomeric repeats;
- (e) the pentapeptide Ile-Pro-Gly-Val-Gly, or IPGVG (SEQ ID NO: 6);
- (f) the pentapeptide Leu-Pro-Gly-X-Gly, or LPGXG (SEQ ID NO: 7), where X is any natural or non-natural amino acid residue, and where X optionally varies among polymeric or oligomeric repeats;
- (g) the pentapeptide Leu-Pro-Gly-Val-Gly, or LPGVG (SEQ ID NO: 8);
- (h) the hexapeptide Val-Ala-Pro-Gly-Val-Gly, or VAPGVG (SEQ ID NO: 9);
- (i) the octapeptide Gly-Val-Gly-Val-Pro-Gly-Val-Gly, or GVGVPGVG (SEQ ID NO: 10);
- (j) the nonapeptide Val-Pro-Gly-Phe-Gly-Val-Gly-Ala-Gly, or VPGFGVGAG (SEQ ID NO: 11);
- (k) the nonapeptides Val-Pro-Gly-Val-Gly-Val-Pro-Gly-Gly, or VPGVGVPGG (SEQ ID NO: 12); and
- (l) the pentapeptide Xaa-Pro-Gly-Val-Gly, or XPGVG (SEQ ID NO:13) where X is any natural or non-natural amino acid residue, and where X optionally varies among polymeric or oligomeric repeats.
- Such structural units defined by SEQ ID NOS: 1-13 may form structural repeating units, or may be used in combination to form an ELP. In some embodiments, the ELP component is formed entirely (or almost entirely) of one or a combination of (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10) structural units selected from SEQ ID NOS: 1-13. In other embodiments, at least about 75%, or at least about 80%, or at least about 90% of the ELP component is formed from one or a combination of structural units selected from SEQ ID NOS: 1-13, and which may be present as repeating units.
- In certain embodiments, the ELP contains repeat units, including tandem repeating units, of Val-Pro-Gly-X-Gly (SEQ ID NO: 3), where X is as defined above, and where the percentage of Val-Pro-Gly-X-Gly (SEQ ID NO: 3) units taken with respect to the entire ELP component (which may comprise structural units other than VPGXG (SEQ ID NO: 3)) is greater than about 50%, or greater than about 75%, or greater than about 85%, or greater than about 95% of the ELP. The ELP may contain motifs of 5 to 15 structural units (e.g. about 9 or about 10 structural units) of SEQ ID NO: 3, with the guest residue X varying among at least 2 or at least 3 of the units in the motif. The guest residues may be independently selected, such as from non-polar or hydrophobic residues, such as the amino acids V, I, L, A, G, and W (and may be selected so as to retain a desired inverse phase transition property). In certain embodiments, the guest residues are selected from V, G, and A.
- In certain embodiments, the ELP contains repeat units, including tandem repeating units, of Xaa-Pro-Gly-Val-Gly (SEQ ID NO: 13), where X is as defined above, and where the percentage of Xaa-Pro-Gly-Val-Gly (SEQ ID NO: 13) units taken with respect to the entire ELP component (which may comprise structural units other than XPGVG (SEQ ID NO: 13)) is greater than about 50%, or greater than about 75%, or greater than about 85%, or greater than about 95% of the ELP. The ELP may contain motifs of 5 to 15 structural units (e.g. about 9 or about 10 structural units) of SEQ ID NO: 13, with the guest residue X varying among at least 2 or at least 3 of the units in the motif. The guest residues may be independently selected, such as from non-polar or hydrophobic residues, such as the amino acids V, I, L, A, G, and W (and may be selected so as to retain a desired inverse phase transition property). In certain embodiments, the guest residues are selected from V and A.
- In certain embodiments, the ELP contains repeating units, including tandem repeating units of any of SEQ ID NOs: 1-13 either alone or in combination. In some embodiments, the ELP contains repeats of two or more of any of SEQ ID NOs: 1-13 in combination. In certain embodiments, the ELP contains repeats of SEQ ID NO: 3 and SEQ ID NO: 13. In some embodiments, the ELP contains repeats of SEQ ID NO: 3 and SEQ ID NO: 13, wherein the guest residues are independently selected, such as from non-polar or hydrophobic residues, such as the amino acids V, I, L, A, G, and W (and may be selected so as to retain a desired inverse phase transition property). In certain embodiments, the guest residues are selected from V, G, and A.
- In some embodiments, the ELP includes 9mers including nine copies of one or more ELP structural units disclosed herein. In some embodiments, the ELP includes 9mers including nine copies of a pentapeptide disclosed herein. In some embodiments, the ELP includes 9mers including SEQ ID NOs: 3 and 13 in any combination. In some embodiments, the ELP includes a sequence alternating between SEQ ID NOs: 3 and 13. ELPs of varying numbers of 9mers can be combined to produce ELPs with, for instance, 18, 27, 36, 45, 54, 63, 72, 81, 90, 99, 108, 117, 126, 135, 144, 153, 162, 171, or 180 copies of the 9mer.
- In certain embodiments, the ELP includes 9mers including SEQ ID NO: 3, wherein the guest residue is selected from V, G, and A. In certain embodiments, the ELP includes 9 mers including SEQ ID NO: 3, wherein V, G, and A are in the ratio of 7:2:0 (alpha). In certain embodiments, the ELP includes 9mers including SEQ ID NO:3, wherein V, G, and A are in the ratio of 7:0:2 (beta v1). In certain embodiments, the ELP includes 9mers including SEQ ID NO:3, wherein V, G, and A are in the ratio of 6:0:3 (beta v2). In certain embodiments, the ELP includes 9mers including SEQ ID NO:3, wherein V, G, and A are in the ratio of 5:2:2 (gamma). In certain embodiments, the ELP includes 9mers including SEQ ID NO: 13, wherein the guest residue is selected from V, G, and A. In certain embodiments, the ELP includes 9mers including SEQ ID NO:13, wherein V, G, and A are in the ratio of 5:0:4 (delta). Exemplary 9mers are disclosed in Table 1. Table 2 demonstrates the transition temperatures of several exemplary 9mers.
-
TABLE 1 Guest residue ratios in exemplary 9mers. The ELP polymers have hydrophobicities between the ELP 1 series (least hydrophobic) andthe ELP 4 series (most hydrophobic).ELP series Pentamer motif Guest residue ratio 1 series VPGXG (SEQ ID NO: 3) 5 Val:3 Gly:2 Ala alpha VPGXG (SEQ ID NO: 3) 7 Val:2 Gly:0 Ala beta v1 VPGXG (SEQ ID NO: 3) 7 Val:0 Gly:2 Ala beta v2 VPGXG (SEQ ID NO: 3) 6 Val:0 Gly:3 Ala gamma VPGXG (SEQ ID NO: 3) 5 Val:2 Gly:2 Ala delta XPGVG (SEQ ID NO: 13) 5 Val:0 Gly:4 Ala VPGXG (SEQ ID NO: 3) 6 Val:3 Gly:0 Ala VPGXG (SEQ ID NO: 3) 6 Val:2 Gly:1 Ala VPGXG (SEQ ID NO: 3) 6 Val:1 Gly:2 Ala VPGXG (SEQ ID NO: 3) 6 Val:0 Gly:3 Ala VPGXG (SEQ ID NO: 3) 7 Val:1 Gly:1 Ala VPGXG (SEQ ID NO: 3) 8 Val:0 Gly:1 Ala VPGXG (SEQ ID NO: 3) 8 Val:1 Gly:0 Ala 4 series VPGXG (SEQ ID NO: 3) 10 Val:0 Gly:0 Ala -
TABLE 2 Comparison of measured transition temperatures of exemplary 9mers. The inflection of turbidity measured using a Cary spectrophotometer is the result of the ELP biopolymer phase transitioning. ELP series (10 mg/ml) Transition temp 1 series (pPB1023) 37° C. alpha (pPE0253) 29° C. beta v1 (pPE0254) 28° C. beta v2 (pPE0311) 31° C. gamma (pPE0255) 29° C. delta (pPE0256) 35° C. 4 series (pPE0002) 26° C. - In some embodiments, the ELP includes combinations of the 9mers listed in Table 1. In some embodiments, the ELP includes combinations of the alpha, beta v1, beta v2, and/or delta 9mers. For example, the gamma ELP is constructed by alternating between an alpha 9mer and a beta v1 9mer for 16 copies until a 144mer is constructed. In certain embodiments, the ELP includes combinations of alpha and beta v1 9mers. In certain embodiments, the ELP includes combinations of alpha and beta v2 9mers. In certain embodiments, the ELP includes combinations of alpha and delta 9mers. In certain embodiments, the ELP includes combinations of beta v1 and beta v2 9mers. In certain embodiments, the ELP includes combinations of beta v1 and delta 9mers. In certain embodiments, the ELP includes combinations of beta v2 and delta 9mers. In certain embodiments, the ELP includes combinations of alpha, beta v1, and beta v2 9mers. In certain embodiments, the ELP includes combinations of alpha, beta v1, and delta 9mers. In certain embodiments, the ELP includes combinations of alpha, beta v2, and delta 9mers. For example, in particular arrangements, the ELPbeta v2 may include the following guest residues in structural units iterated in the following sequence: A-V-A-V-V-A-V-A-V (e.g. amino acid residues 2-10 of SEQ ID NO: 14). The iterated sequence may be repeated sequentially in the ELP about 10 times, about 15 times, about 16 times, about 20 times, about 25 times, about 30 times, or about 35 times or more. In some aspects, the ELP contains about 10 to about 20 iterated sequences. In other aspects, the ELP contains about 15 to 20 iterated sequences. In some aspects, the ELP contains about 16 iterated sequences.
- In some embodiments, the ELP includes 10mers including ten copies of one or more ELP structural units disclosed herein. In some embodiments, the ELP includes 10mers including ten copies of a pentapeptide disclosed herein. In some embodiments, the ELP includes 10mers including SEQ ID NOs: 3 and 13 in any combination, In some embodiments, the ELP includes a sequence alternating between SEQ ID NOs: 3 and 13. ELPs of varying numbers of 10mers can be combined to produce ELPs with, for instance, 20, 30, 40, 60, 90, 100, 120, 150, 160, or 200 copies of the 10mer. Exemplary 10mers are disclosed in Table 3.
-
TABLE 3 Guest residue ratios in exemplary 10mers. The ELP polymers have hydrophobicities between the ELP 1 series (least hydrophobic) andthe ELP 4 series (most hydrophobic).ELP series Pentamer motif Guest residue ratio 1 series VPGXG (SEQ ID NO: 3) 5 Val:3 Gly:2 Ala VPGXG (SEQ ID NO: 3) 5 Val:4 Gly:1 Ala VPGXG (SEQ ID NO: 3) 5 Val:5 Gly:0 Ala VPGXG (SEQ ID NO: 3) 5 Val:2 Gly:3 Ala VPGXG (SEQ ID NO: 3) 5 Val:1 Gly:4 Ala VPGXG (SEQ ID NO: 3) 5 Val:0 Gly:5 Ala VPGXG (SEQ ID NO: 3) 6 Val:4 Gly:0 Ala VPGXG (SEQ ID NO: 3) 6 Val:3 Gly:1 Ala VPGXG (SEQ ID NO: 3) 6 Val:2 Gly:2 Ala VPGXG (SEQ ID NO: 3) 6 Val:1 Gly:3 Ala VPGXG (SEQ ID NO: 3) 6 Val:0 Gly:4 Ala VPGXG (SEQ ID NO: 3) 7 Val:3 Gly:0 Ala VPGXG (SEQ ID NO: 3) 7 Val:2 Gly:1 Ala VPGXG (SEQ ID NO: 3) 7 Val:1 Gly:2 Ala VPGXG (SEQ ID NO: 3) 7 Val:0 Gly:3 Ala VPGXG (SEQ ID NO: 3) 8 Val:2 Gly:0 Ala VPGXG (SEQ ID NO: 3) 8 Val:0 Gly:2 Ala VPGXG (SEQ ID NO: 3) 8 Val:1 Gly:1 Ala VPGXG (SEQ ID NO: 3) 9 Val:1 Gly:1 Ala VPGXG (SEQ ID NO: 3) 9 Val:0 Gly:1 Ala 4 series VPGXG (SEQ ID NO: 3) 10 Val:0 Gly:0 Ala - In some embodiments, the ELP may form a β-turn structure. Exemplary peptide sequences suitable for creating a β-turn structure are described in International Patent Application PCT/US96/05186, which is hereby incorporated by reference in its entirety. For example, the fourth residue (X) in the sequence VPGXG (SEQ ID NO: 3), can be varied without eliminating the formation of a β-turn.
- The structure of exemplary ELPs may be described using the notation ELPk [XiYj-n], where k designates a particular ELP repeat unit, the bracketed capital letters are single letter amino acid codes, and their corresponding subscripts designate the relative ratio of each guest residue X in the structural units (where applicable), and n describes the total length of the ELP in number of the structural repeats. For example, ELP1 [V5A2G3-10] designates an ELP component containing 10 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is valine, alanine, and glycine at a relative ratio of about 5:2:3; ELP1 [K1V2F1-4] designates an ELP component containing 4 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is lysine, valine, and phenylalanine at a relative ratio of about 1:2:1; ELP1 [K1V7F1-9] designates a polypeptide containing 9 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is lysine, valine, and phenylalanine at a relative ratio of about 1:7:1; ELP1 [V-5] designates a polypeptide containing 5 repeating units of the pentapeptide VPGXG (SEQ ID NO:3), where X is valine; ELP1 [V-20] designates a polypeptide containing 20 repeating units of the pentapeptide VPGXG (SEQ ID NO: 3), where X is valine; ELP2 [5] designates a polypeptide containing 5 repeating units of the pentapeptide AVGVP (SEQ ID NO: 4); ELP3 [V-5] designates a polypeptide containing 5 repeating units of the pentapeptide IPGXG (SEQ ID NO: 5), where X is valine; ELP4 [V-5] designates a polypeptide containing 5 repeating units of the pentapeptide LPGXG (SEQ ID NO: 7), where X is valine.
- With respect to ELP, the Tt is a function of the hydrophobicity of the guest residue. Thus, by varying the identity of the guest residue(s) and their mole fraction(s), ELPs can be synthesized that exhibit an inverse transition over a broad range. Thus, the Tt at a given ELP length may be decreased by incorporating a larger fraction of hydrophobic guest residues in the ELP sequence. Examples of suitable hydrophobic guest residues include valine, leucine, isoleucine, phenylalanine, tryptophan and methionine. Tyrosine, which is moderately hydrophobic, may also be used. Conversely, the Tt may be increased by incorporating residues, such as those selected from: glutamic acid, cysteine, lysine, aspartate, alanine, asparagine, serine, threonine, glycine, arginine, and glutamine.
- For polypeptides having a molecular weight >100,000, the hydrophobicity scale disclosed in PCT/US96/05186 (which is hereby incorporated by reference in its entirety) provides one means for predicting the approximate Tt of a specific ELP sequence. For polypeptides having a molecular weight <100,000, the Tt may be predicted or determined by the following quadratic function: Tt=M0+M1X+M2X2 where X is the MW of the fusion protein, and M0=116.21; M1=−1.7499; M2=0.010349.
- The ELP in some embodiments is selected or designed to provide a Tt ranging from about 10 to about 37° C. at formulation conditions, such as from about 20 to about 37° C., or from about 25° C. to about 37° C. In some embodiments, the transition temperature at physiological conditions (e.g., 0.9% saline) is from about 34° C. to 36° C., to take into account a slightly lower peripheral body temperature.
- In certain embodiments, the ELP includes [VPGXG]m, (SEQ ID NO:3) where m is any number from 1 to 200. In certain embodiments, the ELP includes [VPGXG]m (SEQ ID NO:3), where m is any number from 1 to 200, and each X is selected from V, G, and A. In certain embodiments, the ELP includes [VPGXG]m (SEQ ID NO:3), where m is any number from 1 to 200, each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2. In certain embodiments, the ELP includes [VPGXG]90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2. For example, the amino acid sequence capable of forming the hydrogen-bonded matrix at body temperature includes [VPGXG]120 (SEQ ID NO: 19), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2. As shown herein, 120 structural units of this ELP can provide a transition temperature at about 37° C. with about 5 to 15 mg/ml (e.g., about 10 mg/ml) of protein. At concentrations of about 50 to about 100 mg/mL the phase transition temperature is about 35.5 degrees centigrade (just below body temperature), which allows for peripheral body temperature to be just less than 37° C. In some embodiments, the ELP may include [VPGXG]144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2. In some embodiments, the ELP includes [VPGXG]180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A may be about 5:3:2.
- In certain embodiments, the ELP includes [VPGXG]m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0. In certain embodiments, the ELP includes [VPGXG]90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0. In certain embodiments, the ELP includes [VPGXG]120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0. In certain embodiments, the ELP includes [VPGXG]144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0. In certain embodiments, the ELP includes [VPGXG]180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:2:0.
- In certain embodiments, the ELP includes [VPGXG]m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2. In certain embodiments, the ELP includes [VPGXG]90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2. In certain embodiments, the ELP includes [VPGXG]120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2. In certain embodiments, the ELP includes [VPGXG]144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2. In certain embodiments, the ELP includes [VPGXG]180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 7:0:2.
- In certain embodiments, the ELP includes [VPGXG]m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3. In certain embodiments, the ELP includes [VPGXG]90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3. In certain embodiments, the ELP includes [VPGXG]120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3. In certain embodiments, the ELP includes [VPGXG]144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3. In certain embodiments, the ELP includes [VPGXG]180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 6:0:3.
- In certain embodiments, the ELP includes [VPGXG]m (SEQ ID NO:3), where m is any number from 1 to 200, where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2. In certain embodiments, the ELP includes [VPGXG]90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2. In certain embodiments, the ELP includes [VPGXG]120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2. In certain embodiments, the ELP includes [VPGXG]144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2. In certain embodiments, the ELP includes [VPGXG]180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:2:2.
- In certain embodiments, the ELP includes [XPGVG]m (SEQ ID NO:3), where m is any number from 1 to 200. In certain embodiments, the ELP includes [XPGVG]m (SEQ ID NO:3), where m is any number from 1 to 200, and each X is selected from V, G, and A. In certain embodiments, the ELP includes [XPGVG]m (SEQ ID NO:3), where m is any number from 1 to 200, each X is selected from V, G, and A and wherein the ratio of V:G:A is about 5:0:4. In certain embodiments, the ELP includes [XPGVG]90 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4. In certain embodiments, the ELP includes [XPGVG]120 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4. In certain embodiments, the ELP includes [XPGVG]144 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4. In certain embodiments, the ELP includes [XPGVG]180 (SEQ ID NO:3), where each X is selected from V, G, and A, and wherein the ratio of V:G:A is about 5:0:4.
- In certain embodiments, the ELP includes [VPGVG]m (SEQ ID NO:3) where m is any number from 1 to 200. In some embodiments, the ELP includes [VPGVG]90 (SEQ ID NO:3), or [VPGVG]120 (SEQ ID NO:3). As shown herein, 120 structural units of this ELP can provide a transition temperature at about 37° C. with about 0.005 to about 0.05 mg/ml (e.g., about 0.01 mg/ml) of protein. Alternatively, the ELP includes [VPGXG]144 (SEQ ID NO:3) or [XPGVG]144 (SEQ ID NO:3). As shown herein (Table 2), 144 structural units of either of these ELPs can provide a transition temperature at 28° C. to 35° C. inclusive.
- In various embodiments, the intended subject is human, and the body temperature is about 37° C., and thus the therapeutic agent is designed to provide a sustained release at or near this temperature (e.g. between about 28° C. to about 37° C.). A slow release into the circulation with reversal of hydrogen bonding and/or hydrophobic interactions is driven by a drop in concentration as the product diffuses at the injection site, even though body temperature remains constant. In other embodiments, the subject is a non-human mammal, and the therapeutic agent is designed to exhibit a sustained release at the body temperature of the mammal, which may be from about 30 to about 40° C. in some embodiments, such as for certain domesticated pets (e.g., dog or cat) or livestock (e.g., cow, horse, sheep, or pig). Generally, the Tt is higher than the storage conditions of the formulation (which may be from 10 to about 25° C., or from 15 to 22° C.), such that the therapeutic agent remains in solution for injection.
- In some embodiments, the ELP can provide a transition temperature at a range of 27° C. to 36° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 28° C. to 35° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 29° C. to 34° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 27° C. to 33° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 30° C. to 33° C. inclusive. In some embodiments, the ELP can provide a transition temperature at a range of 31° C. to 31° C. inclusive. In some embodiments, the ELP can provide a transition temperature of 27° C., 28° C., 29° C., 30° C., 31° C., 32° C., 33° C., 34° C., 35° C., or 36° C. In some embodiments, the ELP can provide a transition temperature at a range of 28° C. to 35° C. inclusive at a protein concentration of 10 mg/mL in 110 mM NaCl.
- Elastin-like-peptide (ELP) protein polymers and recombinant fusion proteins can be prepared as described in U.S. Patent Publication No. 2010/0022455, which is hereby incorporated by reference. In some embodiments, the ELP protein polymers are constructed through recursive ligation to rapidly clone DNA encoding highly repetitive polypeptides of any sequence and specified length over a large range of molecular weights. In a single cycle, two halves of a parent plasmid, each containing a copy of an oligomer, are ligated together, thereby dimerizing the oligomer and reconstituting a functional plasmid. This process is carried out recursively to assemble an oligomeric gene with the desired number of repeats. For example, one ELP structural subunit (e.g. a pentapeptide or a 9mer of pentapeptides) is inserted into a vector. The vector is digested, and another ELP structural unit (e.g. a pentapeptide or a 9mer of pentapeptides) is inserted. Each subsequent round of digestion and ligation doubles the number of ELP structural units contained in the resulting vector until the ELP polymer is the desired length. By varying the number of pentapeptides in the initial structural unit, ELPs of varying length can easily be constructed. Alternative means of construction (i.e. other than recursive ligation) can be used to produce alternative lengths of ELP.
- In some embodiments, the vector contains one or more additional amino acids or ELP structural unit repeats. For example, pPE0248 (
FIG. 6 ) adds an additional pentamer repeat to the N terminus of the 144mer with valine in the guest position and an additional pentamer to the C terminus with a tryptophan in the guest residue. The tryptophan may be used as a means to increase the extinction coefficient of the molecule, allowing for better measurement of absorbance, for instance at 280 nm, which can be useful for determination of protein concentration, or for monitoring protein content during purification. The pentamers added to either end can also be designed so as the encoding DNA contains restriction enzyme recognition sites for cloning of fusion partners on to either end of the ELP coding sequence. - In some embodiments, the therapeutic agent includes an active agent and one or more ELPs. In some embodiments, the therapeutic agent includes an active agent with one or more ELPs at either the N- or C-terminus. In some embodiments, the therapeutic agent includes an active agent with one or more ELPs at both the N- or C-termini. In some embodiments, the ELPs are approximately the same size. In some embodiments, the ELPs differ in size. In some embodiments, an ELP at one terminus is larger than an ELP at the other terminus. In some embodiments, an ELP at the N-terminus is larger than an ELP at the C-terminus. In some embodiments, an ELP at the C-terminus is larger than an ELP at the N-terminus.
- Active Agents
- Peptide Active Agents
- In various embodiments, the active agent is a protein or peptide, which by itself may have a short circulatory half-life, such as from about 30 seconds to about 1 hour. The therapeutic agent may be a recombinant fusion protein between the protein active agent and the amino acid sequence capable of forming the hydrogen-bonded matrix at the body temperature of the subject (e.g. an ELP). Any appropriate peptide active agent may be used in the therapeutic agents of the present disclosure. Exemplary peptide active agents include GIP receptor agonists such as glucose-dependent insulinotropic peptide (GIP) or a derivative thereof. Further exemplary peptide active agents include GLP1 receptor agonists such as GLP-1 or derivatives thereof (including GLP1 7-36 or GLP1 7-37), or exendin-4 or derivatives thereof. In other embodiments, the protein or peptide agent is, a glucagon receptor agonist (including glucagon, oxyntomodulin or derivatives thereof). In other embodiments, the disclosure provides for a co-formulation of any two of a GLP1 receptor agonist, a glucagon receptor agonist, a GIP receptor agonist, a VPAC2 selective agonist, such as vasoactive intestinal peptide (VIP) or a derivative thereof, a clotting factor, such as Factor VII, Factor VIII, or Factor IX, insulin (e.g., single chain insulin or an A chain or a B chain fusion protein, as described in U.S. Patent Publication No. 2013/0150291, which is hereby incorporated by reference), or a monoclonal antibody or single chain antibody. Alternatively, the active agent is as described in U.S. Patent Publication No. 2011/0123487, which is hereby incorporated by reference.
- The half-life of protein therapeutics can be extended by a variety of means, including increasing the size and thus the hydrodynamic volume of the protein therapeutic, adding modified or unnatural amino acids, conjugation of moieties (e.g. pegylation), the addition of synthetic sequences (e.g. XTEN® sequences, PASylation®), carboxy-terminal extension from hCG (CTP), addition of albumin-binding sequences (e.g. AlbudAb®), conjugation of albumin-binding fatty acids, post-translational modifications such as N-glycosylation and fusion to other peptides, or fusion with a mammalian heterologous protein, such as albumin, transferrin, or antibody Fc sequences. Such sequences are described in See U.S. Pat. No. 7,238,667 (particularly with respect to albumin conjugates), U.S. Pat. No. 7,176,278 (particularly with respect to transferrin conjugates), and U.S. Pat. No. 5,766,883.
- In some embodiments, the disclosure provides derivatives, variants, or mutants of one or more active peptide agents disclosed herein. In some embodiments, the derivative, variant, or mutant contains one or more amino acid substitutions compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, one to 20 amino acids are substituted. In some embodiments, the derivative, variant, or mutant contains about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, or about 10 amino acid substitutions compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, the derivative, variant, or mutant contains one or more amino acid deletions compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, one to 20 amino acids are deleted compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, the derivative, variant, or mutant has about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, or about 10 amino acid deletions compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, one to ten amino acids are deleted at either terminus compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, one to ten amino acids are deleted from both termini compared to the amino acid sequence of the native therapeutic peptide agent. In some embodiments, the amino acid sequence of the derivative, variant, or mutant is at least about 70% identical to the amino acid sequence of the native peptide therapeutic agent. In some embodiments, the amino acid sequence of the derivative, variant, or mutant is about 70%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to the amino acid sequence of the native therapeutic peptide agent.
- Methods to determine identity are well-known in the art. Preferred methods to determine identity are designed to give the best match between the sequences tested. Methods to determine identity and similarity are codified in publicly available computer programs. Sequence alignments and percent identity calculations may be performed using the “Clustal W method of alignment” (described by Higgins and Sharp, CABIOS. 5:151-153 (1989); Higgins, D. G. et al., Comput. Appl. Biosci. 8:189-191 (1992)) and found in the MegAlign™ v6.1 program of the LASERGENE bioinformatics computing suite (DNASTAR Inc.). Default parameters for multiple alignment (GAP PENALTY=10, GAP LENGTH PENALTY=0.2, Delay Divergen Seqs (%)=30, DNA Transition Weight=0.5, Protein Weight Matrix=Gonnet Series, DNA Weight Matrix=IUB). After alignment of the sequences using the Clustal W program, it is possible to obtain a “percent identity” by viewing the “sequence distances” table in the same program.
- In some embodiments, the disclosure provides for co-formulation of any two or more active agents disclosed herein. In some embodiments, the co-formulation includes two or more peptide active agents and small molecule active agents. In some embodiments, the co-formulation includes two or more small molecule active agents. In some embodiments, the co-formulation includes two or more peptide active agents. In some embodiments, the peptide active agents are insulin or derivatives thereof and a GLP-1 receptor agonist or derivatives thereof. In some embodiments, the peptide active agents are insulin or derivatives thereof and exendin-4 or derivatives thereof. In some embodiments, one or more of the active agents in the co-formulation is not conjugated to an ELP. In some embodiments, all of the active agents in the co-formulation are conjugated to an ELP.
- Glucagon-Like Peptide (GLP)-1 Receptor Agonists
- In certain embodiments of the disclosure, the therapeutic agent includes an ELP component fused or conjugated to a GLP-1 receptor agonist, such as GLP-1, exendin-4, or functional analogs thereof.
- Human GLP-1 is a 37 amino acid residue peptide originating from preproglucagon which is synthesized in the L-cells in the distal ileum, in the pancreas, and in the brain.
- Processing of preproglucagon to give GLP-1 (7-36)amide, GLP-1 (7-37) and GLP-2 occurs mainly in the L-cells. A simple system is used to describe fragments and analogs of this peptide. For example, Gly8-GLP-1 (7-37) designates a fragment of GLP-1 formally derived from GLP-1 by deleting the amino acid residues Nos. 1 to 6 and substituting the naturally occurring amino acid residue in position 8 (Ala) by Gly. Similarly, Lys34 (Nε-tetradecanoyl)-GLP-1(7-37) designates GLP-1 (7-37) wherein the ε-amino group of the Lys residue in
position 34 has been tetradecanoylated. Where reference in this text is made to C-terminally extended GLP-1 analogues, the amino acid residue inposition 38 is Arg unless otherwise indicated, the optional amino acid residue in position 39 is also Arg unless otherwise indicated and the optional amino acid residue inposition 40 is Asp unless otherwise indicated. Also, if a C-terminally extended analogue extends to position 41, 42, 43, 44 or 45, the amino acid sequence of this extension is as in the corresponding sequence in human preproglucagon unless otherwise indicated. - The parent peptide of GLP-1, proglucagon (PG), has several cleavage sites that produce various peptide products dependent on the tissue of origin including glucagon (PG[32-62]) and GLP-1[7-36]NH2 (PG[72-107]) in the pancreas, and GLP-1[7-37] (PG[78-108]) and GLP-1[7-36]NH2 (PG [78-107]) in the L cells of the intestine where GLP-1[7-36]NH2 (78-107 PG) is the major product. The GLP-1 component in accordance with the disclosure may be any biologically active product or derivative of proglocagon, or functional analog thereof, including: GLP-1 (1-35), GLP-1(1-36), GLP-1 (1-36)amide, GLP-1 (1-37), GLP-1 (1-38), GLP-1 (1-39), GLP-1 (1-40), GLP-1 (1-41), GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)amide, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40) and GLP-1 (7-41), or a analog of the foregoing. Generally, the GLP-1 component in some embodiments may be expressed as GLP-1 (A-B), where A is an integer from 1 to 7 and B is an integer from 38 to 45, optionally with one or more amino acid substitutions as defined below.
- After processing in the intestinal L-cells, GLP-1 is released into the circulation, most notably in response to a meal. The plasma concentration of GLP-1 rises from a fasting level of approximately 15 pmol/L to a peak postprandial level of 40 pmol/L. For a given rise in plasma glucose concentration, the increase in plasma insulin is approximately threefold greater when glucose is administered orally compared with intravenously (Kreymann et al., 1987, Lancet 2(8571): 1300-4). This alimentary enhancement of insulin release, known as the incretin effect, is primarily humoral and GLP-1 is now thought to be the most potent physiological incretin in humans. GLP-1 mediates insulin production via binding to the GLP-1 receptor, known to be expressed in pancreatic β cells. In addition to the insulinotropic effect, GLP-1 suppresses glucagon secretion, delays gastric emptying (Wettergen et al., 1993, Dig Dis Sci 38: 665-73) and may enhance peripheral glucose disposal (D'Alessio et al., 1994, J. Clin Invest 93: 2293-6).
- A combination of actions gives GLP-1 unique therapeutic advantages over other agents currently used to treat non-insulin-dependent diabetes mellitus (NIDDM). First, a single subcutaneous dose of GLP-1 can completely normalize post prandial glucose levels in patients with NIDDM (Gutniak et al., 1994, Diabetes Care 17: 1039-44). This effect may be mediated both by increased insulin release and by a reduction in glucagon secretion. Second, intravenous infusion of GLP-1 can delay postprandial gastric emptying in patients with NIDDM (Williams et al., 1996, J. Clin Endo Metab 81: 327-32). Third, unlike sulphonylureas, the insulinotropic action of GLP-1 is dependent on plasma glucose concentration (Holz et al., 1993, Nature 361:362-5). Thus, the loss of GLP-1-mediated insulin release at low plasma glucose concentration protects against severe hypoglycemia.
- When given to healthy subjects, GLP-1 potently influences glycemic levels as well as insulin and glucagon concentrations (Orskov, 1992, Diabetologia 35:701-11), effects which are glucose dependent (Weir et al., 1989, Diabetes 38: 338-342). Moreover, it is also effective in patients with diabetes (Gutniak, M., 1992, N. Engl J Med 226: 1316-22), normalizing blood glucose levels in
type 2 diabetic subjects and improving glycemic control intype 1 patients (Nauck et al., 1993, Diabetologia 36: 741-4, Creutzfeldt et al., 1996, Diabetes Care 19:580-6). - GLP-1 is, however, metabolically unstable, having a plasma half-life (tv2) of only 1-2 minutes in vivo. Moreover, exogenously administered GLP-1 is also rapidly degraded (Deacon et al., 1995, Diabetes 44: 1126-31). This metabolic instability has limited the therapeutic potential of native GLP-1.
- GLP-1[7-36]NH2 has the following amino acid sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: 38), which may be employed as the GLP-1 component in accordance with the disclosure. Alternatively, the GLP-1 component may contain glycine (G) at the second position, giving, for example, the sequence HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR (SEQ ID NO: 39). The GLP-1 component may be a biologically active fragment of GLP-1, for example, as disclosed in US 2007/0041951, which is hereby incorporated by reference in its entirety. Other fragments and modified sequences of GLP-1 are known in the art (U.S. Pat. Nos. 5,614,492; 5,545,618; European Patent Application, Publication No. EP 0658568 A1; WO 93/25579, which are hereby incorporated by reference in their entireties). Such fragments and modified sequences may be used in connection with the present disclosure, as well as those described below.
- Certain structural and functional analogs of GLP-1 have been isolated from the venom of the Gila monster lizards (Heloderma suspectum and Heloderma horridum) and have shown clinical utility. Such molecules find use in accordance with the present disclosure. In particular, exendin-4 is a 39 amino acid residue peptide isolated from the venom of Heloderma suspectum and shares approximately 52% homology with human GLP-1.
- Exendin-4 is a potent GLP-1 receptor agonist that stimulates insulin release, thereby lowering blood glucose levels. Exendin-4 has the following amino acid sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO: 23). A synthetic version of exendin-4 known as exenatide (marketed as Byetta®) has been approved for the treatment of Type-2 Diabetes. Although exenatide is structurally analogous to native GLP-1, it has a longer half-life after injection.
- While exenatide has the ability to lower blood glucose levels on its own, it can also be combined with other medications such as metformin, a thiozolidinedione, a sulfonylureas, and/or insulin to improve glucose control. Exenatide is administered by injection subcutaneously twice per day using a pre-filled pen device. Typical human responses to exenatide include improvements in the initial rapid release of endogenous insulin, an increase in β-cell growth and replication, suppression of pancreatic glucagon release, delayed gastric emptying, and reduced appetite—all of which function to lower blood glucose. Unlike sulfonylureas and meglitinides, exenatide increases insulin synthesis and secretion in the presence of glucose only, thus lessening the risk of hypoglycemia. Despite the therapeutic utility of exenatide, it has certain undesirable traits, including the requirement of twice daily injections, gastrointestional side effects, and similar to native GLP-1, a relatively short half-life (i.e. approximately 2 hr).
- Various functional analogs of GLP-1 and exendin-4 are known, and which find use in accordance with the disclosure. These include liraglutide (Novo Nordisk, WO98/008871), R1583/taspoglutide (Roche, WO00/034331), CJC-1131 (ConjuChem, WO00/069911), ZP-10/AVE0010 (Zealand Pharma, Sanofi-Aventis, WO01/004156), and LY548806 (Eli Lilly, WO03/018516).
- Liraglutide, also known as NN2211, is a GLP-1 receptor agonist analog that has been designed for once-daily injection (Harder et al., 2004, Diabetes Care 27: 1915-21). Liraglutide has been tested in patients with type-2 diabetes in a number of studies and has been shown to be effective over a variety of durations. In one study, treatment with liraglutide improved glycemic control, improved β-cell function, and reduced endogenous glucose release in patients with type-2 diabetes after one week of treatment (Degn et al., 2004, Diabetes 53: 1187-94). In a similar study, eight weeks of 0.6-mg liraglutide therapy significantly improved glycemic control without increasing weight in subjects with
type 2 diabetes compared with those on placebo (Harder et al., 2004, Diabetes Care 27: 1915-21). - Thus, in certain embodiments, the GLP-1 receptor agonist in accordance with the disclosure is as described in WO98/008871, which is hereby incorporated by reference in its entirety. The GLP-1 receptor agonist may have at least one lipophilic substituent, in addition to one, two, or more amino acid substitutions with respect to native GLP-1. For example, the lipophilic substituent may be an acyl group selected from CH3(CH2)nCO—, wherein n is an integer from 4 to 38, such as an integer from 4 to 24. The lipophilic substituent may be an acyl group of a straight-chain or branched alkyl or fatty acid (for example, as described in WO98/008871, which description is hereby incorporated by reference).
- In certain embodiments, the GLP-1 component is Arg26-GLP-1 (7-37), Arg34-GLP-1(7-37), Lys36-GLP-1 (7-37), Arg26,34Lys36-GLP-1 (7-37), Arg26,34Lys38-GLP-1 (7-38), Arg28,34 Lys39-GLP-1 (7-39), Arg26,34Lys40-GLP-1(7-40), Arg26Lys36-GLP-1(7-37), Arg34Lys36-GLP-1(7-37), Arg26Lys39-GLP-1(7-39), Arg34Lys40-GLP-1(7-40), Arg26,34Lys36,39-GLP-I (7-39), Arg26,34Lys36,40-GLP-1(7-40), Gly8Arg26-GLP-1(7-37); Gly8Arg34-GLP-1(7-37); Gly8Lys38-GLP-1(7-37); Gly8Arg26,34Lys36-GLP-1(7-37), Gly8Arg26,34Lys39-GLP-1(7-39), Gly8Arg26,34Lys40-GLP-1(7-40), Gly8Arg26Lys36-GLP-1(7-37), Gly8Arg34Lys36-GLP-1(7-37), Gly8Arg26Lys39-GLP-1(7-39); Gly8Arg34Lys40-GLP-1(7-40), Gly8Arg28,34Lys36,39-GLP-1(7-39) and Gly8Arg26,34Lys35,40-GLP-1(7-40), each optionally having a lipophilic substituent. For example, the GLP-1 receptor agonist may have the sequence/structure Arg34Lys26-(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-1(7-37).
- Taspoglutide, also known as R1583 or BIM 51077, is a GLP-1 receptor agonist that has been shown to improve glycemic control and lower body weight in subjects with
type 2 diabetes mellitus treated with metformin (Abstract No. A-1604, Jun. 7, 2008, 68th American Diabetes Association Meeting, San Francisco, Calif.). - Thus, in certain embodiments, the GLP-1 receptor agonist is as described in WO00/034331, which is hereby incorporated by reference in its entirety. In certain exemplary embodiments, the GLP-1 receptor agonist has the sequence [Aib8,35]hGLP-1(7-36)NH2 (e.g. taspoglutide), wherein Aib is alpha-aminoisobutyric acid.
- CJC-1131 is a GLP-1 analog that consists of a DPP-IV-resistant form of GLP-1 joined to a reactive chemical linker group that allows GLP-1 to form a covalent and irreversible bond with serum albumin following subcutaneous injection (Kim et al., 2003, Diabetes 52: 751-9). In a 12-week, randomized, double-blind, placebo-controlled multicenter study, CJC-1131 and metformin treatment was effective in reducing fasting blood glucose levels in
type 2 diabetes patients (Ratner et al., Abstract No. 10-OR, Jun. 10-14, 2005, 65th American Diabetes Association Meeting, San Francisco, Calif.). - Thus, in certain embodiments, the GLP-1 receptor agonist is as described in WO00/069911, which is hereby incorporated by reference in its entirety. In some embodiments, the GLP-1 receptor agonist is modified with a reactive group which reacts with amino groups, hydroxyl groups or thiol groups on blood components to form a stable covalent bond. In certain embodiments, the GLP-1 receptor agonist is modified with a reactive group selected from the group consisting of succinimidyl and maleimido groups. In certain exemplary embodiments, the GLP-1 receptor agonist has the sequence/structure: D-Ala8Lys37-(2-(2-(2-maleimidopropionamido(ethoxy)ethoxy)acetamide))-GLP-1(7-37) (e.g. CJC-1131).
- AVE0010, also known as ZP-10, is a GLP-1 receptor agonist that may be employed in connection with the disclosure. In a recent double-blind study, patients treated with once daily dosing of AVE0010 demonstrated significant reductions in HbA1c levels (Ratner et al., Abstract No. 433-P, 68th American Diabetes Association Meeting, San Francisco, Calif.). At the conclusion of the study, the percentages of patients with HbA1c<7% ranged from 47-69% for once daily dosing compared to 32% for placebo. In addition, AVE0010 treated patients showed dose-dependent reductions in weight and post-prandial plasma glucose.
- Thus, in certain embodiments, the GLP-1 receptor agonist is as described in WO01/004156, which is hereby incorporated by reference in its entirety. For example, the GLP-1 receptor agonist may have the sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 (SEQ ID NO: 41) (e.g. AVE0010).
- LY548806 is a GLP-1 derivative designed to be resistant to proteolysis by dipeptidase-peptidyl IV (DPP-IV) (Jackson et al., Abstract No. 562, Jun. 10-14, 2005, 65th American Diabetes Association Meeting, San Francisco, Calif.). In an animal model of hyperglycemia, LY548806 has been shown to produce a significant lowering of blood glucose levels during the hyperglycemic phase (Saha et al., 2006, J. Pharm. Exp. Ther. 316: 1159-64). Moreover, LY548806 was shown to produce a significant increase in insulin levels consistent with its known mechanism of action, namely stimulation of insulin release in the presence of hyperglycemia.
- Thus, in certain embodiments, the GLP-1 receptor agonist is as described in WO03/018516, which is hereby incorporated by reference in its entirety. In some embodiments, the therapeutic agents of the present disclosure comprise GLP-1 analogs wherein the backbone for such analogs or fragments contains an amino acid other than alanine at position 8 (
position 8 analogs). The backbone may also include L-histidine, D-histidine, or modified forms of histidine such as desamino-histidine, 2-amino-histidine, β-hydroxy-histidine, homohistidine, α-fluoromethyl-histidine, or α-methyl-histidine at position 7. In some embodiments, theseposition 8 analogs may contain one or more additional changes atpositions position 8 analogs may contain one or more additional changes atpositions - In some embodiments, when processed, the mature form of such fusion protein will begin with the His7 of GLP.
- Thus, the present disclosure provides therapeutic agents including an elastin-like peptide (ELP) and a GLP-1 receptor agonist. For example, in certain embodiments, the GLP-1 receptor agonist is GLP-1 (SEQ ID NOs: 37, 38, or 39) or a functional analog thereof. In other embodiments, the GLP-1 receptor agonist is exendin-4 (SEQ ID NO: 23) or a functional analog thereof. Such functional analogs of GLP-1 or exendin-4 include functional fragments truncated at the C-terminus by from 1 to 10 amino acids, including by 1, 2, 3, or up to about 5 amino acids (with respect to SEQ ID NOs: 23, 37, 38, or 39). Such functional analogs may contain from 1 to 10 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (e.g., SEQ ID NOs: 23, 37, 38, or 39), and in each case retaining the activity of the peptide. For example, the functional analog of GLP-1 or exendin-4 may have from 1 to about 3, 4, or 5 insertions, deletions and/or substitutions (collectively) with respect to SEQ ID NOS: 23, 37, 38, or 39. In some embodiments, the exendin-4 variant is exendin-4 (9-39) (SEQ ID NO: 33), exendin-4 (9-31) (SEQ ID NO: 34), or exendin-4 (9-30) (SEQ ID NO: 56). Such activity may be confirmed or assayed using any available assay. In these or other embodiments, the GLP-1 receptor agonist component has at least about 50%, 75%, 80%, 85%, 90%, 95%, or 99% identity with the native sequence (SEQ ID NOS: 23, 37, 38, or 39). Such functional analogs may further comprise additional chemical modifications, such as those described in this section and/or others known in the art.
- In some embodiments, the GLP-1 receptor agonist is a dual agonist having an amino acid sequence described in US 2011/0257092, which is hereby incorporated by reference in its entirety. Other dual or multi receptor agonists are described in US 2011/016602 and US 2010/00190701, each of which is hereby incorporated by reference, in particular with regard to the structures and sequences of GLP-1 receptor co-agonists described therein.
- Additional descriptions of GLP-1 receptor co-agonists can be found in Pocai A et al., Glucagon-
Like Peptide 1/Glucagon Receptor Dual Agonism Reverses Obesity in Mice, Diabetes 58:2258-2266 (2009) and Patterson J T, et al., Functional association of the N-terminal residues with the central region in glucagon-related peptides, J. Pept. Sci. 17:659-666 (2011), Finan et al., A rationally designed monomeric peptide triagonist corrects obesity and diabetes in rodents, Nature Medicine 21:27-36, each of which are hereby incorporated by reference in their entirety. - In another aspect, the present disclosure provides methods for treating or preventing
type 2 diabetes, impaired glucose tolerance,type 1 diabetes, hyperglycemia, obesity, binge eating, bulimia, hypertension, syndrome X, dyslipidemia, cognitive disorders, atheroschlerosis, non-fatty liver disease, myocardial infarction, coronary heart disease and other cardiovascular disorders, or hyperinsulinism, such as congenital hyperinsulinism or acquired hyperinsulinism following gastric surgery, for instance gastric surgery to treat obesity. - The methods include administering a therapeutic agent including the elastin-like peptide (ELP) and an GLP-1 receptor agonist (as described above) to a patient in need of such treatment. In these or other embodiments, the present disclosure provides methods for decreasing food intake, decreasing β-cell apoptosis, increasing β-cell function and β-cell mass, and/or for restoring glucose sensitivity to β-cells. Generally, the patient may be a human or non-human animal patient (e.g., dog, cat, cow, or horse). Preferably, the patient is human.
- In some embodiments, the treatment with a ELP/GLP-1 receptor agonist compound according to the present disclosure may also be combined with one or more pharmacologically active substances, e.g. selected from antidiabetic agents, antiobesity agents, appetite regulating agents, antihypertensive agents, agents for the treatment and/or prevention of complications resulting from or associated with diabetes and agents for the treatment and/or prevention of complications and disorders resulting from or associated with obesity. In the present context, the expression “antidiabetic agent” includes compounds for the treatment and/or prophylaxis of insulin resistance and diseases wherein insulin resistance is the pathophysiological mechanism.
- The ability of a GLP-1 or exendin-4 analog, or an GLP-1 receptor agonist/ELP compound, to bind the GLP-1 receptor may be determined by standard methods, for example, by receptor-binding activity screening procedures which involve providing appropriate cells that express the GLP-1 receptor on their surface, for example, insulinoma cell lines such as RINmSF cells or INS-1 cells. In addition to measuring specific binding of tracer to membrane using radioimmunoassay methods, cAMP activity or glucose dependent insulin production can also be measured. In one method, cells recombinantly expressing the GLP-1 receptor may also be used to measure the GLP-1 receptor agonist activity. Thus, these methods may be employed for testing or confirming whether a suspected GLP-1 receptor agonist is active.
- In addition, known methods can be used to measure or predict the level of biologically activity of a GLP-1 receptor agonist or GLP-1 receptor agonist/ELP in vivo (See e.g. Siegel, et al., 1999, Regul Pept 79(2-3): 93-102). In particular, GLP-1 receptor agonists or GLP-1 receptor agonist/ELP compounds can be assessed for their ability to induce the production of insulin in vivo using a variety of known assays for measuring GLP-1 activity. For example, an ELP/GLP-1 receptor agonist compound can be introduced into a cell, such as an immortalized β-cell, and the resulting cell can be contacted with glucose. If the cell produces insulin in response to the glucose, then the modified GLP-1 is generally considered biologically active in vivo (Fehmann et al., 1992, Endocrinology 130: 159-166). An exemplary assay is described in greater detail herein.
- The ability of an GLP-1 receptor agonist/ELP compound to enhance β-cell proliferation, inhibit β-cell apoptosis, and regulate islet growth may also be measured using known assays. Pancreatic β-cell proliferation may be assessed by 3H-tymidine or BrdU incorporation assays (See e.g. Buteau et al., 2003, Diabetes 52: 124-32), wherein pancreatic β-cells such as INS(832/13) cells are contacted with an ELP/GLP-1 receptor agonist compound and analyzed for increases in 3H-thymidine or BrdU incorporation. The antiapoptotic activity of an ELP/GLP-1 receptor agonist compound can be measured in cultured insulin-secreting cells and/or in animal models where diabetes occurs as a consequence of an excessive rate of beta-cell apoptosis (See e.g. Bulotta et al., 2004, Cell Biochem Biophys 40(3 suppl): 65-78).
- In addition to GLP-1, other peptides of this family, such as those derived from processing of the pro-glucagon gene, such as GLP-2, GIP, and oxyntomodulin, can be conjugated or fused to the ELP component (as described herein) to enhance the therapeutic potential.
- In various embodiments, the disclosure encompasses doses and/or regimens such as those that do not induce substantial appetite suppression in a patient and/or those that do not induce substantial nausea in the patient, such as those described in PCT/US12/44383, which is hereby incorporated by reference.
- Human Growth Hormone
- In some aspects, the protein active agent is a growth hormone. An exemplary growth hormone sequences includes the sequence underlined in
FIGS. 24, 26, 28, and 30 (e.g. SEQ ID NO: 22). Additional suitable sequences include those described in Seeburg et al., “The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone: DNA 1 (3), 239-249 (1982), which includes the sequence associated with Accession No. AAA98618. In addition to the exact sequence of AAA98616, other derivatives may be used. For examples, the growth hormone may be truncated at the N-terminus by up to 3 amino acids, up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 25 amino acids, up to 30 amino acids, up to 35 amino acids, or up to 40 amino acids. In particular aspects about 15 to about 30 amino acids may be deleted from the N-terminus. In other aspects, the growth hormone may be truncated at the C-terminus by up to 3 amino acids, up to 5 amino acids, up to 10 amino acids, up to 15 amino acids, up to 20 amino acids, up to 25 amino acids, up to 30 amino acids, up to 35 amino acids, or up to 40 amino acids. In particular aspects about 20 to about 30 amino acids may be deleted from the C-terminus. - Other growth hormone derivatives include those having certain sequence identity to SEQ ID NO: 22. For example, growth hormones include amino acids sequences that share at least about 75% identity, about 80% identity, about 90% identity, about 95% identity, about 96% identity, about 97% identity, about 98% identity, or about 99% identity, with SEQ ID NO: 22.
- In certain aspects, the deleted portions may be replaced with one or more amino acids, such as methionine or glycine, which may serve functions such as initiating expression or providing spatial separation. In certain aspects, the N- and C-terminal truncations may be combined to arrive at a particular growth hormone.
- In some embodiments, the growth hormone peptide is in a fusion protein with more than one ELP sequence. In some embodiments, the growth hormone peptide has one or more ELPs at both the N- and C-termini. In some embodiments, the two or more ELPs at the N- and C-termini are approximately the same size. In some embodiments, the two or more ELPs at the N- and C-termini differ in size. In some embodiments, the ELP at the N-terminus of the growth hormone peptide is larger than the ELP at the C-terminus of the growth hormone peptide. In some embodiments, the ELP at the N-terminus of the growth hormone peptide includes about 90 to about 120 repeating structural units. In some embodiments, the ELP at the C-terminus of the growth hormone peptide includes about 5 to about 20 repeating structural units. In some embodiments, the ELP at the C-terminus of the growth hormone peptide is larger than the ELP at the N-terminus of the growth hormone peptide. In some embodiments, the ELP at the C-terminus of the growth hormone peptide includes about 90 to about 120 repeating structural units. In some embodiments, the ELP at the N-terminus of the growth hormone peptide includes about 5 to about 20 repeating structural units.
- Insulin
- Human proinsulin consists of A and B chains linked together with the 31 amino acid C peptide (SEQ ID NOs: 44 or 46). Once the preproinsulin reaches the endoplasmic reticulum, a protease cleaves off the signal peptide to create proinsulin. Specifically, once disulfide bonds are formed between the A and B chains the proinsulin is converted into mature insulin in vivo by removal of the C peptide by a trypsin/carboxypeptidase B-like system. Human insulin is composed of two chains of amino acids named chain A (21 amino acids—GIVEQCCTSICSLYQLENYCN) (SEQ ID NO: 47) and chain B (30 amino acids FVNQHLCGSHLVEALYLVCGERGFFYTPKT) (SEQ ID NO: 48) that are linked together by two disulfide bridges. There is a 3rd disulfide bridge within the A chain that links the 6th and 11th residues of the A chain together. In most species, the length and amino acid compositions of chains A and B are similar, and the positions of the three disulfide bonds are highly conserved. For this reason, pig insulin can replace deficient human insulin levels in diabetes patients. Today, porcine insulin has largely been replaced by the mass production of human proinsulin by bacteria (recombinant insulin).
- Insulin molecules have a tendency to form dimers in solution, and in the presence of zinc ions, insulin dimers associate into hexamers. Whereas monomers of insulin readily diffuse through the blood and have a rapid effect, hexamers diffuse slowly and have a delayed onset of action. In the design of recombinant insulin, the structure of insulin can be modified in a way that reduces the tendency of the insulin molecule to form dimers and hexamers but that does not interrupt binding to the insulin receptor. In this way, a range of preparations are made, varying from short acting to long acting.
- Within the endoplasmic reticulum, proinsulin is exposed to several specific peptidases that remove the C-peptide and generate the mature and active form of insulin. In the Golgi apparatus, insulin and free C-peptide are packaged into secretory granules, which accumulate in the cytoplasm of the β-cells. Exocytosis of the granules is triggered by the entry of glucose into the beta cells. The secretion of insulin has a broad impact on metabolism.
- There are two phases of insulin release in response to a rise in glucose. The first is an immediate release of insulin. This is attributable to the release of preformed insulin, which is stored in secretory granules. After a short delay, there is a second, more prolonged release of newly synthesized insulin.
- Once released, insulin is active for only a brief time before it is degraded by enzymes. Insulinase found in the liver and kidneys breaks down insulin circulating in the plasma, and as a result, insulin has a half-life of only about 6 minutes. This short duration of action results in rapid changes in the circulating levels of insulin.
- Insulin analogs have been developed with improved therapeutic properties (Owens et al., 2001, Lancet 358: 739-46; Vajo et al., 2001, Endocr Rev 22: 706-17), and such analogs may be employed in connection with the present disclosure. Various strategies, including elongation of the COOH-terminal end of the insulin B-chain and engineering of fatty acid-acylated insulins with substantial affinity for albumin are used to generate longer-acting insulin analogs. However, in vivo treatments with available longer-acting insulin compounds still result in a high frequency of hypo- and hyperglycemic excursions and modest reduction in HbA1c. Accordingly, development of a truly long-acting and stable human insulin analog still remains an important task.
- Functional analogs of insulin that may be employed in accordance with the disclosure include rapid acting analogs such as insulin lispro, insulin aspart and insulin glulisine, which are absorbed rapidly (<30 minutes) after subcutaneous injection, peak at one hour, and have a relatively short duration of action (3 to 4 hours). In addition, three long acting insulin analogs have been developed: insulin glargine, insulin detemir, and insulin degludec, and which may be employed in connection with the disclosure. The long acting insulin analogs have an onset of action of approximately two hours and reach a plateau of biological action at 4 to 6 hours, and may last up to 24 hours.
- Thus, in some embodiments, the insulin amino acid sequence may contain the A and/or B chain of insulin lispro (also known as HUMALOG, Eli Lilly). Insulin lispro differs from human insulin by the substitution of proline with lysine at
position 28 and the substitution of lysine with proline at position 29 of the insulin B chain. Although these modifications do not alter receptor binding, they help to block the formation of insulin dimers and hexamers, allowing for larger amounts of active monomeric insulin to be available for postprandial injections. - In other embodiments, the insulin amino acid sequence may contain an A and/or B chain of aspart (also known as NOVOLOG®, Novo Nordisk). Insulin aspart is designed with the single replacement of the amino acid proline by aspartic acid at
position 28 of the human insulin B chain. This modification helps block the formation for insulin hexamers, creating a faster acting insulin. - In yet other embodiments, the insulin amino acid sequence may contain an A and/or B chain of glulisine (also known as APIDRA®, Sanofi-Aventis). Insulin glulisine is a short acting analog created by substitution of asparagine at
position 3 by lysine and lysine at position 29 by glutamine of human insulin B chain. Insulin glulisine has more rapid onset of action and shorter duration of action compared to regular human insulin. - In other embodiments, the insulin amino acid sequence may contain an A and/or B chain of insulin glargine (also known as LANTUS®, Sanofi-Aventis). Insulin glargine has delayed absorption due to its acidic pH that causes microprecipitate formation of insulin crystals in the presence of neutral physiologic pH. Insulin glargine differs from human insulin in that the amino acid asparagine at position 21 of the A chain is replaced by glycine and two arginines are added to the C-terminus of the B-chain. Compared with bedtime neutral protamine Hagedorn (NPH) insulin (an intermediate acting insulin), insulin glargine is associated with less nocturnal hypoglycemia in patients with
type 2 diabetes. - In yet other embodiments, the insulin amino acid sequence may contain an A and/or B chain from insulin detemir (also known as LEVEMIR®, Novo Nordisk). Insulin detemir is a soluble (at neutral pH) long-acting insulin analog, in which the amino acid threonine at B30 is removed and a 14-carbon, myristoyl fatty acid is acetylated to the epsilon-amino group of LysB29. After subcutaneous injection, detemir dissociates, thereby exposing the free fatty acid which enables reversible binding to albumin molecules. So at steady state, the concentration of free unbound insulin is greatly reduced resulting in stable plasma glucose levels.
- In yet other embodiments, the insulin amino acid sequence may contain an A and/or B chain from insulin degludec (also known as TRESIBA®, Novo Nordisk). Insulin degludec is a soluble (at neutral pH) long-acting insulin analog, in which the amino acid threonine at B30 is removed and a side-chain consisting of glutamic acid and a C16 fatty acid has been attached. After subcutaneous injection, insulin degludec dissociates, thereby exposing the fatty acid which enables reversible binding to albumin molecules. So at steady state, the concentration of free unbound insulin is greatly reduced resulting in stable plasma glucose levels.
- In some embodiments, the insulin amino acid sequence may be a single-chain insulin analog (SIA) (e.g. as described in U.S. Pat. No. 6,630,438 and WO 2008/019368, which are hereby incorporated by reference in their entirety). Single-chain insulin analogs encompass a group of structurally-related proteins wherein the A and B chains are covalently linked by a polypeptide linker. The polypeptide linker connects the C-terminus of the B chain to the N-terminus of the A chain. The linker may be of any length so long as the linker provides the structural conformation necessary for the SIA to have a glucose uptake and insulin receptor binding effect. In some embodiments, the linker is about 5-18 amino acids in length. In other embodiments, the linker is about 9-15 amino acids in length. In certain embodiments, the linker is about 12 amino acids long. In certain exemplary embodiments, the linker has the sequence KDDNPNLPRLVR (SEQ ID NO.: 51) or GAGSSSRRAPQT (SEQ ID NO.: 52). However, it should be understood that many variations of this sequence are possible such as in the length (both addition and deletion) and substitutions of amino acids without substantially compromising the effectiveness of the produced SIA in glucose uptake and insulin receptor binding activities. For example, several different amino acid residues may be added or removed from either end without substantially decreasing the activity of the produced SIA.
- An exemplary single-chain insulin analog currently in clinical development is albulin (Duttaroy et al., 2005, Diabetes 54: 251-8). Albulin can be produced in yeast or in mammalian cells. It consists of the B and A chain of human insulin (100% identity to native human insulin) linked together by a dodecapeptide linker and fused to the NH2 terminals of the native human serum albumin. For expression and purification of albulin, Duttaroy et al. constructed a synthetic gene construct encoding a single-chain insulin containing the B- and A-chain of mature human insulin linked together by a dodecapeptide linker using four overlapping primers and PCR amplification. The resulting PCR product was ligated in-frame between the signal peptide of human serum albumin (HSA) and the NH2 terminus of mature HSA, contained within a pSAC35 vector for expression in yeast. In accordance with the present disclosure, the HSA component of abulin may be replaced with an amino acid sequence providing a sustained release as described herein.
- Thus, in some aspects, the present disclosure provides therapeutic agents including an amino acid sequence providing a sustained release, including, for example, an elastin-like peptide (ELP), and an insulin amino acid sequence. For example, in certain embodiments, the insulin is a mammalian insulin, such as human insulin or porcine insulin. In accordance with the disclosure, the amino acid sequence providing a sustained release component may be coupled (e.g., via recombinant fusion or chemical conjugation) to the insulin A chain, or B chain, or both. In some embodiments, the amino acid sequence that provides a slow absorption from the injection site is covalently bound to the insulin A chain. The insulin may comprise each of chains A, B, and C (e.g. SEQ ID NOs: 44 or 46), or may contain a processed form, containing only chains A and B. In some embodiments, chains A and B are connected by a short linking peptide, to create a single chain insulin. The insulin may be a functional analog of human insulin, including functional fragments truncated at the N-terminus and/or C-terminus (of either or both of chains A and B) by from 1 to 10 amino acids, including by 1, 2, 3, or about 5 amino acids. Functional analogs may contain from 1 to 10 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (e.g., SEQ ID NOs: 44, 46, 47 or 48), and in each case retaining the activity of the peptide. For example, functional analogs may have 1, 2, 3, 4, or 5 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (which may contain chains A and B, or chains A, B, and C). Such activity may be confirmed or assayed using any available assay, including those described herein. In these or other embodiments, the insulin component has at least about 75%, about 80%, about 85%, about 90%, about 95%, or about 98% identity with each of the native sequences for chains A and B (SEQ ID NOs: 47 or 48). The determination of sequence identity between two sequences (e.g., between a native sequence and a functional analog) can be accomplished using any alignment tool, including Tatusova et al.,
Blast 2 sequences—a new tool for comparing protein and nucleotide sequences, FEMS Microbiol Lett. 174:247-250 (1999). The insulin component may contain additional chemical modifications known in the art. - To characterize the in vitro binding properties of an insulin analog or an amino acid sequence providing a sustained release-containing insulin analog, competition binding assays may be performed in various cell lines that express the insulin receptor (Jehle et al., 1996, Diabetologia 39: 421-432). For example, competition binding assays using CHO cells overexpressing the human insulin receptor may be employed. Insulin can also bind to the IGF-1 receptor with a lower affinity than the insulin receptor. To determine the binding affinity of an amino acid sequence providing a sustained release-containing insulin analog, a competition binding assay can be performed using 125I-labeled IGF-1 in L6 cells.
- The activities of insulin include stimulation of peripheral glucose disposal and inhibition of hepatic glucose production. The ability of an amino acid sequence providing a sustained release-containing insulin analog to mediate these biological activities can be assayed in vitro using known methodologies. For example, the effect of an amino acid sequence providing a sustained release-containing analog on glucose uptake in 3T3-L1 adipocytes can be measured and compared with that of insulin. Pretreatment of the cells with a biologically active analog will generally produce a dose-dependent increase in 2-deoxyglucose uptake. The ability of an amino acid sequence providing a sustained release-containing insulin analog to regulate glucose production may be measured in any number of cells types, for example, H4IIe hepatoma cells. In this assay, pretreatment with a biologically active analog will generally result in a dose-dependent inhibition of the amount of glucose released.
- Vasoactive Intestinal Peptides
- Vasoactive intestinal peptide (VIP) is a 28 amino acid neuropeptide which binds to two receptors, VPAC1 and VPAC2, found in a variety of tissues including the airway, small intestine, testes, and pancreas. VIP and its functionally and structurally related analogs are known to have many physiological functions, including, relaxing airway smooth muscle thereby acting as a bronchodilator, stimulating fluid secretion in airway submucosal glands, and regulating water and electrolyte secretion in the intestines and pancreas (Wine (2007); Wu (2011); Derand (2004)).
- VIP-producing nerve fibers are co-localized with acetylcholine secreting neurons surrounding exocrine glands (Lundberg (1980); Heinz-Erian (1986)). In glands from subjects with functional CFTR protein, VIP induces fluid secretion, but this induction is impaired or absent in Cystic Fibrosis patients (Joo (2002); Joo (2012)). Further, in human and pig airway glands, administration of low concentrations of both VIP and acetylcholine stimulates the secretion mucus, but this synergism is lost in cystic fibrosis patients (Choi (2007)).
- VIP increases CFTR membrane insertion, stability, and function in human airway epithelial cells (Alshafie (2014)). In a murine VIP knockout model CFTR does not localize to the apical cell membrane, but instead remains mainly intracellular (Chappe and Said (2012)). The absence of CFTR from the apical membrane is associated with a lung pathology similar to that seen in Cystic Fibrosis patients, with inflammatory cell infiltration, thickening of the alveolar wall and the bronchiolar mucosa, and goblet cell hyperplasia. Administration of VIP intraperitoneally for three weeks restores CFTR apical membrane localization, and prolonged VIP stimulation increases the number of CFTR channels at the cell membrane (Chappe (2008)). This increase in apical CFTR density, which occurs via stabilization of CFTR at the membrane, is associated with an increase in CFTR-dependent function as measured by iodide efflux assays (Chappe (2008)).
- In some aspects the disclosure provides therapeutic compositions that may include one or more various VIP peptides. For example, the VIP peptide may comprise or consist of a polypeptide having SEQ ID NO: 53, SEQ ID NO: 54, or SEQ ID NO: 55. In some embodiments, the present disclosure provides a VIP without the N-terminal Methionine (e.g. SEQ ID NO: 55). In some embodiments, the present disclosure provides a VIP with the N-terminal Methionine (e.g. SEQ ID NO: 53).
- Mature human VIP has 28 amino acid residues with the following sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN (SEQ ID NO: 55). VIP results from processing of the 170-amino acid precursor molecule prepro-VIP. Structures of VIP and exemplary analogs have been described in U.S. Pat. Nos. 4,835,252, 4,939,224, 5,141,924, 4,734,400, 4,605,641, 6,080,837, 6,316,593, 5,677,419, 5,972,883, 6,489,297, 7,094,755, and 6,608,174.
- A number of mutations to improve peptide stability against proteases etc. are detailed in the literature (see Onune et al Physicochemical and pharmacological characterization of novel vasoactive intestinal peptide derivatives with improved stability, Eur. J. Pharm. Biopharm. 2009). For example, modified VIP peptides include the sequences of SEQ ID NOs: 53, 54, or 55 In some aspects, the present disclosure provides modified VIP peptides that include one or more of these modifications. In some embodiments, the present disclosure provides modified VIP peptides that include one or more of these modifications and further include additional VIP modifications described herein.
- In various embodiments, the present disclosure provides a modified VIP (e.g., including SEQ ID NO: 55) or a functional analog as described herein. Generally, functional analogs of VIP, include functional fragments truncated at the N- or C-terminus by from 1 to 10 amino acids, including by 1, 2, 3, or up to about 5 amino acids (with respect to SEQ ID NO: 55). Such functional analogs may contain from 1 to 5 amino acid insertions, deletions, and/or substitutions (collectively) with respect to the native sequence (e.g., SEQ ID NO: 55), and in each case retain the activity of the native peptide (e.g., through VPAC2 and/or VPAC1 binding). Such activity may be confirmed or assayed using any available assay, including an assay described herein, and including any suitable assay to determine or quantify an activity described in Delgado et al., The Significance of Vasoactive Intestinal Peptide in Immunomodulation, Pharmacol. Reviews 56(2):249-290 (2004). In these or other embodiments, the VIP component of the modified VIP has at least about 50%, about 75%, about 80%, about 85%, about 90%, about 95%, about 97% identity, about 98% identity, or about 99% identity with the native mature sequence (SEQ ID NO: 55). The determination of sequence identity between two sequences (e.g., between a native sequence and a functional analog) can be accomplished using any alignment tool, including for example, that disclosed in Tatusova et al.,
Blast 2 sequences—a new tool for comparing protein and nucleotide sequences, FEMS Microbiol Lett. 174:247-250 (1999). - In various aspects, the present disclosure provides a modified VIP molecule having receptor preference for VPAC2 or VPAC1, as compared to unmodified VIP (e.g., a peptide consisting of the amino acid sequence of SEQ ID NO: 55). For example, the modified VIP may have a relative binding preference for VPAC2 over VPAC1 of at least about 2:1, about 5:1, about 10:1, about 25:1, about 50:1, about 100:1, about 500:1 or more. In other embodiments, the modified VIP may have a relative binding preference for VPAC1 over VPAC2 of at least about 2:1, about 5:1, about 10:1, about 25:1, about 50:1, about 100:1, about 500:1, or more. For example, in certain embodiments, the modified VIP activates the VPAC2 receptor with an EC50 within a factor of about 2 of mature, unmodified, human VIP (SEQ ID NO: 55). However, this same modified VIP is 50- or 100-fold or more less potent than mature, unmodified, human VIP in activating the VPAC1 receptor. In some embodiments, the modified VIP may have relatively equipotent binding preferences for VPAC1 and VPAC2.
- Such modified VIP molecules may contain modified N-terminal regions, such as an addition of from 1 to about 500 amino acids to the N-terminal histidine of VIP, which may include heterologous mammalian amino acid sequences. For example, the modified VIP may contain a single methionine at the N-terminal side of the natural N-terminal histidine of mature VIP. This can be prepared in E. coli or other bacterial expression system, since the methionine will not be removed by E coli when the adjacent amino acid is histidine. Alternatively, the N-terminal amino acid may be any of the naturally-occurring amino acids, namely alanine, arginine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, serine, threonine, tryptophan, tyrosine, valine, and proline.
- The additional sequence added to the N-terminus of VIP may be of any sequence, including biologically active and biologically inert sequences of from 1 to about 100, 1 to about 50, 1 to about 20, 1 to about 10, and 1 to about 5 amino acids.
- The N-terminus of the modified VIP may have the structure M-N, where M is methionine, and N is the N-terminus of the VIP molecule (e.g., SEQ ID NO. 53). This methionine supports translation of the protein in a bacterial or eukaryotic host cell. Thus, the modified VIP can be made in a biological system, including bacterial and yeast expression systems (e.g., E. coli). While methionine can sometimes be removed by methionine aminopeptidase (MA) in bacterial expression systems, histidine (H) is one of the least favored residues at
position 2 for MA. - In some embodiments, the VIP is modified at the N-terminus. In some embodiments, the VIP is modified at the C-terminus.
- In other embodiments, VIP is activatable by a peptidase or protease, such as an endogenous peptidase or protease. Such activatable sequences are described in International Application No. PCT/US2009/068656. As used herein, the terms “peptidase” and “protease” are interchangeable. For example, the VIP may be designed to be activatable by a dipeptidyl peptidase. Exemplary dipeptidyl peptidases include dipeptidyl peptidase-1 (DPP-I), dipeptidyl peptidase-3 (DPP-III), dipeptidyl peptidase-4 (DPP-IV), dipeptidyl peptidase-6 (DPP-VI), dipeptidyl peptidase-7 (DPP-VII), dipeptidyl peptidase-8 (DPP-VIII), dipeptidyl peptidase-9 (DPP-IX), dipeptidyl peptidase-10 (DPP-X). Substrate sequences for such dipeptidases are known.
- In some embodiments, the N-terminus of an activatable VIP may have the structure Z-N, where Z is a substrate for a dipeptidase (e.g., Z is removed by dipeptidase exposure), and N is the N-terminus of VIP. The activatable VIP may have an N-terminal sequence with the formula M-X-N where M is methionine, X is Pro, Ala, or Ser, and N is the N-terminal of VIP or VIP analog. In this manner, M and X will be sensitive to, and removed by a host cell (e.g., E. coli), and/or a dipeptidase (e.g., DPP-IV), subsequently. Alternatively, the N-terminal sequence of the activatable VIP may be X1-X2-N, where X1 is Gly, Ala, Ser, Cys, Thr, Val, or Pro; X2 is Pro, Ala, or Ser; and N is the N-terminal of VIP. X1-X2 is a substrate for dipeptidase (e.g., DPP-IV), and dipeptidase digestion will expose N, the desired N-terminus of the VIP or the VIP analog. In such embodiments, the protein may be produced by expression of a construct encoding M-X1-X2-N (where M is methionine) in a host cell (e.g., E. coli.), since Gly, Ala, Ser, Cys, Thr, Val, or Pro at the second position will signal the removal of the Met, thereby leaving X1-X2 on the N-terminus, which can be activated by a dipeptidase (e.g., DPP-IV) in vivo. In some embodiments, the peptidase may be present in the body and act on the activatable VIP after injection.
- In other embodiments, the N-terminus of the modified activatable VIP has the structure M-Z-N, where M is methionine, Z is a substrate for a dipeptidase (e.g., Z is removed by dipeptidase exposure), and N is a non-His N-terminal of an active VIP (modified VIP).
- For example, the modified activatable VIP may have an N-terminal sequence with the formula M-X-N where M is methionine; X is Pro, Ala, or Ser; and N is a non-His N-terminal of the active VIP. In this manner, M and X will be sensitive to, and removed by a host cell (e.g., E. coli.), and/or a dipeptidase (e.g., DPP-IV), subsequently. Alternatively, the N-terminal sequence of the activatable VIP may be X1-X2-N, where X1 is Gly, Ala, Ser, Cys, Thr, Val, or Pro; X2 is Pro, Ala, or Ser; and N is a non-His N-terminal of the active VIP. X1-X2 is a substrate for dipeptidase (e.g., DPP-IV), and dipeptidase digestion will expose N, the desired non-His N-terminus of the VIP.
- In still other embodiments, the N-terminus of a modified activatable VIP has the structure M-Z-S-N, where M is methionine; Z is a substrate for a dipeptidase (e.g., Z is removed by dipeptidase exposure); N is the N-terminus of mature VIP (His); and S is one or more amino acids which will be exposed after dipeptidase digestion, and which provide a modified VIP as previously described. For example, the modified activatable VIP may have an N-terminal sequence with the formula M-X-S-N where M is methionine, X is Pro, Ala, or Ser; N is the N-terminal of mature VIP; and S is one or more amino acids which will be exposed after dipeptidase digestion, and will provide receptor preference. Alternatively, the N-terminal sequence of the activatable VIP may be X1-X2-S-N, where X1 is Gly, Ala, Ser, Cys, Thr, Val, or Pro; X2 is Pro, Ala, or Ser; N is a non-His N-terminal of VIP; and S is one or more amino acids which will be exposed after dipeptidase digestion. X1-X2 is a substrate for dipeptidase (e.g., DPP-IV), and dipeptidase digestion will expose S.
- In some embodiments, N-terminal chemical modifications to the VIP N-terminus provides receptor preference. Chemical modification of proteins and methods thereof are well known in the art. Non-limiting exemplary chemical modifications are PEGylation, methylglyoxalation, reductive alkylation, performic acid oxidation, succinylation, aminoethylation, and lipidation (Clifton, New Protein Techniques, New Jersey: Humana Press, 1985. ISBX. 0-89603-126-8. Volume. 3 of Methods in Molecular Biology). Chemical groups, such as PEGylation, may be attached by modifications of cysteine, methionine, histidine, lysine, arginine, tryptophan, tyrosine, carboxyl groups have been described previously (see Lundblad, Techniques in Protein Modification, CRC Press, 1995).
- The VIP active agent finds use in a method of treating a condition selected from uncontrolled or resistant hypertension, or pulmonary arterial hypertension (PAH), or chronic obstructive pulmonary disease (COPD), or cardiomyopathy secondary to muscular dystrophy, among others.
- Small Molecules
- In other embodiments, the therapeutic agent is a chemical conjugate between the active agent and the amino acid sequence capable of forming the matrix at the body temperature of the subject (e.g. an ELP). For example, the active agent may be a chemotherapeutic agent, such as a chemotherapeutic agent selected from methotrexate, daunomycin, mitomycin, cisplatin, vincristine, epirubicin, fluorouracil, verapamil, cyclophosphamide, cytosine arabinoside, aminopterin, bleomycin, mitomycin C, democolcine, etoposide, mithramycin, chlorambucil, melphalan, daunorubicin, doxorubicin, tamoxifen, paclitaxel, vinblastine, camptothecin, actinomycin D, cytarabine, and combrestatin. Alternatively, the agent may be an immunogenic molecule, or an immunomodulator, or an anti-inflammatory agent, such as an agent described in U.S. Patent Publication No. 2009/0004104, which is hereby incorporated by reference in its entirety. Also, the agent may be an opioid molecule, such as, for example oxycodone, morphine, or codeine, such as described in U.S. Provisional Application No. 61/597,898, which is hereby incorporated by reference. The chemical conjugate may be through a cleavable linker, for which numerous types are known in the art. See U.S. Pat. No. 6,328,996, which is hereby incorporated by reference in its entirety.
- Formulations
- The present disclosure provides sustained release formulations including a therapeutic agent disclosed herein and one or more pharmaceutically acceptable excipients and/or diluents. For example, such excipients include salts, and other excipients that may act to stabilize hydrogen bonding. Any appropriate excipient known in the art may be used. Exemplary excipients include, but are not limited to, amino acids such as histidine, glycine, or arginine; glycerol; sugars, such as sucrose; surface active agents such as
polysorbate 20 and polysorbate 80; citric acid; sodium citrate; antioxidants; salts including alkaline earth metal salts such as sodium, potassium, and calcium; counter ions such as chloride and phosphate; sugar alcohols (e.g. mannitol); preservatives; sugar alcohols (e.g. mannitol, sorbitol); and buffering agents. Exemplary salts include sodium chloride, potassium chloride, magnesium chloride, calcium chloride, sodium phosphate dibasic, sodium phosphate monobasic, sodium phosphate, and potassium phosphate. - The therapeutic agent is formulated at a pH, ionic strength, and generally with excipients sufficient to enable the formation of the matrix at body temperature (e.g., 37° C., or at from 34 to 36° C. in some embodiments). The therapeutic agent is generally prepared such that it does not form the matrix at storage conditions. The formulation can be stored frozen, refrigerated or at room temperature. Storage conditions are generally less than the transition temperature of the formulation, such as less than about 32° C., or less than about 30° C., or less than about 27° C., or less than about 25° C., or less than about 20° C., or less than about 15° C. For example, the formulation may be isotonic with blood or have an ionic strength that mimics physiological conditions. For example, the formulation may have an ionic strength of at least that of 25 mM Sodium Chloride, or at least that of 30 mM Sodium chloride, or at least that of 40 mM Sodium Chloride, or at least that of 50 mM Sodium Chloride, or at least that of 75 mM Sodium Chloride, or at least that of 100 mM Sodium Chloride, or at least that of 150 mM Sodium Chloride. In certain embodiments, the formulation has an ionic strength equivalent to that of 0.9% saline (154 mM sodium chloride).
- In some embodiments, the formulation is stable at storage conditions. Stability can be measured using any appropriate means in the art. Generally, a stable formulation is one that shows less than a 5% increase in degradation products or impurities. In some embodiments, the formulation is stable for at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, or at least about one year or more at the storage conditions. In some embodiments, the formulation is stable for at least about 1 month, at least about 2 months, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, or at least about one year or more at 25° C.
- In some embodiments, the formulation includes two or more of calcium chloride, magnesium chloride, potassium chloride, potassium phosphate monobasic, sodium chloride, sodium phosphate dibasic, sodium phosphate monobasic, histidine, arginine, glycine, glycerol, antimicrobial preservative (e.g. metacresol), tonicity-adjusting agent (e.g. mannitol), glacial acetic acid, sodium acetate trihydrate; sucrose, carboxymethylcellulose sodium, sodium phosphate monobasic monohydrate, sodium phosphate dibasic heptahydrate, zinc, m-cresol, phenol, sorbitol, polysorbate 80, and
polysorbate 20. In some embodiments, the formulation does not include carboxymethylcellulose. - In some embodiments, the formulation includes histidine or another amino acid at a range of about 10 mM to about 100 mM histidine. In some embodiments, the formulation includes histidine or another amino acid at a range of about 10 mM to about 30 mM histidine. In some embodiments, the formulation includes histidine or another amino acid at a range of about 15 mM to about 25 mM histidine. In some embodiments, the formulation includes NaCl at a range of about 10 mM to about 165 mM NaCl. In some embodiments, the formulation includes between about 50 mM and about 165 mM NaCl. In some embodiments, the formulation includes between about 54 mM and about 162 mM NaCl. In some embodiments, the formulation includes between about 110 mM and about 162 mM NaCl. In some embodiments, the formulation includes sodium phosphate at a range of about 1 mM to about 20 mM. In some embodiments, the formulation includes sodium phosphate at a range of about 5 mM to about 15 mM. In some embodiments, the formulation includes sodium phosphate monobasic at a range of about 2 mM to about 10 mM. In some embodiments, the formulation includes sodium phosphate monobasic at a range of about 4 mM to about 8 mM. In some embodiments, the formulation includes sodium phosphate dibasic at a range of about 1 mM to about 10 mM. In some embodiments, the formulation includes sodium phosphate dibasic at a range of about 2 mM to about 7 mM. In some embodiments, the formulation includes sodium phosphate dibasic at a range of about 2 mM to about 5 mM. In some embodiments, the formulation includes
polysorbate 20 at a range of about 0.01% to about 0.2%. In some embodiments, the formulation includes polysorbate 80 at a range of about 0.01% to about 0.2%. In some embodiments, the formulation includes sodium phosphate, sodium chloride, sodium phosphate monobasic, sodium phosphate dibasic, andPolysorbate 20. In some embodiments, the formulation includes about 10 mM sodium phosphate (about 7 mM sodium phosphate monobasic and about 3 mM sodium phosphate dibasic), about 110 mM sodium chloride, and about 0.1% polysorbate 20. - In some embodiments, the formulation is formulated at physiological pH. In In some embodiments, the formulation is formulated at a pH in the range of about 5.5 to about 7.5. In some embodiments, the formulation is formulated at a pH in the range of about 6.0 to about 7.0. In some embodiments, the formulation is formulated at a pH in the range of about 6.5 to about 7.0. In some embodiments, formulations with a lower pH demonstrate improved formulation stability compared to formulations at a higher pH. In some embodiments, formulations with a pH of about 6.5 demonstrate improved stability compared to formulations with a pH of about 7.0. In some embodiments, formulations with a pH of about 6.0 demonstrate improved stability compared to formulations with a pH of about 6.5. In some embodiments, formulations with a lower pH maintain a higher percentage of monomers compared to formulations at a higher pH. In some embodiments, formulations with a pH of about 6.5 maintain a higher percentage of monomers compared to formulations with a pH of about 7.0. In some embodiments, formulations with a pH of about 6.0 maintain a higher percentage of monomers compared to formulations with a pH of about 6.5.
- The protein concentration of the therapeutic agent in the formulation is tailored to drive the formation of the matrix at the temperature of administration. For example, higher protein concentrations help drive the formation of the matrix, and the protein concentration needed for this purpose varies depending on the ELP series used. For example, in embodiments using an ELP1-120, or amino acid sequences with comparable transition temperatures, the protein is present in the range of about 1 mg/mL to about 200 mg/mL, or is present in the range of about 30 mg/mL to about 150 mg/mL. In embodiments using an ELP4-120, or amino acid sequences with comparable transition temperatures, the protein is present in the range of about 0.005 mg/mL to about 10 mg/mL, or is present in the range of about 0.01 mg/mL to about 5 mg/mL.
- In some embodiments, the therapeutic agent may be present in the range of about 0.5 mg/mL to about 200 mg/mL, or is present in the range of about 30 mg/mL to about 150 mg/mL. In some embodiments, the therapeutic agent is present in the range of about 50 mg/mL to about 125 mg/mL, or the range of about 75 mg/mL to about 110 mg/mL. In some embodiments, the therapeutic agent is present at a concentration of about 100 mg/mL.
- In some aspects, the disclosure provides a method for delivering a sustained release regimen of an active agent disclosed herein. The method includes administering the pharmaceutical composition described herein to a subject in need, wherein the pharmaceutical composition is administered from about 1 to about 8 times per month. In some embodiments, the pharmaceutical composition is administered about 1 time, about 2 times, about 3 times, and/or about 4 times per month. In some embodiments, the pharmaceutical composition is administered weekly. In some embodiments, the pharmaceutical composition is administered daily. In some embodiments, the pharmaceutical composition is administered from one to three times weekly. In some embodiments, the pharmaceutical composition is administered once every two weeks. In some embodiments, the pharmaceutical composition is administered from one to two times a month. In particular embodiments, the pharmaceutical composition is administered about 1 time per month. In some embodiments, the pharmaceutical composition is administered about once every 2 months, about once every 3 months, about once every 4 months, about once every 5 months, and/or about once every 6 months. The pharmaceutical composition can be packaged in the form of pre-filled pens or syringes for administration once per week, twice per week, or from one to eight times per month, or alternatively filled in conventional vials and the like.
- In some embodiments, the formulation is administered about monthly, and may be administered subcutaneously or intramuscularly. In some embodiments, the formulation is administered about weekly, and may be administered subcutaneously or intramuscularly.
- In some embodiments, the site of administration is not a pathological site, for example, is not the intended site of action.
- In some embodiments, the pharmaceutical compositions disclosed herein are administered chronically. In some embodiments, the pharmaceutical compositions disclosed herein are administered for about 6 months, for about 7 months, for about 8 months, for about 9 months, for about 10 months, for about 11 months, for about 1 year, for about 2 years, for about 3 years, for about 4 years, for about 5 years, for about 10 years or more. The pharmaceutical compositions may be administered at any required dose and/or frequency disclosed herein.
- In some embodiments, the pharmaceutical compositions disclosed herein are administered until disease or disorder symptoms improve. In some embodiments, the pharmaceutical compositions disclosed herein are administered until disease or disorder symptoms are ameliorated, delayed, and/or cured.
- In some embodiments, the pharmaceutical compositions disclosed herein are administered before the patient begins to exhibit one or more disease or disorder symptoms. In some embodiments, the pharmaceutical compositions disclosed herein are administered at the onset of disease or disorder symptoms.
- The therapeutic agent is formulated generally for “systemic delivery,” meaning that the agent is not delivered locally to a pathological site or a site of action. Instead, the agent is absorbed into the bloodstream from the injection site, where the agent acts systemically or is transported to a site of action via the circulation. The therapeutic agent may be administered by any known route, such as for example, orally, intravenously, intramuscularly, nasally, subcutaneously, intra-vaginally, and intra-rectally. In some embodiments, the formulation is generally for subcutaneous administration. In some embodiments, the pharmacokinetic (PK) parameters are prolonged when the agent is administered subcutaneously. In some embodiments, the half-life of the fusion protein is prolonged. In some embodiments, the PK parameters when the agent is administered subcutaneously are prolonged compared with the agent administered by other means (e.g. intravenously). In some embodiments, the depot of the agent is prolonged when the agent is administered subcutaneously compared with the agent administered by other means (e.g. intravenously). By providing a slow absorption from the injection site, renal clearance and degradation can be controlled, thereby achieving the desired PK profile.
- Advantageously, the compositions provide for prolonged pharmacokinetic exposure due to sustained release of the active agent. In particular aspects, the maximal exposure level may be achieved at about 10 hours, about 24 hours, about 48 hours or about 72 hours after administration; typically the maximum exposure level is achieved between about 10 hours and about 48 hours after administration. After the maximal exposure level is achieved the compositions may achieve a sustained rate of release whereby a substantial percentage of the maximal level is obtained for a period of time. For example, the sustained rate may about 50%, about 60%, about 70%, about 80%, about 90% or about 100% of the maximal exposure level. Exemplary periods of time for maintaining the sustained rate are about 3 days, about 4 days, about 5 days, about 6 days, about 1 week, about 2 weeks, about 4 weeks, about 6 weeks, or about 8 weeks, after the maximal exposure level is achieved. Subsequently, the sustained rate may lower to a reduced exposure rate. Such reduced exposure rates may be about 5%, about 10%, about 20%, about 30%, about 40%, about 50% or about 60% of the maximal exposure level.
FIG. 20B illustrates an embodiment (PE0256) whereby a maximal exposure level of 1000 ng/mL is obtained within about 1-2 days. After this period, a sustained rate of about 70-100% of the maximal exposure level is maintained until about days 10-12 whereupon a reduced exposure rate from about 60% decreasing down to about 10% is obtained for the remainder of the study. - In various embodiments, the plasma concentration of the active agent does not change by more than a factor of about 20, or a factor of about 10, or a factor of about 5, or a factor of about 3 over the course of a plurality of administrations, such as at least 2, at least about 5, or at least about 10 administrations of the formulation. In some embodiments, the plasma concentration of the active agent does not change by more than a factor of about 20, or a factor of about 10, or a factor of about 5, or a factor of about 3 between each administration. In some embodiments, there is some accumulation until steady state is reached (e.g. after about 3 to about 4 administrations). The administrations are substantially evenly spaced, such as, for example, about daily, or about once per week, or from one to about five times per month, or about once every two months, or about once every three months. In other embodiments, the dose may be steadily increased over several administrations, so steady state is reached after 5 or more administrations.
- The pharmaceutical compositions disclosed herein may be administered in smaller doses and/or less frequently than unfused or unconjugated counterparts. While one of skill in the art can determine the desirable dose in each case, a suitable dose of the therapeutic agent for achievement of therapeutic benefit, may, for example, be in a range of about 1 microgram (μg) to about 100 milligrams (mg) per kilogram body weight of the recipient per dose, preferably in a range of about 10 μg to about 50 mg per kilogram body weight per dose and most preferably in a range of about 10 μg to about 50 mg per kilogram body weight per dose. In some embodiments, the pharmaceutical composition is administered at a low dose. In some embodiments, the pharmaceutical composition is administered at a dose between 1 mg per kilogram per body weight per dose to about 9 mg per kilogram per body weight per dose. In some embodiments, the pharmaceutical composition is administered at about 1 mg per kilogram body weight per dose, about 3 mg per kilogram body weight per dose, and/or about 9 mg per kilogram body weight per dose. The desired dose may be presented as one dose or two or more sub-doses administered at appropriate intervals throughout the day. These sub-doses can be administered in unit dosage forms, for example, containing from about 10 μg to about 1000 mg, preferably from about 50 μg to about 500 mg, and most preferably from about 50 μg to about 250 mg of active ingredient per unit dosage form. Alternatively, if the condition of the recipient so requires, the doses may be administered as a continuous infusion.
- In certain embodiments, the subject is a human, but in other embodiments may be a non-human mammal, such as a domesticated pet (e.g., dog or cat), or livestock or farm animal (e.g., horse, cow, sheep, or pig).
- It should be understood that singular forms such as “a,” “an,” and “the” are used throughout this application for convenience, however, except where context or an explicit statement indicates otherwise, the singular forms are intended to include the plural. All numerical ranges should be understood to include each and every numerical point within the numerical range, and should be interpreted as reciting each and every numerical point individually. The endpoints of all ranges directed to the same component or property are inclusive, and intended to be independently combinable.
- The term “about” when used in connection with a referenced numeric indication means the referenced numeric indication plus or minus up to 10% of that referenced numeric indication. For example, the language “about 50” covers the range of 45 to 55.
- As used herein, the word “include,” and its variants, is intended to be non-limiting, such that recitation of items in a list is not to the exclusion of other like items that may also be useful in the materials, compositions, devices, and methods of this technology. Similarly, the terms “can” and “may” and their variants are intended to be non-limiting, such that recitation that an embodiment can or may comprise certain elements or features does not exclude other embodiments of the present technology that do not contain those elements or features. Although the open-ended term “comprising,” as a synonym of terms such as including, containing, or having, is used herein to describe and claim the disclosure, the present technology, or embodiments thereof, may alternatively be described using more limiting terms such as “consisting of” or “consisting essentially of” the recited ingredients.
- As used herein, “half-life” (which generally refers to in vivo half-life or circulatory half-life) is the period of time that is required for a 50% diminution of bioactivity of the active agent to occur. In some embodiments, this term includes both prolonged exposure and a long half-life (e.g. both a slow uptake from the injection site and retardation of clearance compared to the unconjugated peptide).
- Unless defined otherwise, all technical and scientific terms herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials, similar or equivalent to those described herein, can be used in the practice or testing of the present disclosure, the preferred methods and materials are described herein.
- This disclosure is further illustrated by the following non-limiting examples.
- The phase transition property exhibited by certain amino acid sequences is illustrated in
FIG. 1 (for ELP1) andFIG. 2 (for ELP4). Phase transition can be observed as an increase in turbidity.FIG. 3 illustrates, without wishing to be bound by theory, a potential mechanism for phase transition, driven by exclusion of a water shell and formation of hydrogen bonds at a temperature above the phase transition temperature for a given concentration. - Changing the amino acid in the guest residue position X in the VPGXG (SEQ ID NO:3) sequence of the ELP motif can change stability or strength of a coacervate of an ELP biopolymer in the transitioned state, resulting in slower release of drug and a prolonged depot when dosed subcutaneously. A collection of ELP biopolymers with different coacervation strengths was built by changing the ratio of guest amino acids used in nine VPGXG (SEQ ID NO:3) pentamer (9mer) blocks (alpha, beta, and beta v2). In addition to substituting the guest residue of VPGXG (SEQ ID NO:3), a pentamer with the motif XPGVG (SEQ ID NO:3) was also constructed (delta). The ELP pentamers can be combined to any length but for exemplification and ease of DNA synthesis and manipulation subunits of 9 ELP pentamers (9mers) were constructed. These 9mers can be combined to make polymers of any length but the overall ratio of valine to other amino acids at the guest residue position will remain the same.
FIG. 4 shows an alignment of these 9mers (alpha, beta, beta v2, and delta). The 9mers were designed to create ELP biopolymers with hydrophobicity and thus transition temperatures between theELP 1 series (VPGXG (SEQ ID NO:3): V5A2G3) andELP 4 series (VPGXG (SEQ ID NO:3): V-5) biopolymers previously examined. Another ELP polymer was developed which is not depicted inFIG. 10 . This polymer (ELPgamma) includes the VPGXG pentamer motif with a ratio of V5:A2:G2. Table 1 compares the ratios of guest residue occupancy between 9mers of the new ELP series and the 1 and 4 series. - The 9mers were repeated using recursive ligation to build biopolymers of different lengths.
FIG. 5 illustrates this ligation technique. The 9mers were synthesized (Integrated DNA Technologies, Coralville, Iowa) in a background vector (pIDT) to create synthesis vectors. These synthesis vectors were cut with BglI/PflMI restriction enzymes and sub-cloned back into the same synthesis vector cut with BglI and dephosphorylated. This gives a vector containing two copies of the 9mer. This doubling technique was continued until vectors containing 16 copies of the 9mer (144mer) were built. ELPs of varying numbers of 9mers can be combined to produce ELPs with, for instance, 18, 27, 36, 45, 54, 63, 72, 81, 90, 99, 108, 117, 126, 135, 144, 153, 162, 171, 180 copies of the 9mer. The units described in Table 1 can also be combined in various ratios to produce additional ELP biopolymers with intermediate characteristics. For instance, the gamma ELP polymer was constructed by alternating between an alpha 9mer and a beta 9mer until a 144mer was constructed. These ELP 144mers were then sub-cloned into a pET-based intermediate vector, pPE0248 (FIG. 6 ) which contains a linker region (FIG. 7 ) that allows the ELP144mers to be cloned into the correct reading frame for expression. pPE0248 adds an additional pentamer repeat to the N terminus of the 144mer with valine in the guest position and an additional pentamer to the C terminus with a tryptophan in the guest residue. The tryptophan may be used as a means to increase the extinction coefficient of the molecule, allowing for better measurement of absorbance, for instance at 280 nm, which can be useful for determination of protein concentration, or for monitoring protein content during purification. The pentamers added to either end can also be designed so as the encoding DNA contains restriction enzyme recognition sites for cloning of fusion partners on to either end of the ELP coding sequence. The 144mer expression plasmids were designated pPE0249 (ELPalpha-144), pPE0250 (ELPbetaV1-144), pPE0362 (ELPbetaV2-144), pPE0251 (ELPgamma-144), and pPE0252 (ELPdelta-144).FIGS. 8 through 17 contain the ELP amino acid sequences of the biopolymers and maps of the vectors. - The GLP-1 peptide was cloned onto the N-terminus of different ELP sequences. A synthesized GLP-1 gene was digested XbaI/BsrGI and cloned XbaI/Acc65i into pPE0249, pPE0250, pPE0362, pPE0251, and pPE0252 making vectors pPE0253 (GLP-1:ELPalpha-144), pPE254 (GLP-1:ELPbetaV1-144), pPE0311 (GLP-1:ELPbetaV2-144), pPE0255 (GLP-1:ELPgamma-144), pPE0256 (GLP-1:ELPdelta-144) respectively. These vectors were expressed in E. coli strain BLR(DE3). Following fermentation and purification, the peptide fusions including the different ELP polymers were formulated at 10 mg/mL in 20 mM histidine, 110 mM NaCl, and the transition temperatures measured using a Cary 300 UV Spectrophotometer. As shown in
FIG. 18 and Table 2, the transition temperatures of ELPalpha-144, ELPbetaV1-144, ELPbetaV2-144, ELPgamma-144, and ELPdelta-144 fall between, but do not include, the temperatures for theseries 4 ELPs (PE0002) and theseries 1 ELPs (PB1023). - The PK of the PE0253 (alpha), PE0254 (beta v1), PE0255 (gamma), PE0256 (delta), and PE0311 (beta v2) were evaluated in Cynomolgus monkeys.
FIG. 19 and Table 4 display the PK results of non-naïve monkeys, 1 male and 1 female per group, each dosed with a single subcutaneous injection of 20 mg/kg of either PE0253, PE0254, PE0255, or PE0256.FIG. 20 and Table 5 show the PK results of a single subcutaneous dose of PE0256 at 10 mg/kg into four protein naïve monkeys, 2 male and 2 female.FIG. 21 and Table 6 demonstrate the PK results of a single subcutaneous dose of PE0311 at 10 mg/kg into three protein naïve monkeys, all male. In contrast,FIG. 22 and Table 7 show the PK results of non-naïve monkeys dosed with a single IV injection of PE0256 at 2 mg/kg. - An human growth hormone (hGH) sequence was synthesized, digested with restriction enzymes PflM1/Bgl I, and then sub-cloned into plasmid pE0362 to provide plasmid pPE0429, placing a ELPbetaV2-144 on the N-terminus of the hGH sequence.
FIG. 23 shows the plasmid map of pPE0429.FIG. 24 shows the sequence of the fusion protein. This construct provides an ELP with 16 repeats of the ELPbetaV2 9mer. - In a further fusion protein, an ELP1 30mer was appended to the C-terminus of the fusion protein in pPE0429 to provide plasmid pPE0430. Adding the ELP1 30mer disrupts receptor mediated clearance and thus further increases circulatory half-life of the hGH fusion protein.
FIG. 27 shows the plasmid map for plasmid pPE0430.FIG. 28 shows the sequence of the fusion protein. - In other experiments, the hGH protein was fused to a
series 1 ELP 120mer, both alone and with a C-terminal ELP1 series 30 mer.FIG. 25 shows the plasmid map for plasmid pPE0431, prepared by inserting hGH into the pPB1031, providing a ELP1 series 120mer with a C-terminal hGH sequence.FIG. 26 shows the sequence of the fusion protein. The ELP1 120mer protein was inserted into the plasmid pPE0431 to append an ELP1 30mer protein to the C-terminus of the ELP1-120 hGH fusion protein. The resulting plasmid was termed pPE0432.FIG. 29 . The resulting amino acid sequence of the ELP1-120mer-hGH-ELP1 30mer is shown inFIG. 30 . - An exendin-4 encoding sequence was synthesized, digested with restriction enzymes XbaI/BsrGI, and then sub-cloned into plasmid pE0362 to provide plasmid pPE0364, placing the exendin-4 sequence on the N-terminus of the ELPbetaV2-144 sequence.
FIG. 31 shows the plasmid map of pPE0364.FIG. 32 shows the sequence of the fusion protein. This construct provides an ELP with 16 repeats of the ELPbetaV2 9mer. - All patents and publications referenced herein are hereby incorporated by reference in their entireties, including the publications disclosed below.
- The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure.
- This application incorporates by reference the following publications in their entireties for all purposes: US 2001/0034050 A1; US 2009/0220455; U.S. Pat. No. 8,334,257; US 2013/0310538; US 2013/0172274; US 2011/0236384; U.S. Pat. Nos. 6,582,926; 7,429,458; 7,364,859; 8,178,495; US 2013/0079277; US 2013/0085099; US 2013/0143802; US 2014/0024600; US 2011/0178017; U.S. Pat. No. 7,709,227; US 2011/0123487; U.S. Pat. No. 8,729,018; US 2014/0171370; US 2013/0150291; WO/2014/113434; and US 2014/0213516.
-
TABLE 4 PK results from non-naïve monkeys, 1 male and 1 female per group, each dosed with a single subcutaneous injection of 20 mg/kg of either PE0253 (alpha), PE0254 (beta v1), PE0255 (gamma), or PE0256 (delta). PK Results (ng/mL) PE0253 (alpha) PE0254 (betav1) Time (Hours) 905 906 Average 907 908 Average 0 BLQ BLQ BLQ BLQ BLQ BLQ 1 84.3 111 97.65 69.6 112 90.8 3 170 201 185.5 139 180 159.5 6 136 256 196 167 160 163.5 24 98.7 63.1 80.9 50.9 67.2 59.05 48 80.8 48.7 64.75 33.6 39.3 36.45 72 64.8 44.6 54.7 21.8 24.8 23.3 168 51.8 54.8 53.3 16.5 14.8 15.65 240 46.7 50.3 48.5 16.1 13.6 14.85 336 5.87 62.1 33.985 9.23 15.5 12.365 408 BLQ 61.7 61.7 10.4 13.5 11.95 504 BLQ 10.6 10.6 2.85 15 8.925 576 BLQ BLQ BLQ BLQ 11.9 11.9 672 BLQ BLQ BLQ BLQ 13.5 13.5 720 BLQ BLQ BLQ BLQ 14.5 14.5 BLQ < 2.44 ng/mL BLQ < 4.88 ng/mL PE0255 (gamma) PE0256 (delta) Time (Hours) 909 910 Average 911 912 Average 0 BLQ BLQ BLQ BLQ BLQ BLQ 1 93.5 78 85.75 33 97.9 65.45 3 124 148 136 164 196 180 6 84.4 142 113.2 214 266 240 24 49.4 54.1 51.75 190 454 322 48 32.4 42.2 37.3 490 543 516.5 72 21.9 31.2 26.55 951 594 772.5 168 26.5 29.3 27.9 1430 754 1092 240 4.51 15.4 9.955 3490 1170 2330 336 BLQ BLQ BLQ 483 1450 966.5 408 BLQ BLQ BLQ 73.8 1350 711.9 504 BLQ BLQ BLQ 4.3 914 459.15 576 BLQ BLQ BLQ BLQ 839 839 672 BLQ BLQ BLQ BLQ 852 852 720 BLQ BLQ BLQ BLQ 691 691 BLQ < 2.44 ng/mL BLQ < 4.88 ng/mL -
TABLE 5 PK results (ng/mL) from of a single subcutaneous dose of PE0256 (delta) at 10 mg/kg into four protein naive monkeys, 2 male and 2 female. PK results (ng/mL) Hours Days M1 M2 F1 F2 0 0 blq 17 blq blq 1 0.042 232 94 52.9 241 3 0.125 482 217 176 596 6 0.25 492 257 277 831 24 1 997 374 1030 1610 48 2 1260 677 1630 1640 72 3 1130 875 1780 1660 168 7 1230 1140 1620 1210 240 10 1540 783 1220 1030 336 14 27 617 440 758 408 17 blq 395 102 587 504 21 blq 128 16.6 383 576 24 blq 38.3 blq 348 672 28 blq 5.6 3.6 230 720 30 blq blq blq 97.5 -
TABLE 6 PK results of a single subcutaneous dose of PE0311 (beta v2) at 10 mg/kg into three protein naïve monkeys, all male. PK Results (ng/mL) Time (hrs) Days 1M1 1M2 1M3 Average SD 0 0 BLQ BLQ BLQ 0 0 1 0.042 230 206 181 205.7 24.5 3 0.125 826 426 368 540.0 249.4 6 0.25 1050 360 355 588.3 399.8 24 1 619 333 533 495.0 146.7 48 2 702 548 621 623.7 77.0 72 3 1340 695 799 944.7 346.3 168 7 2110 1270 1640 1673.3 421.0 240 10 1370 1130 726 1075.3 325.5 336 14 1150 224 393 589.0 493.1 408 17 1690 24.8 290 668.3 894.7 504 21 908 BLQ 133 520.5 548.0 576 24 289 BLQ 68.9 179.0 155.6 672 28 205 BLQ 38.3 121.7 117.9 720 30 137 BLQ 39.8 88.4 68.7 -
TABLE 7 PK results (in ng/mL) of non-naïve monkeys dosed with a single IV injection of PE0256 (delta) at 2 mg/kg. PE0256 (delta) Time (Hours) 914 915 Average 0 BLQ BLQ BLQ 0.083 31300 30400 30850 0.25 28600 29400 29000 0.5 30400 29000 29700 0.75 25500 26500 26000 1 25900 23600 24750 2 22200 18800 20500 3 19300 16400 17850 6 15500 12000 13750 24 4700 2960 3830 48 1120 434 777 72 334 48.6 191.3 96 57.6 5.38 31.49 120 9.81 BLQ 9.81 144 BLQ BLQ BLQ 168 BLQ BLQ BLQ
Claims (34)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/939,624 US20200353091A1 (en) | 2014-11-21 | 2020-07-27 | Elp fusion proteins for controlled and sustained release |
US18/323,208 US20230414773A1 (en) | 2014-11-21 | 2023-05-24 | Elp fusion proteins for controlled and sustained release |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201462082945P | 2014-11-21 | 2014-11-21 | |
US201462098624P | 2014-12-31 | 2014-12-31 | |
PCT/US2015/061955 WO2016081884A2 (en) | 2014-11-21 | 2015-11-20 | Elp fusion proteins for controlled and sustained release |
US201715527985A | 2017-05-18 | 2017-05-18 | |
US16/939,624 US20200353091A1 (en) | 2014-11-21 | 2020-07-27 | Elp fusion proteins for controlled and sustained release |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/527,985 Continuation US10722590B2 (en) | 2014-11-21 | 2015-11-20 | ELP fusion proteins for controlled and sustained release |
PCT/US2015/061955 Continuation WO2016081884A2 (en) | 2014-11-21 | 2015-11-20 | Elp fusion proteins for controlled and sustained release |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/323,208 Continuation US20230414773A1 (en) | 2014-11-21 | 2023-05-24 | Elp fusion proteins for controlled and sustained release |
Publications (1)
Publication Number | Publication Date |
---|---|
US20200353091A1 true US20200353091A1 (en) | 2020-11-12 |
Family
ID=56014690
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/527,985 Active US10722590B2 (en) | 2014-11-21 | 2015-11-20 | ELP fusion proteins for controlled and sustained release |
US16/939,624 Abandoned US20200353091A1 (en) | 2014-11-21 | 2020-07-27 | Elp fusion proteins for controlled and sustained release |
US18/323,208 Pending US20230414773A1 (en) | 2014-11-21 | 2023-05-24 | Elp fusion proteins for controlled and sustained release |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/527,985 Active US10722590B2 (en) | 2014-11-21 | 2015-11-20 | ELP fusion proteins for controlled and sustained release |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US18/323,208 Pending US20230414773A1 (en) | 2014-11-21 | 2023-05-24 | Elp fusion proteins for controlled and sustained release |
Country Status (7)
Country | Link |
---|---|
US (3) | US10722590B2 (en) |
EP (1) | EP3220936A4 (en) |
JP (3) | JP7075757B2 (en) |
CN (1) | CN107206044A (en) |
AU (2) | AU2015349743B2 (en) |
CA (1) | CA2967394A1 (en) |
WO (1) | WO2016081884A2 (en) |
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9561262B2 (en) | 2011-06-06 | 2017-02-07 | Phasebio Pharmaceuticals, Inc. | Use of modified vasoactive intestinal peptides in the treatment of hypertension |
EP3139949B1 (en) | 2014-05-08 | 2020-07-29 | Phasebio Pharmaceuticals, Inc. | Compositions comprising a vip-elp fusion protein for use in treating cystic fibrosis |
EP3220936A4 (en) | 2014-11-21 | 2018-08-22 | Phasebio Pharmaceuticals, Inc. | Elp fusion proteins for controlled and sustained release |
JP6824888B2 (en) * | 2015-02-09 | 2021-02-03 | フェーズバイオ ファーマシューティカルズ,インコーポレイテッド | Methods and compositions for treating muscle disorders and disorders |
AU2016315656A1 (en) | 2015-08-28 | 2018-02-01 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
JP7325075B2 (en) * | 2018-09-21 | 2023-08-14 | 学校法人 埼玉医科大学 | For screening at least one agent selected from the group consisting of agents for increasing or decreasing the number of frizzled 3-expressing cells, agents for preventing or treating diabetes, agents for preventing or treating insulinoma, and agents for promoting or suppressing insulin secretion Screening Agent, Screening Kit, and Screening Method |
WO2021030196A1 (en) * | 2019-08-09 | 2021-02-18 | Phasebio Pharmaceuticals, Inc. | Elp fusion proteins comprising parathyroid hormone for controlled and sustained release |
US20230173030A1 (en) * | 2020-05-05 | 2023-06-08 | Phasebio Pharmaceuticals, Inc. | Vasoactive intestinal peptide fusion proteins for the treatment of covid-19 |
CN113735941B (en) * | 2021-08-13 | 2024-01-30 | 江南大学 | Protein purification method and application thereof |
Family Cites Families (25)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5854387A (en) | 1995-04-14 | 1998-12-29 | Bioelastics Research, Ltd. | Simple method for the purification of a bioelastic polymer |
AU3867400A (en) | 1999-03-19 | 2000-10-09 | Duke University | Methods of using bioelastomers |
US6852834B2 (en) | 2000-03-20 | 2005-02-08 | Ashutosh Chilkoti | Fusion peptides isolatable by phase transition |
US20050255554A1 (en) | 2000-03-20 | 2005-11-17 | Ashutosh Chilkoti | Fusion peptides isolatable by phase transition |
SE0302191D0 (en) | 2003-03-10 | 2003-08-11 | Staffan Gunnarsson | Transponder with infrared technology |
WO2007002362A2 (en) | 2005-06-24 | 2007-01-04 | Duke University | A direct drug delivery system based on thermally responsive biopolymers |
US7846445B2 (en) | 2005-09-27 | 2010-12-07 | Amunix Operating, Inc. | Methods for production of unstructured recombinant polymers and uses thereof |
US8841255B2 (en) | 2005-12-20 | 2014-09-23 | Duke University | Therapeutic agents comprising fusions of vasoactive intestinal peptide and elastic peptides |
CA2634034A1 (en) | 2005-12-20 | 2007-06-28 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
US20130172274A1 (en) | 2005-12-20 | 2013-07-04 | Duke University | Methods and compositions for delivering active agents with enhanced pharmacological properties |
US7709227B2 (en) | 2006-01-04 | 2010-05-04 | Phasebio Pharmaceuticals, Inc. | Multimeric ELP fusion constructs |
WO2008036147A2 (en) | 2006-07-24 | 2008-03-27 | Duke University | Drug delivery with stimulus responsive biopolymers |
WO2008030968A2 (en) | 2006-09-06 | 2008-03-13 | Phase Bioscience, Inc. | Fusion peptide therapeutic compositions |
SI2173890T1 (en) | 2007-06-21 | 2011-06-30 | Univ Muenchen Tech | Biological active proteins having increased in vivo and/or vitro stability |
WO2009067584A1 (en) | 2007-11-20 | 2009-05-28 | Duke University | Methods and compositions for modulating drug-polymer architecture, pharmacokinetics and biodistribution |
EP2926825A1 (en) | 2008-06-27 | 2015-10-07 | Duke University | Therapeutic agents comprising elastin-like peptides |
WO2010080578A1 (en) | 2008-12-18 | 2010-07-15 | Phasebio Pharmaceuticals, Inc. | Biologically active proteins activatable by peptidase |
WO2010124180A1 (en) | 2009-04-23 | 2010-10-28 | Phasebio Pharmaceuticals, Inc. | Phenylalanine hydroxylase fusion protein and methods for treating phenylketonuria |
JP5801807B2 (en) | 2009-08-14 | 2015-10-28 | フェーズバイオ ファーマシューティカルズ,インコーポレイテッド | Modified vasoactive intestinal peptide |
US20130090285A1 (en) | 2011-06-27 | 2013-04-11 | Phasebio Pharmaceuticals, Inc. | Methods of treatment with glp-1 receptor agonists |
US20130084277A1 (en) * | 2011-08-24 | 2013-04-04 | Phasebio Pharmaceuticals, Inc. | Formulations of active agents for sustained release |
JP2014534265A (en) * | 2011-11-28 | 2014-12-18 | フェーズバイオ ファーマシューティカルズ,インコーポレイテッド | Therapeutic drugs containing insulin amino acid sequence |
WO2014081849A1 (en) * | 2012-11-20 | 2014-05-30 | Phasebio Pharmaceuticals, Inc. | Formulations of active agents for sustained release |
US20150361154A1 (en) | 2013-01-15 | 2015-12-17 | Phasebio Pharmaceuticals, Inc. | Therapeutic agents, compositions, and methods for glycemic control |
EP3220936A4 (en) | 2014-11-21 | 2018-08-22 | Phasebio Pharmaceuticals, Inc. | Elp fusion proteins for controlled and sustained release |
-
2015
- 2015-11-20 EP EP15860714.3A patent/EP3220936A4/en active Pending
- 2015-11-20 CN CN201580073854.5A patent/CN107206044A/en active Pending
- 2015-11-20 AU AU2015349743A patent/AU2015349743B2/en active Active
- 2015-11-20 WO PCT/US2015/061955 patent/WO2016081884A2/en active Application Filing
- 2015-11-20 JP JP2017525911A patent/JP7075757B2/en active Active
- 2015-11-20 US US15/527,985 patent/US10722590B2/en active Active
- 2015-11-20 CA CA2967394A patent/CA2967394A1/en active Pending
-
2020
- 2020-07-27 US US16/939,624 patent/US20200353091A1/en not_active Abandoned
- 2020-10-08 JP JP2020170512A patent/JP2021008501A/en active Pending
-
2021
- 2021-09-10 AU AU2021229233A patent/AU2021229233A1/en active Pending
-
2022
- 2022-08-23 JP JP2022132284A patent/JP7461997B2/en active Active
-
2023
- 2023-05-24 US US18/323,208 patent/US20230414773A1/en active Pending
Also Published As
Publication number | Publication date |
---|---|
EP3220936A2 (en) | 2017-09-27 |
JP2022176986A (en) | 2022-11-30 |
AU2015349743A1 (en) | 2017-05-25 |
US20190015523A1 (en) | 2019-01-17 |
EP3220936A4 (en) | 2018-08-22 |
JP2018500291A (en) | 2018-01-11 |
CA2967394A1 (en) | 2016-05-26 |
US20230414773A1 (en) | 2023-12-28 |
WO2016081884A2 (en) | 2016-05-26 |
AU2015349743B2 (en) | 2021-06-10 |
CN107206044A (en) | 2017-09-26 |
AU2021229233A1 (en) | 2021-10-28 |
JP7075757B2 (en) | 2022-05-26 |
JP2021008501A (en) | 2021-01-28 |
WO2016081884A3 (en) | 2016-09-15 |
JP7461997B2 (en) | 2024-04-04 |
US10722590B2 (en) | 2020-07-28 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230414773A1 (en) | Elp fusion proteins for controlled and sustained release | |
Gupta | Glucagon-like peptide-1 analogues: an overview | |
EP3452021B1 (en) | Elp fusion proteins for controlled and sustained release | |
US20140364362A1 (en) | Therapeutic agents comprising insulin amino acid sequences | |
AU2003208945B2 (en) | Method for administering GLP-1 molecules | |
EP2926825A1 (en) | Therapeutic agents comprising elastin-like peptides | |
CA2846209C (en) | Systemic sustained release formulation comprising elastinlike peptide repeating sequence and protein active agent | |
TW201808989A (en) | Glucagon-receptor selective polypeptides and methods of use thereof | |
US20150361154A1 (en) | Therapeutic agents, compositions, and methods for glycemic control | |
KR20170085611A (en) | Modified Vasoactive Intestinal Peptide | |
Park et al. | Exendins and exendin analogs for diabetic therapy: a patent review (2012-2015) | |
Linderoth et al. | GLP‐1 Receptor Agonists for the Treatment of Type 2 Diabetes and Obesity | |
WO2010014689A1 (en) | Pharmaceutical formulations comprising elastin-like proteins |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: PHASEBIO PHARMACEUTICALS, INC., PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:JOWETT, JAMES;BALLANCE, DAVID JAMES;REEL/FRAME:054206/0431 Effective date: 20150410 Owner name: PHASEBIO PHARMACEUTICALS, INC., PENNSYLVANIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:JOWETT, JAMES;BALLANCE, DAVID JAMES;REEL/FRAME:054206/0385 Effective date: 20150410 |
|
AS | Assignment |
Owner name: SILICON VALLEY BANK, CALIFORNIA Free format text: SECURITY INTEREST;ASSIGNOR:PHASEBIO PHARMACEUTICALS, INC.;REEL/FRAME:056405/0575 Effective date: 20200319 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
AS | Assignment |
Owner name: JMB CAPITAL PARTNERS LENDING, LLC, CALIFORNIA Free format text: ASSIGNMENT OF INTELLECTUAL PROPERTY SECURITY AGREEMENT;ASSIGNOR:SILICON VALLEY BANK;REEL/FRAME:061606/0035 Effective date: 20221003 |
|
STCV | Information on status: appeal procedure |
Free format text: NOTICE OF APPEAL FILED |
|
AS | Assignment |
Owner name: JMB CAPITAL PARTNERS LENDING, LLC, CALIFORNIA Free format text: SECURITY INTEREST;ASSIGNOR:PHASEBIO PHARMACEUTICALS, INC.;REEL/FRAME:061601/0001 Effective date: 20221028 |
|
AS | Assignment |
Owner name: PHASEBIO PHARMACEUTICALS, INC., PENNSYLVANIA Free format text: RELEASE BY SECURED PARTY;ASSIGNOR:JMB CAPITAL PARTNERS LENDING, LLC;REEL/FRAME:062376/0850 Effective date: 20230113 |
|
AS | Assignment |
Owner name: IMMUNOFORGE CO., LTD., KOREA, REPUBLIC OF Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:PHASEBIO PHARMACEUTICALS, INC.;REEL/FRAME:062993/0313 Effective date: 20230203 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |