US20200239560A1 - Anti-egf like domain multiple 6 (egfl6) antibodies and their applications in cancer diagnosis and treatment - Google Patents
Anti-egf like domain multiple 6 (egfl6) antibodies and their applications in cancer diagnosis and treatment Download PDFInfo
- Publication number
- US20200239560A1 US20200239560A1 US16/652,929 US201816652929A US2020239560A1 US 20200239560 A1 US20200239560 A1 US 20200239560A1 US 201816652929 A US201816652929 A US 201816652929A US 2020239560 A1 US2020239560 A1 US 2020239560A1
- Authority
- US
- United States
- Prior art keywords
- seq
- antibody
- egfl6
- cancer
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 104
- 201000011510 cancer Diseases 0.000 title claims abstract description 88
- 238000011282 treatment Methods 0.000 title abstract description 19
- 238000003745 diagnosis Methods 0.000 title abstract description 8
- 102100032029 Epidermal growth factor-like protein 6 Human genes 0.000 claims abstract description 53
- 230000027455 binding Effects 0.000 claims abstract description 32
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 19
- 230000033115 angiogenesis Effects 0.000 claims abstract description 17
- 230000010261 cell growth Effects 0.000 claims abstract description 7
- 101000921196 Homo sapiens Epidermal growth factor-like protein 6 Proteins 0.000 claims abstract 8
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 56
- 238000000034 method Methods 0.000 claims description 41
- 210000004027 cell Anatomy 0.000 claims description 34
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 31
- 239000012634 fragment Substances 0.000 claims description 28
- 239000000427 antigen Substances 0.000 claims description 27
- 108091007433 antigens Proteins 0.000 claims description 27
- 102000036639 antigens Human genes 0.000 claims description 27
- 125000000539 amino acid group Chemical group 0.000 claims description 23
- 206010027476 Metastases Diseases 0.000 claims description 21
- 230000009401 metastasis Effects 0.000 claims description 20
- 241000282414 Homo sapiens Species 0.000 claims description 18
- 239000000523 sample Substances 0.000 claims description 17
- 206010009944 Colon cancer Diseases 0.000 claims description 15
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 15
- 239000012472 biological sample Substances 0.000 claims description 14
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 12
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 239000012530 fluid Substances 0.000 claims description 10
- 239000002246 antineoplastic agent Substances 0.000 claims description 9
- 229940041181 antineoplastic drug Drugs 0.000 claims description 9
- 208000035475 disorder Diseases 0.000 claims description 9
- 238000012544 monitoring process Methods 0.000 claims description 8
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 238000004393 prognosis Methods 0.000 claims description 8
- 239000003814 drug Substances 0.000 claims description 7
- 210000002307 prostate Anatomy 0.000 claims description 6
- 238000012360 testing method Methods 0.000 claims description 6
- 210000001519 tissue Anatomy 0.000 claims description 6
- 210000001072 colon Anatomy 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 210000004072 lung Anatomy 0.000 claims description 5
- 210000002966 serum Anatomy 0.000 claims description 5
- -1 tissue biopsy Substances 0.000 claims description 5
- 208000005017 glioblastoma Diseases 0.000 claims description 4
- 210000003734 kidney Anatomy 0.000 claims description 4
- 210000000056 organ Anatomy 0.000 claims description 4
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 4
- 210000000664 rectum Anatomy 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical group C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- 206010018338 Glioma Diseases 0.000 claims description 3
- 208000007766 Kaposi sarcoma Diseases 0.000 claims description 3
- 210000004369 blood Anatomy 0.000 claims description 3
- 239000008280 blood Substances 0.000 claims description 3
- 210000000481 breast Anatomy 0.000 claims description 3
- 210000003679 cervix uteri Anatomy 0.000 claims description 3
- 210000004696 endometrium Anatomy 0.000 claims description 3
- 210000001672 ovary Anatomy 0.000 claims description 3
- 210000000496 pancreas Anatomy 0.000 claims description 3
- 210000002784 stomach Anatomy 0.000 claims description 3
- 210000003932 urinary bladder Anatomy 0.000 claims description 3
- 210000002700 urine Anatomy 0.000 claims description 3
- 206010061818 Disease progression Diseases 0.000 claims description 2
- 206010029260 Neuroblastoma Diseases 0.000 claims description 2
- 208000009956 adenocarcinoma Diseases 0.000 claims description 2
- 210000000577 adipose tissue Anatomy 0.000 claims description 2
- 210000004381 amniotic fluid Anatomy 0.000 claims description 2
- 210000003445 biliary tract Anatomy 0.000 claims description 2
- 238000001574 biopsy Methods 0.000 claims description 2
- 210000000988 bone and bone Anatomy 0.000 claims description 2
- 210000001185 bone marrow Anatomy 0.000 claims description 2
- 230000005750 disease progression Effects 0.000 claims description 2
- 230000009433 disease-worsening effect Effects 0.000 claims description 2
- 210000003238 esophagus Anatomy 0.000 claims description 2
- 208000030533 eye disease Diseases 0.000 claims description 2
- 208000027866 inflammatory disease Diseases 0.000 claims description 2
- 210000000867 larynx Anatomy 0.000 claims description 2
- 210000004185 liver Anatomy 0.000 claims description 2
- 230000001926 lymphatic effect Effects 0.000 claims description 2
- 210000004698 lymphocyte Anatomy 0.000 claims description 2
- 201000001441 melanoma Diseases 0.000 claims description 2
- 210000002381 plasma Anatomy 0.000 claims description 2
- 210000003296 saliva Anatomy 0.000 claims description 2
- 208000000649 small cell carcinoma Diseases 0.000 claims description 2
- 206010041823 squamous cell carcinoma Diseases 0.000 claims description 2
- 210000001550 testis Anatomy 0.000 claims description 2
- 210000001685 thyroid gland Anatomy 0.000 claims description 2
- 210000004291 uterus Anatomy 0.000 claims description 2
- 206010039491 Sarcoma Diseases 0.000 claims 1
- 201000008261 skin carcinoma Diseases 0.000 claims 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 abstract description 12
- 102000008394 Immunoglobulin Fragments Human genes 0.000 abstract description 12
- 238000001514 detection method Methods 0.000 abstract description 6
- 101710194643 Epidermal growth factor-like protein 6 Proteins 0.000 description 45
- 201000010099 disease Diseases 0.000 description 22
- 108090000623 proteins and genes Proteins 0.000 description 22
- 108090000765 processed proteins & peptides Proteins 0.000 description 12
- 241000287828 Gallus gallus Species 0.000 description 11
- 230000014509 gene expression Effects 0.000 description 11
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 11
- 229930012538 Paclitaxel Natural products 0.000 description 10
- 235000013330 chicken meat Nutrition 0.000 description 10
- 229960001592 paclitaxel Drugs 0.000 description 10
- 102000004196 processed proteins & peptides Human genes 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 9
- 239000000090 biomarker Substances 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 230000004614 tumor growth Effects 0.000 description 9
- 241000699660 Mus musculus Species 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 238000011580 nude mouse model Methods 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 238000003556 assay Methods 0.000 description 7
- 239000003550 marker Substances 0.000 description 7
- 235000018102 proteins Nutrition 0.000 description 7
- 239000003795 chemical substances by application Substances 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical group C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- 102000009024 Epidermal Growth Factor Human genes 0.000 description 5
- 101800003838 Epidermal growth factor Proteins 0.000 description 5
- 102000001554 Hemoglobins Human genes 0.000 description 5
- 108010054147 Hemoglobins Proteins 0.000 description 5
- 108010001160 IgY Proteins 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 229940116977 epidermal growth factor Drugs 0.000 description 5
- 239000003112 inhibitor Substances 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 108010082117 matrigel Proteins 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- 102000002322 Egg Proteins Human genes 0.000 description 4
- 108010000912 Egg Proteins Proteins 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 4
- 235000001014 amino acid Nutrition 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 210000004408 hybridoma Anatomy 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 4
- 206010061289 metastatic neoplasm Diseases 0.000 description 4
- 239000000693 micelle Substances 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 238000010647 peptide synthesis reaction Methods 0.000 description 4
- 238000002823 phage display Methods 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical group N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 3
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 3
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 3
- 230000002159 abnormal effect Effects 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 229940098773 bovine serum albumin Drugs 0.000 description 3
- 210000004556 brain Anatomy 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 208000029742 colonic neoplasm Diseases 0.000 description 3
- 230000000875 corresponding effect Effects 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000002405 diagnostic procedure Methods 0.000 description 3
- 235000013345 egg yolk Nutrition 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 3
- 229960000961 floxuridine Drugs 0.000 description 3
- 238000005755 formation reaction Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- 230000005012 migration Effects 0.000 description 3
- 238000013508 migration Methods 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 238000004091 panning Methods 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 238000010837 poor prognosis Methods 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 210000000952 spleen Anatomy 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 3
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 208000003174 Brain Neoplasms Diseases 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 230000004568 DNA-binding Effects 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 2
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 102000029749 Microtubule Human genes 0.000 description 2
- 108091022875 Microtubule Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- SXEHKFHPFVVDIR-UHFFFAOYSA-N [4-(4-hydrazinylphenyl)phenyl]hydrazine Chemical compound C1=CC(NN)=CC=C1C1=CC=C(NN)C=C1 SXEHKFHPFVVDIR-UHFFFAOYSA-N 0.000 description 2
- 210000001015 abdomen Anatomy 0.000 description 2
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000000340 anti-metabolite Effects 0.000 description 2
- 229940100197 antimetabolite Drugs 0.000 description 2
- 239000002256 antimetabolite Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 230000005907 cancer growth Effects 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- GYOZYWVXFNDGLU-XLPZGREQSA-N dTMP Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)C1 GYOZYWVXFNDGLU-XLPZGREQSA-N 0.000 description 2
- 229960000640 dactinomycin Drugs 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000003467 diminishing effect Effects 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 210000002969 egg yolk Anatomy 0.000 description 2
- 230000010595 endothelial cell migration Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 210000004688 microtubule Anatomy 0.000 description 2
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 230000001575 pathological effect Effects 0.000 description 2
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 229960003171 plicamycin Drugs 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000011301 standard therapy Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 210000005166 vasculature Anatomy 0.000 description 2
- MWWSFMDVAYGXBV-MYPASOLCSA-N (7r,9s)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.O([C@@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-MYPASOLCSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- WUIABRMSWOKTOF-OYALTWQYSA-N 3-[[2-[2-[2-[[(2s,3r)-2-[[(2s,3s,4r)-4-[[(2s,3r)-2-[[6-amino-2-[(1s)-3-amino-1-[[(2s)-2,3-diamino-3-oxopropyl]amino]-3-oxopropyl]-5-methylpyrimidine-4-carbonyl]amino]-3-[(2r,3s,4s,5s,6s)-3-[(2r,3s,4s,5r,6r)-4-carbamoyloxy-3,5-dihydroxy-6-(hydroxymethyl)ox Chemical compound OS([O-])(=O)=O.N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C WUIABRMSWOKTOF-OYALTWQYSA-N 0.000 description 1
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 1
- 101710169336 5'-deoxyadenosine deaminase Proteins 0.000 description 1
- QCVGEOXPDFCNHA-UHFFFAOYSA-N 5,5-dimethyl-2,4-dioxo-1,3-oxazolidine-3-carboxamide Chemical compound CC1(C)OC(=O)N(C(N)=O)C1=O QCVGEOXPDFCNHA-UHFFFAOYSA-N 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 102100033393 Anillin Human genes 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 101710192393 Attachment protein G3P Proteins 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- FVLVBPDQNARYJU-XAHDHGMMSA-N C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O Chemical compound C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O FVLVBPDQNARYJU-XAHDHGMMSA-N 0.000 description 1
- 102100024153 Cadherin-15 Human genes 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 101710169873 Capsid protein G8P Proteins 0.000 description 1
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 1
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 102100039551 Collagen triple helix repeat-containing protein 1 Human genes 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 102100032522 Cyclin-dependent kinases regulatory subunit 2 Human genes 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 102100038387 Cystatin-SN Human genes 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 102000003915 DNA Topoisomerases Human genes 0.000 description 1
- 108090000323 DNA Topoisomerases Proteins 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 102100020743 Dipeptidase 1 Human genes 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 206010051066 Gastrointestinal stromal tumour Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 108010053070 Glutathione Disulfide Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102100034221 Growth-regulated alpha protein Human genes 0.000 description 1
- 102100039381 Heparan-sulfate 6-O-sulfotransferase 2 Human genes 0.000 description 1
- 101100118545 Holotrichia diomphalia EGF-like gene Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 1
- 101000732632 Homo sapiens Anillin Proteins 0.000 description 1
- 101000762242 Homo sapiens Cadherin-15 Proteins 0.000 description 1
- 101000714553 Homo sapiens Cadherin-3 Proteins 0.000 description 1
- 101000910338 Homo sapiens Carbonic anhydrase 9 Proteins 0.000 description 1
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 description 1
- 101000746121 Homo sapiens Collagen triple helix repeat-containing protein 1 Proteins 0.000 description 1
- 101000942317 Homo sapiens Cyclin-dependent kinases regulatory subunit 2 Proteins 0.000 description 1
- 101000884768 Homo sapiens Cystatin-SN Proteins 0.000 description 1
- 101000932213 Homo sapiens Dipeptidase 1 Proteins 0.000 description 1
- 101001069921 Homo sapiens Growth-regulated alpha protein Proteins 0.000 description 1
- 101001035622 Homo sapiens Heparan-sulfate 6-O-sulfotransferase 2 Proteins 0.000 description 1
- 101001034844 Homo sapiens Interferon-induced transmembrane protein 1 Proteins 0.000 description 1
- 101001013150 Homo sapiens Interstitial collagenase Proteins 0.000 description 1
- 101000605522 Homo sapiens Kallikrein-1 Proteins 0.000 description 1
- 101001091385 Homo sapiens Kallikrein-6 Proteins 0.000 description 1
- 101000590482 Homo sapiens Kinetochore protein Nuf2 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001023833 Homo sapiens Neutrophil gelatinase-associated lipocalin Proteins 0.000 description 1
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 1
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102100040021 Interferon-induced transmembrane protein 1 Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 102100034866 Kallikrein-6 Human genes 0.000 description 1
- 102100032431 Kinetochore protein Nuf2 Human genes 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 101710125418 Major capsid protein Proteins 0.000 description 1
- 101710156564 Major tail protein Gp23 Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102100024299 Maternal embryonic leucine zipper kinase Human genes 0.000 description 1
- 101710154611 Maternal embryonic leucine zipper kinase Proteins 0.000 description 1
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 1
- 208000027007 Meningioma benign Diseases 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 102100035405 Neutrophil gelatinase-associated lipocalin Human genes 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 208000034038 Pathologic Neovascularization Diseases 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 230000006819 RNA synthesis Effects 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 102000000505 Ribonucleotide Reductases Human genes 0.000 description 1
- 108010041388 Ribonucleotide Reductases Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 101710168942 Sphingosine-1-phosphate phosphatase 1 Proteins 0.000 description 1
- 102100030684 Sphingosine-1-phosphate phosphatase 1 Human genes 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 101150117115 V gene Proteins 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- MBHRHUJRKGNOKX-UHFFFAOYSA-N [(4,6-diamino-1,3,5-triazin-2-yl)amino]methanol Chemical compound NC1=NC(N)=NC(NCO)=N1 MBHRHUJRKGNOKX-UHFFFAOYSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- VJHCJDRQFCCTHL-UHFFFAOYSA-N acetic acid 2,3,4,5,6-pentahydroxyhexanal Chemical compound CC(O)=O.OCC(O)C(O)C(O)C(O)C=O VJHCJDRQFCCTHL-UHFFFAOYSA-N 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 229960004150 aciclovir Drugs 0.000 description 1
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 229930013930 alkaloid Natural products 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- RGHILYZRVFRRNK-UHFFFAOYSA-N anthracene-1,2-dione Chemical class C1=CC=C2C=C(C(C(=O)C=C3)=O)C3=CC2=C1 RGHILYZRVFRRNK-UHFFFAOYSA-N 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000003432 anti-folate effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 229940127074 antifolate Drugs 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 229940045985 antineoplastic platinum compound Drugs 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 229940078010 arimidex Drugs 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 150000001508 asparagines Chemical class 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- XFILPEOLDIKJHX-QYZOEREBSA-N batimastat Chemical compound C([C@@H](C(=O)NC)NC(=O)[C@H](CC(C)C)[C@H](CSC=1SC=CC=1)C(=O)NO)C1=CC=CC=C1 XFILPEOLDIKJHX-QYZOEREBSA-N 0.000 description 1
- 229950001858 batimastat Drugs 0.000 description 1
- 201000009467 benign meningioma Diseases 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical class N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229950008138 carmellose Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 239000004359 castor oil Substances 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 210000000991 chicken egg Anatomy 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229940043378 cyclin-dependent kinase inhibitor Drugs 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Natural products NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000013681 dietary sucrose Nutrition 0.000 description 1
- CRVGKGJPQYZRPT-UHFFFAOYSA-N diethylamino acetate Chemical compound CCN(CC)OC(C)=O CRVGKGJPQYZRPT-UHFFFAOYSA-N 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 102000006795 dihydrofolate reductase activity proteins Human genes 0.000 description 1
- 108040000939 dihydrofolate reductase activity proteins Proteins 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 238000013399 early diagnosis Methods 0.000 description 1
- 210000000969 egg white Anatomy 0.000 description 1
- 235000014103 egg white Nutrition 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 208000021045 exocrine pancreatic carcinoma Diseases 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 201000006986 fibrous meningioma Diseases 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 150000005699 fluoropyrimidines Chemical class 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 206010017758 gastric cancer Diseases 0.000 description 1
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- YPZRWBKMTBYPTK-BJDJZHNGSA-N glutathione disulfide Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@H](C(=O)NCC(O)=O)CSSC[C@@H](C(=O)NCC(O)=O)NC(=O)CC[C@H](N)C(O)=O YPZRWBKMTBYPTK-BJDJZHNGSA-N 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 238000000227 grinding Methods 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 239000003276 histone deacetylase inhibitor Substances 0.000 description 1
- 102000054751 human RUNX1T1 Human genes 0.000 description 1
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 1
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 229940099279 idamycin Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 230000002055 immunohistochemical effect Effects 0.000 description 1
- 239000000367 immunologic factor Substances 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229910017053 inorganic salt Inorganic materials 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 208000037841 lung tumor Diseases 0.000 description 1
- 210000004324 lymphatic system Anatomy 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 231100000782 microtubule inhibitor Toxicity 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 229940090009 myleran Drugs 0.000 description 1
- 230000014399 negative regulation of angiogenesis Effects 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 210000002445 nipple Anatomy 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000003956 nonsteroidal anti androgen Substances 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 229940045681 other alkylating agent in atc Drugs 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- YPZRWBKMTBYPTK-UHFFFAOYSA-N oxidized gamma-L-glutamyl-L-cysteinylglycine Natural products OC(=O)C(N)CCC(=O)NC(C(=O)NCC(O)=O)CSSCC(C(=O)NCC(O)=O)NC(=O)CCC(N)C(O)=O YPZRWBKMTBYPTK-UHFFFAOYSA-N 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- 150000003058 platinum compounds Chemical class 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 229940117820 purinethol Drugs 0.000 description 1
- 239000003790 pyrimidine antagonist Substances 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 238000002702 ribosome display Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 229960003440 semustine Drugs 0.000 description 1
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 1
- 235000012239 silicon dioxide Nutrition 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 238000009987 spinning Methods 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 201000011549 stomach cancer Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229960004793 sucrose Drugs 0.000 description 1
- 229910021653 sulphate ion Inorganic materials 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 229940037128 systemic glucocorticoids Drugs 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000000439 tumor marker Substances 0.000 description 1
- 230000004222 uncontrolled growth Effects 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 229940099039 velcade Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00113—Growth factors
- A61K39/001131—Epidermal growth factor [EGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/005—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies constructed by phage libraries
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
Definitions
- the invention relates to the field of cancer detection (or diagnosis) and treatment.
- the invention relates to anti-EGF like domain multiple 6 antibody (anti-EGFL6 antibody) and cancer detection (or diagnosis) and treatment using the anti-EGFL6 antibody.
- Cancer is the uncontrolled growth of abnormal cells anywhere in a body.
- the abnormal cells are termed cancer cells, malignant cells, or tumor cells.
- Early diagnosis of a cancer often increases the likelihood of successful treatment or cure of such disease.
- EGFL6 is a member of the epidermal growth factor (EGF) repeat superfamily proteins and consists of an EGF-like repeat region and an integrin association motif (RGD). EGFL6 promotes endothelial cell migration and angiogenesis.
- GEF epidermal growth factor
- RGD integrin association motif
- tumor vascular markers may serve as potential biomarkers and molecular targets for ovarian cancer, wherein EGFL6 is one of the markers (Ronald J. Buckanovich et al., Journal of Clinical Oncology, 2007, Vol. 25, No. 7, pp. 852-861).
- EGFL6 mRNA was found in high levels in ovarian cancer, comparable to that in benign meningioma and when compared with fibroblastic meningioma, EGFL6 mRNA levels were significantly decreased in all other investigated tumors including glioma, lung cancer, hepatocellular carcinoma, pancreatic carcinoma, gastric cancer, breast cancer, prostate cancer, colorectal cancer and bladder cancer (Xuanchun Wang et al., PLOS ONE; 2012, Vol. 7, Issue 12, e52707).
- EGFL6 is overexpressioned in W1TR cell line and is a secreted protein that promotes endothelial cell migration and angiogenesis (Radoslaw Januchowski et al., Oncology Reports 32: 1981-1990, 2014). Another article reports that EGFL6 is a candidate tumor vasculature ligand in breast cancer (Benjimin M Larimer, J. Mol Biomark Diagn. 2014, 5(3): doi: 10.4172/2155-9929.1000178).
- WO2009057849 discloses a diagnostic composition for colon cancer, comprising an agent measuring mRNA or protein levels of one or more genes selected from KLK6, CKS2, IFITM1, SPP1, DPEP1, CST1, CDH3, ANLN, CXCL1, MELK, CDCA1, CTHRC1, CEACAM6, MMP1, LCN2, HS6ST2, EGFL6 and CA9.
- the present disclosure provides an isolated anti-EGFL6 antibody or an antigen-binding portion thereof, comprising at least one of a light chain CDR1 (L-CDR1) consisting of the amino acid residue of SEQ ID NO: 1 or 2, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 1 and 2; a light chain CDR2 (L-CDR2) consisting of the amino acid residue of SEQ ID NO: 3 or 4, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 3 and 4; and a light chain CDR3 (L-CDR3) consisting of the amino acid residue SEQ ID NO: 5 or 6, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 5 and 6; and
- H-CDR1 heavy chain complementarity determining region 1
- H-CDR2 heavy chain CDR2
- H-CDR3 heavy chain CDR3
- the antibody of the present disclosure include a monoclonal antibody, chimeric antibody, humanized antibody and human antibody.
- the isolated anti-EGFL6 antibody is a single chain Fv (scFv), IgG, Fab, (Fab) 2 , or (scFv′) 2 .
- One embodiment of the present disclosure includes a light chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 13 or 14.
- One embodiment of the present disclosure includes a heavy chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 15 or 16.
- the invention comprises an isolated antibody (EL6_S12), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 13 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15.
- the invention comprises an isolated antibody (EL6_E5), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 14 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 16.
- the present disclosure provides a pharmaceutical composition comprising the anti-EGFL6 antibody of the present disclosure and a pharmaceutically acceptable carrier or excipient.
- the present disclosure also provides a method for treating or preventing angiogenesis disorder in a subject, comprising administering an anti-EGFL6 antibody of the present disclosure to the subject.
- the present disclosure also provides a method for inhibiting cancer cell growth or cancer metastasis in a subject comprising administering an anti-EGFL6 antibody of the present disclosure to the subject.
- each of the above identified compositions and methods of treatment may additionally include an additional anti-tumor drug and the administration of an additional one or more anti-tumor drug.
- the present disclosure further provides a method for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer in a subject, comprising contacting a biological sample from a subject with an anti-EGFL6 antibody of the present disclosure, quantifying the binding of EGFL6 antigen in the sample to the antibody, and comparing said binding to a reference value representing binding between the anti-EGFL6 antibody and the EGFL6 antigen determined in samples from control subjects not afflicted with a cancer.
- the present disclosure further provides a method for monitoring the progression of a cancer in a subject already diagnosed with a cancer.
- the present disclosure further provides a kit for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer, or monitoring cancer progression in a subject, comprising an anti-EGFL6 antibody of the present disclosure.
- FIG. 1 shows the binding activity of anti-EGFL6 antibodies using ELISA.
- FIGS. 2A and 2B show full-length EGFL6 protein and EGFL6-F396 truncated fragment identified by E5 scFv (A) and S12 scFv (B) in the Western blotting.
- FIG. 3 shows a protein expression of EGFL6 in various cancer cell lines measured by Western Blot.
- FIGS. 4 (A) and (B) show that the single chain antibodies Ab4, Ab5 (E5) and Ab10 were effective in inhibiting the cancer cells migrations (A) and the anti-EGFL6 single chain antibodies can effectively inhibit the formations of tumor capsule compared with the control group treated with the Paclitaxel (B).
- FIG. 5 shows the hemoglobin contents in the matrix micelles of the nude mice treated with the anti-EGFL6 single chain antibodies E5 and S12.
- FIGS. 6 (A) and (B) shows that the humanized IgG antibodies S12 and/or E5 have the ability for inhibiting the tumor growth in colorectal cancer cell HCT-116 (A) and in non-small cell lung cancer A549 (B).
- FIGS. 7 (A) and (B) shows that the humanized IgG antibody E5 has the ability for inhibiting the tumor growth in triple negative breast cancer cell MDA-MB-231(A) and glioblastoma cancer cell U87 (B).
- FIG. 8 shows the anti-cancer activity of humanized IgG antibody E5 combined with paclitaxel in human non-small cell lung cancer A549 xenograft model.
- tumor As used herein, the terms “tumor,” “cancer” and “carcinoma” are used interchangeably and refer to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- the term “marker” or “biomarker” are used interchangeably herein, and in the context of the present invention refer to a gene which is differentially expressed in a sample taken from a subject having a cancer as compared to a comparable sample taken from a control subject (e.g., a person with a negative diagnosis, normal or healthy subject).
- biological sample refers to a sample obtained from a patient.
- Biological samples for example, can be obtained from blood, tissue (e.g. tumor), serum, stool, urine, sputum, cerebrospinal fluid, nipple aspirates and supernatant from cell lysate.
- diagnostic means identifying the presence or nature of a pathologic condition and includes identifying subjects who are at risk of developing a cancer. Diagnostic methods differ in their sensitivity and specificity.
- the “sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of “true positives”). Diseased individuals not detected by the assay are “false negatives.” Subjects who are not diseased and who test negative in the assay, are termed “true negatives.”
- the “specificity” of a diagnostic assay is to measure the proportion of negatives that are correctly identified as such (e.g., the percentage of the subjects who are not diseased and are correctly identified as not having the condition).
- detection As used herein, the terms “detection,” “detecting” and the like, may be used in the context of detecting biomarkers, or of detecting a cancer (e.g. when positive assay results are obtained). In the latter context, “detecting” and “diagnosing” are considered synonymous.
- test amount refers to an amount of a marker present in a sample being tested.
- a “control amount” of a marker can be any amount or a range of amount which is to be compared against a test amount of a marker.
- the term “at risk of” is intended to mean at increased risk of, compared to a normal subject, or compared to a control group.
- a subject “at risk of” developing a cancer is at increased risk compared to a normal population, and a subject “at risk of” a recurrence of a cancer may be considered at increased risk of having a recurrence as compared to the risk of a recurrence among all treated cancer patients.
- the term “increased risk” or “elevated risk” mean any statistically significant increase in the probability, e.g., that the subject will develop a cancer, or a recurrence thereof.
- prognosis refers to the prediction of the likelihood of cancer-attributable death or progression, including recurrence, metastatic spread, and drug resistance, of a neoplastic disease, such as ovarian cancer.
- poor prognosis means that the prospect of survival and recovery of disease is unlikely despite the standard of care for the treatment of the cancer (for example, prostate cancer), that is, surgery, radiation, chemotherapy. Poor prognosis is the category of patients whose survival is less than that of the median survival.
- metalastasis is defined as the spread of cancer from one part of the body to another.
- a tumor formed by cells that have spread is called a “metastatic tumor” or a “metastasis.”
- the term “risk of metastasis” refers to a prognostic indication that the cancer in a particular patient, particularly a human patient, will advance to a metastatic state based on statistical predictors. Actual advance to a metastatic state is not required, and adoption of treatment modalities to try to delay or prevent the realization of such risk is anticipated to occur.
- reference value refers to a laboratory value used as reference for the values/data obtained by means of samples obtained from a subject.
- determination of a level typically refer to calculation of an amount or concentration of a particular substance, or to quantifying an intensity of a signal from a probe that represents the amount or concentration of a particular substance.
- the term “antibody” is used in the broadest sense and specifically covers, for example, single monoclonal antibodies (including agonist, antagonist, and neutralizing antibodies), antibody compositions with polyepitopic specificity, polyclonal antibodies, single chain anti-antibodies, and fragments of antibodies (see below) as long as they specifically bind a native polypeptide and/or exhibit a biological activity or immunological activity of the present invention.
- the antibody binds to an oligomeric form of a target protein, e.g., a trimeric form.
- the phrase “functional fragment or analog” of an antibody is a compound having a qualitative biological activity in common with an antibody to which it is being referred.
- a functional fragment or analog of an antibody of this invention can be one which can specifically bind to EGFR.
- the antibody can prevent or substantially reduce the ability of an EGFR to induce cell proliferation.
- the term “isolated antibody” is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and can include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes.
- the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- percent (%) amino acid sequence identity and “homology” with respect to a peptide, polypeptide or antibody sequence refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEGALIGN (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms known in the art needed to achieve maximal alignment over the full length of the sequences being compared.
- Fab indicates an antigen binding fragment of an Ig (regardless of how prepared) including variable domain and first constant domain.
- the term “Fv” is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
- the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding.
- CDR complementarity determining region
- humanized antibody refers to a recombinant protein in which the CDRs from an antibody from one species; e.g., a murine or a chicken antibody, are transferred from the heavy and light variable chains of the antibody from the species into human heavy and light variable domains (framework regions).
- the constant domains of the antibody molecule are derived from those of a human antibody.
- specific residues of the framework region of the humanized antibody particularly those that are touching or close to the
- CDR sequences may be modified, for example replaced with the corresponding residues from the original murine, rodent, subhuman primate, or other antibody.
- the humanized antibody may be achieved by various methods including (a) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues, or (b) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues.
- Such methods as are useful in practicing the present invention include that disclosed in Padlan, Mol. Immunol., 31(3): 169-217 (1994).
- chimeric antibody refers to a recombinant protein that contains the variable domains of both the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody or a chicken antibody, more preferably a murine antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
- CDRs complementarity determining regions
- beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival.
- treatment is a reduction of pathological consequence of cancer (such as, for example, tumor volume).
- administer refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body (e.g., a formulation of the invention) into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery and/or any other method of physical delivery described herein or known in the art.
- a disease, or a symptom thereof is being treated, administration of the substance typically occurs after the onset of the disease or symptoms thereof.
- a disease, or symptoms thereof is being prevented, administration of the substance typically occurs before the onset of the disease or symptoms thereof.
- the terms “individual,” “subject,” “host,” and “patient,” refer to a mammal, including, but not limited to, murines (rats, mice), non-human primates, humans, canines, felines, ungulates (e.g., equines, bovines, ovines, porcines, caprines), etc.
- the term “therapeutically effective amount” or “efficacious amount” refers to the amount of a subject anti-EGFL6 antibody that, when administered to a mammal or other subject for treating a disease, is sufficient to effect such treatment for the disease.
- the present invention creates anti-EGFL6 antibodies, particularly, a single-chain antibody fragments (scFv) and humanized antibody, which have ability in binding to EGFL6 and in inhibiting angiogenesis and cancer cell growth.
- scFv single-chain antibody fragments
- the present invention provides an isolated anti-EGFL6 antibody or an antigen-binding portion thereof, comprising at least one of a light chain CDR1 (L-CDR1) consisting of the amino acid residue of SEQ ID NO: 1 or 2, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 1 and 2; a light chain CDR2 (L-CDR2) consisting of the amino acid residue of SEQ ID NO: 3 or 4, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 3 and 4; and a light chain CDR3 (L-CDR3) consisting of the amino acid residue SEQ ID NO: 5 or 6, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 5 and 6; and
- H-CDR1 heavy chain complementarity determining region 1
- H-CDR2 heavy chain CDR2
- H-CDR3 heavy chain CDR3
- sequence identity as mentioned above is at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
- amino acid sequences of the complementarity determining regions in light chains and heavy chains are listed below.
- H-CDR1 H-CDR2 H-CDR3 GFDFSSHG ISGSGSGT VRTRGSFNIVTIDT (SEQ ID NO: 7) (SEQ ID NO: 9) (SEQ ID NO: 11)
- GFTLSSYG IRSDGSNT AKSAYGTGYSSGRIDT (SEQ ID NO: 8) (SEQ ID NO: 10) (SEQ ID NO: 12)
- the isolated anti-EGFL6 antibody is a monoclonal antibody, chimeric antibody, humanized antibody or human antibody. In some embodiments, the isolated anti-EGFL6 antibody is a single chain antibody (such as Fv (scFv), IgG, Fab, (Fab) 2 , or (scFv′) 2 ).
- amino acids of the light chains and the heavy chains and of the antibodies of the invention are listed below.
- Embodiments of Amino Acid Sequences of Light chains LTQPSSVSANLGETVKITCSGG GNDKY YGWFQQKSPGSAPVTVIY ETR SR PSDIPSRFSGSKSGSTATLTITGVQAEDEAVYFC GGYDSSAGYAGM FGAG TTLTVL (SEQ ID NO: 13) (EL6_S12) LTQPSSVSANPGETVKITCSGG SGRYG WFQQKSPGTAPVTMIY DND KRPS GIPPRFSGSTSGSTGTLIITGVQVEDEAVYFC GSYDRSGGVGT FGAGTTL TVL (SEQ ID NO: 14) (EL6_E5)
- Embodiments of Amino Acid Sequences of Heavy Chains TVTLDESGGGLQTPGGAVSLVCKAS GFDFSSHG MGWVRQAPGKGLEWVAG ISGSGSGT GYAPAVKGRATISRDNGQSTLRLQLNDLRPEDTATYYCVRD V RTRGSFNIVTIDT WGHGTEVIVSSTSGQAGQ (SEQ ID NO: 15) (EL6_S12) TVTLDESGGGLHTPGGALSLVCKAS GFTLSSYG MFWVRQAPGKGLEFVAY IRSDGSNT YYGAAVKGRATISRDDGQSTVRLQLNNLRAEDTGIYFC AKSA YGTGYSSGRIDT WGHGTEVIVSSTSGQAGQ (SEQ ID NO: 16) (EL6_E5)
- the invention provides a light chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 13 or 14.
- the light chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 13 wherein the L-CDR1, L-CDR2 and L-CDR3 are replaced with SEQ ID NO: 2, SEQ ID NO: 4 and SEQ ID NO: 6, respectively.
- the light chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 14 wherein the L-CDR1, L-CDR2 and L-CDR3 are replaced with SEQ ID NO: 1, SEQ ID NO: 3 and SEQ ID NO: 5, respectively.
- the invention provides a heavy chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 15 or 16.
- the heavy chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 15 wherein the H-CDR1, H-CDR2 and H-CDR3 are replaced with SEQ ID NO: 8, SEQ ID NO: 10 and SEQ ID NO: 12, respectively.
- the heavy chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 16 wherein the H-CDR1, H-CDR2 and H-CDR3 are replaced with SEQ ID NO: 7, SEQ ID NO: 9 and SEQ ID NO: 11, respectively.
- the invention comprises an isolated antibody, comprising a light chain having an amino acid sequence as set forth in the sequence selected from the group consisting of SEQ ID NOs: 13 and 14, or a variant having at least 80% identity to any of SEQID NOs: 13 and 14, and (ii) a heavy chain having an amino acid sequence as set forth in the sequence selected from the group consisting of SEQ ID NOs: 15 and 16 or a variant having at least 80% identity to any of SEQ ID NOs: 15 to 16.
- the sequence identity as mentioned above is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
- the invention comprises an isolated antibody (EL6 S12), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 13 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15.
- the invention comprises an isolated antibody (EL6_E5), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 14 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 16.
- the invention comprises an isolated antibody, comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 13 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 16.
- the invention comprises an isolated antibody, comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 14 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15.
- monoclonal antibodies can be obtained by injecting mice or chicken with a composition comprising an antigen, removing the spleen to obtain B-lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones which produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
- variable light chain and variable heavy chain sequences for an antibody of interest may be obtained by a variety of molecular cloning procedures, such as RT-PCR, 5′-RACE, and cDNA library screening.
- the variable heavy or light chain sequence genes of an antibody from a cell that expresses a murine antibody can be cloned by PCR amplification and sequenced.
- the cloned VL and VH genes can be expressed in cell culture as a chimeric antibody as described by Orlandi et al., (Proc. Natl. Acad.
- a humanized antibody can then be designed and constructed as described by Leung et al. (Mol. Immunol., 32: 1413 (1995)).
- a chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody.
- Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject.
- Methods for constructing chimeric antibodies are well known in the art (e.g., Leung et al., 1994, Hybridoma 13: 469).
- a chimeric monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the corresponding variable domains of a human antibody.
- the mouse framework regions (FR) in the chimeric monoclonal antibody are also replaced with human FR sequences.
- one or more human FR residues may be replaced by the mouse counterpart residues.
- Humanized monoclonal antibodies may be used for therapeutic treatment of subjects.
- Phage display technology can be used to produce the anti-EGFL6 antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
- V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle. Because the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. Thus, the phage mimics some of the properties of the B-cell.
- Phage display can be performed in a variety of formats, reviewed in, e.g., Johnson, Kevin S. and Chiswell, David J., Curr. Opin Struct. Biol. 3: 564-571 (1993).
- V-gene segments can be used for phage display. Clackson et al., Nature 352: 624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice.
- ribosome display technology can be used to produce the anti-EGFL6 antibodies and antibody fragments in vitro.
- antibody fragments Traditionally, these fragments were derived via proteolytic digestion of intact antibodies. However, these fragments can now be produced directly by recombinant host-cells, for example, using nucleic acids encoding anti-EGFL6 antibodies of the present disclosure. Fab, Fv and scFv antibody fragments can all be expressed in and secreted from E. coli , thus allowing the straightforward production of large amounts of these fragments. Anti-EGFL6 antibody fragments can also be isolated from the antibody phage libraries as discussed above. Alternatively, Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′) 2 fragments.
- F(ab′) 2 fragments can be isolated directly from recombinant host-cell culture. Production of Fab and F(ab′) 2 antibody fragments with increased in vivo half-lives are described in U.S. Pat. No. 5,869,046.
- the antibody of choice is a single chain Fv fragment (scFv).
- Modifications can be made to a nucleic acid encoding a polypeptide described herein without diminishing its biological activity. Some modifications can be made to facilitate the cloning, expression, or incorporation of the targeting molecule into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, termination codons, a methionine added at the amino terminus to provide an initiation, site, additional amino acids placed on either terminus to create conveniently located restriction sites, or additional amino acids (such as poly His) to aid in purification steps.
- the antibodies of the present disclosure can also be constructed in whole or in part using standard peptide synthesis well known in the art.
- the heavy and light chain regions are separately solubilized and reduced and then combined in the refolding solution.
- An exemplary yield is obtained when these two proteins are mixed in a molar ratio such that a 5 fold molar excess of one protein over the other is not exceeded.
- Excess oxidized glutathione or other oxidizing low molecular weight compounds can be added to the refolding solution after the redox-shuffling is completed.
- the antibodies and variants thereof that are disclosed herein can also be constructed in whole or in part using standard peptide synthesis.
- Solid phase synthesis of the polypeptides can be accomplished by attaching the C-terminal amino acid of the sequence to an insoluble support followed by sequential addition of the remaining amino acids in the sequence. Techniques for solid phase synthesis are described by Barany & Merrifield, The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A. pp. 3-284; Merrifield et al., J. Am. Chem. Soc. 85: 2149-2156, 1963, and Stewart et al., Solid Phase Peptide Synthesis, 2nd ed., Pierce Chem. Co., Rockford, Ill., 1984. Proteins of greater length may be synthesized by condensation of the amino and carboxyl termini of shorter fragments.
- compositions comprising Anti-EDFL6 Antibody and Treatment or Prevention Applications of the Anti-EDFL6 Antibody
- compositions comprising the anti-EGFL6 antibody of the invention and a pharmaceutically acceptable carrier or excipient.
- pharmaceutically acceptable carrier is intended to include, but not limited to, a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type known to persons skilled in the art. Diluents, such as polyols, polyethylene glycol and dextrans, may be used to increase the biological half-life of the conjugate.
- compositions of the present invention can be formulated according to conventional methods (for example, Remington's Pharmaceutical Science, latest edition, Mark Publishing Company, Easton, U.S.A.), and may also contain pharmaceutically acceptable carriers and additives.
- pharmaceutically acceptable carriers and additives include, but are not limited to, surfactants, excipients, coloring agents, flavoring agents, preservatives, stabilizers, buffers, suspension agents, isotonic agents, binders, disintegrants, lubricants, fluidity promoting agents, and corrigents, and other commonly used carriers can be suitably used.
- the carriers include light anhydrous silicic acid, lactose, crystalline cellulose, mannitol, starch, carmellose calcium, carmellose sodium, hydroxypropyl cellulose, hydroxypropyl methylcellulose, polyvinylacetal diethylaminoacetate, polyvinylpyrrolidone, gelatin, medium-chain triglyceride, polyoxyethylene hardened castor oil 60, saccharose, carboxymethyl cellulose, corn starch, inorganic salt, and such.
- An embodiment is directed to a method for treating or preventing angiogenesis disorder in a subject, comprising administering an anti-EGFL6 antibody of the present disclosure to the subject.
- an embodiment is directed to a use of an anti-EGFL6 antibody of the present disclosure in the manufacture of a medicament for treating or preventing angiogenesis disorder in a subject.
- a disorder characterized by pathological angiogenesis refers to a disorder where abnormal or aberrant angiogenesis, alone or in combination with others, contributes to causation, origination, or symptom of the disorder. Examples of this disorder include various cancers (e.g., vascularized tumors), eye disorders, inflammatory disorders, and others.
- a further embodiment is directed to a method for inhibiting cancer cell growth or cancer metastasis in a subject comprising administering an anti-EGFL6 antibody of the present disclosure to the subject.
- a further embodiment is directed to a use of an anti-EGFL6 antibody of the present disclosure in the manufacture of a medicament for inhibiting cancer cell growth or cancer metastasis in a subject. Because angiogenesis is involved in both primary cancer growth and metastasis, the antiangiogenic treatment provided by the present disclosure is capable of inhibiting the cancer cell growth at the primary site as well as preventing metastasis of tumors at the secondary sites.
- Exemplary solid tumors include, but are not limited to, carcinomas of the skin, kidney, prostate, adipose tissue, lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate, thyroid, squamous cell carcinomas, adenocarcinomas, small cell carcinomas, melanomas, gliomas, glioblastomas, neuroblastomas, Kaposi's sarcoma, and sarcomas (such as gastrointestinal stromal tumor).
- the cancer is colorectal cancer, colon cancer or rectal cancer.
- the present method also comprises administering the anti-EGFL6 antibody of the present disclosure concomitantly with, or subsequent to other standard therapies, wherein said standard therapy is selected from the group consisting of radiotherapy, surgery and chemotherapy.
- the subject is a mammal.
- exemplary mammals include human, pig, sheep, goat, horse, mouse, dog, cat, cow, etc.
- Diseases that may be treated with the anti-EGFL6 antibody or a pharmaceutical composition thereof include cancer, such as cancer of the liver, skin, head and neck, lung, breast, prostate, ovaries, endometrium, cervix, colon, rectum, colon and rectum, bladder, brain, stomach, pancreas or lymphatic system.
- the cancer is colorectal cancer.
- the anti-EGFL6 antibody or the pharmaceutical composition thereof may be administered intravenously, intra-peritoneally, intra-arterially, intra-thecally, intra-vesically, or intratumorally.
- effective amounts of the anti-EGFL6 antibody can be determined empirically. It will be understood that, when administered to a human patient, the total daily usage of the anti- EGFL6 antibody or composition will be decided by the attending physician within the scope of sound medical judgment.
- the specific therapeutically effective dose level for any particular patient will depend upon a variety of factors: the type and degree of the cellular response to be achieved; activity of the specific anti-EGFL6 antibody or composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the anti-EGFL6 antibody; the duration of the treatment; drugs used in combination or coincidental with the anti-EGFL6 antibody; and like factors well known in the medical arts.
- compositions and methods of treatment may additionally include an additional anti-tumor drug and the administration of an additional one or more anti-tumor drug.
- Anti-tumor drugs suitable for use with the present disclosure include, but are not limited to, agents that induce apoptosis, agents that inhibit adenosine deaminase function, inhibit pyrimidine biosynthesis, inhibit purine ring biosynthesis, inhibit nucleotide interconversions, inhibit ribonucleotide reductase, inhibit thymidine monophosphate (TMP) synthesis, inhibit dihydrofolate reduction, inhibit DNA synthesis, form adducts with DNA, damage DNA, inhibit DNA repair, intercalate with DNA, deaminate asparagines, inhibit RNA synthesis, inhibit protein synthesis or stability, inhibit microtubule synthesis or function, and the like.
- alkaloids including microtubule inhibitors (e.g., vincristine, vinblastine, and vindesine, etc.), microtubule stabilizers (e.g., paclitaxel (TAXOL), and docetaxel, etc.), and chromatin function inhibitors, including topoisomerase inhibitors, such as epipodophyllotoxins (e.g., etoposide (VP-16), and teniposide (VM-26), etc.), and agents that target topoisomerase I (e.g., camptothecin and isirinotecan (CPT-11), etc.); 2) covalent DNA-binding agents (alkylating agents), including nitrogen mustards (e.g., mechlorethamine, chlorambucil, cyclophosphamide, ifosphamide, and busulfan (MYLERAN), etc.), nitrosoureas (e.g.,
- the present disclosure also shows that there is a connection between EGFL6 levels and cancer severity; accordingly, the expression of EGFL6 or a fragment thereof in high level in the biological sample as compared to a reference level of the expression of EGFL6 or a fragment thereof in the control sample is indicative of prediction of a metastasis or poor prognosis.
- the anti-EGFL6 antibody of the present disclosure can be used as an indicator of a diagnosis or predication of a prognosis or an elevated risk of metastasis or future occurrence of a cancer in a subject.
- the present disclosure provides a method for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer in a subject, comprising contacting a biological sample from a subject with an anti-EGFL6 antibody of the present disclosure, quantifying the binding of EGFL6 antigen in the sample to the antibody, and comparing said binding to a reference value representing binding between the anti-EGFL6 antibody and the EGFL6 antigen determined in samples from control subjects not afflicted with a cancer.
- the biological sample may be a cell, tissue, organ, organ sample, tissue biopsy, blood, plasma, serum, ascetic fluid, lymphocytes, urine, bone marrow fluid, lymphatic fluid, saliva, lachrymal fluid, mucosal fluid, amniotic fluid, or a combination thereof.
- Detectable labels suitable for conjugation to antibodies and other binding reagents include radioisotopes, fluorescent labels, enzyme-substrate labels, chromogenic labels, chemiluminescent labels and colloidal gold particles.
- Examples of the measurement method include, but are not limited to, a fluorescence immunoassay (FIA) method, an enzyme immunoassay (EIA) method, a radioimmunoassay (MA) method, a Western blotting method, dot blot, an immunohistochemical assay, Fluorescence Activated Cell Sorter (FACS), in vivo imaging and a radio-imaging assay.
- FIA fluorescence immunoassay
- EIA enzyme immunoassay
- MA radioimmunoassay
- FACS Fluorescence Activated Cell Sorter
- the present disclosure further provides a method for monitoring the progression of a cancer in a subject already diagnosed with a cancer.
- monitoring can be used to evaluate whether a particular treatment is successful.
- monitoring cancer progression comprises determining a first level of EGFL6 or a fragment thereof in a first biological sample obtained from a subject diagnosed with a cancer by the anti-EGFL6 antibody of the present disclosure; and determining a second level of EGFL6 or the fragment thereof in a second biological sample obtained from the subject by the anti-EGFL6 antibody of the present disclosure after a predetermined period of time; comparing the first and second levels of EGFL6 or the fragment thereof; wherein a higher level of EGFL6 or the fragment thereof in the second sample compared to the first sample is indicative of disease progression and worsening. Similarly, a lower level of EGFL6 or the fragment thereof in the second sample compared to the first sample is indicative of improvement.
- the diagnostic methods of the present disclosure may be combined with the known diagnostic methods for a cancer.
- kits for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer, or monitoring cancer progression in a subject It is typically in a package which contains all elements, optionally including instructions. The package may be divided so that components are not mixed until desired. Individual components may be separately packaged within the kit.
- the kit may contain reagents necessary to detect the expression level of a marker gene.
- a kit is any manufacture (e.g., a package or container) comprising at least one reagent, e.g., an antibody reagent(s), for specifically detecting and/or measuring the expression level of a marker gene in a sample.
- kits having different components are contemplated by the current disclosure.
- the kit will include the means for quantifying EGFL6 or more biomarkers in a subject.
- the kit will include means for collecting a biological sample, means for quantifying EGFL6 or more biomarkers in the biological sample, and instructions for use of the kit contents.
- the kit comprises a means for quantifying the amount of a biomarker.
- the means for quantifying the amount of a biomarker comprises reagents necessary to detect the amount of a biomarker.
- the antibody libraries will be established based on the previous report (Andris-Widhopf, J., Rader, C., Steinberger, P., Fuller, R., and Barbas, C. F., 3rd (2000). Methods for the generation of chicken monoclonal antibody fragments by phage display. J Immunol Methods 242, 159-181. Barbas, C. F., 3rd, Kang, A. S., Lerner, R. A., and Benkovic, S. J. (1991). Assembly of combinatorial antibody libraries on phage surfaces: the gene III site. Proc Natl Acad Sci U S A 88, 7978-7982). Briefly, chicken spleens were harvested and placed immediately in Trizol.
- RNAs Ten ug of total RNAs will be reversely transcribed into the first-strand cDNA.
- PCR products of heavy and light chain variable (VH and VL) regions with short or long linkers will be subjected to a second round of PCR, digested with SfiI and cloned into the pComb3X vector.
- Recombinant DNAs were transformed into E. coli ER2738 strain by electroporation.
- Recombinant phage was produced by the addition of VCS-M13 helper phage, precipitated with 4% polyethylglycol 8000 and 3% NaCl (w/v), re-suspended in phosphate-buffered saline (PBS) containing 1% bovine serum albumin (BSA). Then, 10 11 plaque-forming units (pfu) of recombinant phages were added to wells pre-coated with EGFL6 protein (0.5 ug/well), and incubated at 37° C. for 2 h.
- PBS phosphate-buffered saline
- BSA bovine serum albumin
- Bound phages were eluted with 0.1 M HCl/glycine (pH 2.2)/0.1% BSA, neutralized with 2 M Tris base buffer and used to infect the ER2738 strain. The amplified phages were recovered as described above for the next round of selection. The panning procedure was repeated six times. The total DNAs were purified and transformed into TOP 10F′ E. coli strain. Twenty clones were randomly selected and grown from the final panning process. Bacterial cells were lysed and analyzed for scFv antibody expression and binding reactivity to EGFL6. ScFv antibodies were purified using Ni 2+ -charged sepharose as described by the manufacturer (Amersham Biosciences, UK). FIG.
- FIG. 1 shows the binding activity of anti-EGFL6 antibodies using ELISA.
- the total cell lysates of 14 clones randomly selected from each ELISA-positive phage library after the 6 th round of bio-panning were used to examine their anti-EGFL6 activity. It was found that most scFv antibodies can specifically bind to the EGFL6 protein (see FIG. 1 ).
- FIG. 2 shows recombinant full-length EGFL6 protein (Lane EGFL6), and N-terminus truncated fragment (Lane EGFL6-F37) and the C-terminus truncated fragment (Lane EGFL6-F396) were used to SDS-PAGE analysis under reducing condition.
- FIGS. 2A and 2B show full-length EGFL6 protein and EGFL6-F396 truncated fragment identified by E5 scFv ( FIG. 2A ) and S12 scFv ( FIG. 2B ) in the Western blotting.
- epidermal growth factor like protein 6 (EGFL6) were evaluated in the serum of cancer patients.
- EGFL6 As shown in FIG. 3 , a protein expression of EGFL6 in lung, colon, ovarian, prostate, brain, uterine and breast cancer cell lines was measured by Western Blot. EGFL6 is not expressed in normal cell lines. These results suggest that EGFL6 could be found in patients with cancer and EGFL6 could serve as a cancer marker.
- a cell penetration migration analysis was performed to evaluate the single chain antibodies for ability to inhibit cell migrations of the colorectal cancer cell lines HCT116. As shown in FIG. 4 (A), the anti-EGFL6 single chain antibodies were added to the colorectal cancer cell lines HCT116 and inhibit the growth of cancer cells under cell culture conditions. The results illustrated that the antibodies Ab4, Ab5 (E5) and Ab10 were effective in inhibiting the cancer cells migrations.
- the ability for inhibiting the metastasis of the colorectal cancer cells CT26 to lung was observed after the mice were administered with the anti-EGFL6 single chain antibodies (S12 and E5) and small molecule drug Paclitaxel.
- the anti-EGFL6 single chain antibodies S12 and E5 were administered with a dose of 15 mg/kg once every three days while the Paclitaxel was administered with a dose of 20 mg/kg once every four days.
- the groups treated with two of the anti-EGFL6 single chain antibodies at a dose of 15 mg/kg once every three days can effectively inhibit the formations of tumor capsule compared with the control group treated with the Paclitaxel at a dose of 20 mg/kg once every four days.
- the five-week old nude mice were subcutaneously injected with 500 ⁇ l of matrigel mixed with EGF to induce angiogenesis.
- the nude mice were divided into four groups: (1) matrigel alone as the negative control group (Basal); (2) matrigel mixed with EGF (150 ng/mL) as the positive control group (Control); (3) the groups treated with the single chain antibody E5 at a dose of 15 mg/kg under EGF-induced condition and (4) the groups treated with the single chain antibody S12 at a dose of 15 mg/kg under EGF-induced condition.
- Each group had 3 nude mice and the single chain antibodies E5 and S12 were administered three times a week by the tail vein injection for one week.
- the nude mice were sacrificed on the eighth day.
- the matrix micelles in mice abdomen were removed and homogenized by the grinding rod, followed by measuring the hemoglobin contents.
- the angiogenesis was not shown in the negative control group (Basal) injected with the matrigel alone. Comparing the negative control group (Basal), the angiogenesis was shown in the positive control group (Control) injected with the matrigel mixed with EGF after 24 hours. As shown in FIG. 5 , it was apparent that the groups treated with both of the anti-EGFL6 single chain antibodies E5 and S12 showed the effects of inhibiting angiogenesis. In addition, the nude mice were sacrificed and the matrix micelles in mice abdomen were removed and the hemoglobin contents were measured. FIG.
- variable regions of chicken scFv antibodies will be performed with the assistance of a molecular model generated by the algorithms applied in previous studies (Tsurushita et al., 2004; Zilber et al., 1990).
- the human V region framework used as an acceptor for the CDRs of the anti-EGFL6 scFv antibodies will be chosen based on sequence homology. Amino acid residues in the humanized V regions predicted from the three-dimensional model to be important for proper formation of the CDR structure will be substituted with the corresponding residues of chicken anti-EGFL6 scFv antibodies.
- Other methods will be combined and used to further fine-tune the structure of humanized anti-EGFL6 antibodies (Ewert et al., 2003; Sidhu et al., 2004).
- mice Two of the anti-EGFL6 humanized IgG antibodies (S12 and E5) were evaluated ability to inhibit the growth of the colorectal cancer cells HCT116, non-small cell lung cancer A549, triple negative breast cancer cell MDA-MB-231 and gilblastoma cancer cell U87 in xenograft mice.
- the mice were administered with indicated dose and intravenous injection twice a week.
- the initial tumor size was about 200 mm 3 .
- the ratio of tumor growth inhibition (% TGI) was calculated compared with the control group.
- both of the groups with the humanized IgG antibodies S12 and E5 have the ability for inhibiting the tumor growth (colorectal cancer cell HCT-116).
- the % TGI of the group with S12 antibody is 7.5% while the group with E5 antibody is 36.2%.
- the humanized IgG antibody E5 has the ability for inhibiting the tumor growth in non-small cell lung cancer A549.
- the %TGI of the group with E5 antibody (10 mg/kg) is 14.3% while the group with E5 antibody (20 mg/kg) is 80.8%.
- the groups with the humanized IgG antibody E5 have the ability for inhibiting the tumor growth (triple negative breast cancer cell MDA-MB-231).
- the % TGI of the group with E5 antibody (20 mg/kg) is 65.1% while the group with E5 antibody (40 mg/kg) is 65.4%.
- the groups with the single chain antibody E5 have the ability for inhibiting the tumor growth (glioblastoma cancer cell).
- the % TGI of the group with E5 antibody (20 mg/kg) is 36.5%.
Abstract
Description
- The invention relates to the field of cancer detection (or diagnosis) and treatment. Particularly, the invention relates to anti-EGF like domain multiple 6 antibody (anti-EGFL6 antibody) and cancer detection (or diagnosis) and treatment using the anti-EGFL6 antibody.
- Cancer is the uncontrolled growth of abnormal cells anywhere in a body. The abnormal cells are termed cancer cells, malignant cells, or tumor cells. Early diagnosis of a cancer often increases the likelihood of successful treatment or cure of such disease.
- A biomarker is a potential tool in the detection of a cancer. EGFL6 is a member of the epidermal growth factor (EGF) repeat superfamily proteins and consists of an EGF-like repeat region and an integrin association motif (RGD). EGFL6 promotes endothelial cell migration and angiogenesis. George Yeung et al. report that EGFL6 encodes a predicted signal peptide, suggesting that it is secreted, and that its transcripts are expressed in brain and lung tumor and fetal tissues (George Yeung et al., Genomics 62, 1999, pp. 304-307). A study is conducted to identify the molecule profile of ovarian tumor vasculature showed that tumor vascular markers may serve as potential biomarkers and molecular targets for ovarian cancer, wherein EGFL6 is one of the markers (Ronald J. Buckanovich et al., Journal of Clinical Oncology, 2007, Vol. 25, No. 7, pp. 852-861). However, an article reports that EGFL6 mRNA was found in high levels in ovarian cancer, comparable to that in benign meningioma and when compared with fibroblastic meningioma, EGFL6 mRNA levels were significantly decreased in all other investigated tumors including glioma, lung cancer, hepatocellular carcinoma, pancreatic carcinoma, gastric cancer, breast cancer, prostate cancer, colorectal cancer and bladder cancer (Xuanchun Wang et al., PLOS ONE; 2012, Vol. 7,
Issue 12, e52707). - It is also reported that EGFL6 is overexpressioned in W1TR cell line and is a secreted protein that promotes endothelial cell migration and angiogenesis (Radoslaw Januchowski et al., Oncology Reports 32: 1981-1990, 2014). Another article reports that EGFL6 is a candidate tumor vasculature ligand in breast cancer (Benjimin M Larimer, J. Mol Biomark Diagn. 2014, 5(3): doi: 10.4172/2155-9929.1000178). WO2009057849 discloses a diagnostic composition for colon cancer, comprising an agent measuring mRNA or protein levels of one or more genes selected from KLK6, CKS2, IFITM1, SPP1, DPEP1, CST1, CDH3, ANLN, CXCL1, MELK, CDCA1, CTHRC1, CEACAM6, MMP1, LCN2, HS6ST2, EGFL6 and CA9.
- However, no EGFL6 alone is actually applied in clinical cancer diagnosis. Moreover, there is also a need to develop an anti-EGFL6 antibody for cancer treatment.
- The present disclosure provides an isolated anti-EGFL6 antibody or an antigen-binding portion thereof, comprising at least one of a light chain CDR1 (L-CDR1) consisting of the amino acid residue of SEQ ID NO: 1 or 2, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 1 and 2; a light chain CDR2 (L-CDR2) consisting of the amino acid residue of SEQ ID NO: 3 or 4, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 3 and 4; and a light chain CDR3 (L-CDR3) consisting of the amino acid residue SEQ ID NO: 5 or 6, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 5 and 6; and
- at least one of a heavy chain complementarity determining region 1 (H-CDR1) consisting of the amino acid residue of SEQ ID NO: 7 or 8 , or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 7 and 8; a heavy chain CDR2 (H-CDR2) consisting of the amino acid residue of SEQ ID NO: 9 or 10, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 9 and 10; and a heavy chain CDR3 (H-CDR3) consisting of the amino acid residue of SEQ ID NO: 11 or 12, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 11 and 12; such that said isolated antibody or antigen-binding portion thereof binds to EGFL6.
- Certain embodiments of the antibody of the present disclosure include a monoclonal antibody, chimeric antibody, humanized antibody and human antibody. In some embodiments, the isolated anti-EGFL6 antibody is a single chain Fv (scFv), IgG, Fab, (Fab)2, or (scFv′)2.
- One embodiment of the present disclosure includes a light chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 13 or 14.
- One embodiment of the present disclosure includes a heavy chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 15 or 16.
- In a further embodiment, the invention comprises an isolated antibody (EL6_S12), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 13 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15. In a further embodiment, the invention comprises an isolated antibody (EL6_E5), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 14 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 16.
- The present disclosure provides a pharmaceutical composition comprising the anti-EGFL6 antibody of the present disclosure and a pharmaceutically acceptable carrier or excipient.
- The present disclosure also provides a method for treating or preventing angiogenesis disorder in a subject, comprising administering an anti-EGFL6 antibody of the present disclosure to the subject.
- The present disclosure also provides a method for inhibiting cancer cell growth or cancer metastasis in a subject comprising administering an anti-EGFL6 antibody of the present disclosure to the subject.
- In some embodiments, each of the above identified compositions and methods of treatment may additionally include an additional anti-tumor drug and the administration of an additional one or more anti-tumor drug.
- The present disclosure further provides a method for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer in a subject, comprising contacting a biological sample from a subject with an anti-EGFL6 antibody of the present disclosure, quantifying the binding of EGFL6 antigen in the sample to the antibody, and comparing said binding to a reference value representing binding between the anti-EGFL6 antibody and the EGFL6 antigen determined in samples from control subjects not afflicted with a cancer.
- The present disclosure further provides a method for monitoring the progression of a cancer in a subject already diagnosed with a cancer.
- The present disclosure further provides a kit for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer, or monitoring cancer progression in a subject, comprising an anti-EGFL6 antibody of the present disclosure.
-
FIG. 1 shows the binding activity of anti-EGFL6 antibodies using ELISA. -
FIGS. 2A and 2B show full-length EGFL6 protein and EGFL6-F396 truncated fragment identified by E5 scFv (A) and S12 scFv (B) in the Western blotting. -
FIG. 3 shows a protein expression of EGFL6 in various cancer cell lines measured by Western Blot. -
FIGS. 4 (A) and (B) show that the single chain antibodies Ab4, Ab5 (E5) and Ab10 were effective in inhibiting the cancer cells migrations (A) and the anti-EGFL6 single chain antibodies can effectively inhibit the formations of tumor capsule compared with the control group treated with the Paclitaxel (B). -
FIG. 5 shows the hemoglobin contents in the matrix micelles of the nude mice treated with the anti-EGFL6 single chain antibodies E5 and S12. -
FIGS. 6 (A) and (B) shows that the humanized IgG antibodies S12 and/or E5 have the ability for inhibiting the tumor growth in colorectal cancer cell HCT-116 (A) and in non-small cell lung cancer A549 (B). -
FIGS. 7 (A) and (B) shows that the humanized IgG antibody E5 has the ability for inhibiting the tumor growth in triple negative breast cancer cell MDA-MB-231(A) and glioblastoma cancer cell U87 (B). -
FIG. 8 shows the anti-cancer activity of humanized IgG antibody E5 combined with paclitaxel in human non-small cell lung cancer A549 xenograft model. - The terminology herein is used to describe specific embodiments of the invention, but their usage does not delimit the invention, except as outlined in the claims. It is to be understood that both the foregoing general description and the following detailed description are examples and explanatory only and are not restrictive of the subject matter claimed in this application.
- Terms such as “a”, “an” and “the” are not intended to refer to only a singular entity, but include the general class of which a specific example may be used for illustration.
- In this application, the use of “or” means “and/or” unless stated otherwise. Furthermore, use of the term “including” as well as other forms, such as “includes,” and “included” is not limiting.
- As used herein, the terms “tumor,” “cancer” and “carcinoma” are used interchangeably and refer to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
- As used herein, the term “marker” or “biomarker” are used interchangeably herein, and in the context of the present invention refer to a gene which is differentially expressed in a sample taken from a subject having a cancer as compared to a comparable sample taken from a control subject (e.g., a person with a negative diagnosis, normal or healthy subject).
- As used herein, the term “biological sample” refers to a sample obtained from a patient. Biological samples, for example, can be obtained from blood, tissue (e.g. tumor), serum, stool, urine, sputum, cerebrospinal fluid, nipple aspirates and supernatant from cell lysate.
- As used herein, the term “diagnostic” means identifying the presence or nature of a pathologic condition and includes identifying subjects who are at risk of developing a cancer. Diagnostic methods differ in their sensitivity and specificity. The “sensitivity” of a diagnostic assay is the percentage of diseased individuals who test positive (percent of “true positives”). Diseased individuals not detected by the assay are “false negatives.” Subjects who are not diseased and who test negative in the assay, are termed “true negatives.” The “specificity” of a diagnostic assay is to measure the proportion of negatives that are correctly identified as such (e.g., the percentage of the subjects who are not diseased and are correctly identified as not having the condition).
- As used herein, the terms “detection,” “detecting” and the like, may be used in the context of detecting biomarkers, or of detecting a cancer (e.g. when positive assay results are obtained). In the latter context, “detecting” and “diagnosing” are considered synonymous.
- A “test amount” of a marker refers to an amount of a marker present in a sample being tested.
- A “control amount” of a marker can be any amount or a range of amount which is to be compared against a test amount of a marker.
- The term “at risk of” is intended to mean at increased risk of, compared to a normal subject, or compared to a control group. Thus, a subject “at risk of” developing a cancer is at increased risk compared to a normal population, and a subject “at risk of” a recurrence of a cancer may be considered at increased risk of having a recurrence as compared to the risk of a recurrence among all treated cancer patients.
- As used herein, the term “increased risk” or “elevated risk” mean any statistically significant increase in the probability, e.g., that the subject will develop a cancer, or a recurrence thereof.
- As used herein, the term “prognosis” refers to the prediction of the likelihood of cancer-attributable death or progression, including recurrence, metastatic spread, and drug resistance, of a neoplastic disease, such as ovarian cancer. The term “poor prognosis” means that the prospect of survival and recovery of disease is unlikely despite the standard of care for the treatment of the cancer (for example, prostate cancer), that is, surgery, radiation, chemotherapy. Poor prognosis is the category of patients whose survival is less than that of the median survival.
- As used herein, the term “metastasis” is defined as the spread of cancer from one part of the body to another. A tumor formed by cells that have spread is called a “metastatic tumor” or a “metastasis.”
- As used herein, the term “risk of metastasis” refers to a prognostic indication that the cancer in a particular patient, particularly a human patient, will advance to a metastatic state based on statistical predictors. Actual advance to a metastatic state is not required, and adoption of treatment modalities to try to delay or prevent the realization of such risk is anticipated to occur.
- As used herein, the expression “reference value” refers to a laboratory value used as reference for the values/data obtained by means of samples obtained from a subject.
- As used herein, “determination of a level”, “determining a level” or “measuring a level” typically refer to calculation of an amount or concentration of a particular substance, or to quantifying an intensity of a signal from a probe that represents the amount or concentration of a particular substance.
- As used herein, the term “antibody” is used in the broadest sense and specifically covers, for example, single monoclonal antibodies (including agonist, antagonist, and neutralizing antibodies), antibody compositions with polyepitopic specificity, polyclonal antibodies, single chain anti-antibodies, and fragments of antibodies (see below) as long as they specifically bind a native polypeptide and/or exhibit a biological activity or immunological activity of the present invention. According to one embodiment, the antibody binds to an oligomeric form of a target protein, e.g., a trimeric form. The phrase “functional fragment or analog” of an antibody is a compound having a qualitative biological activity in common with an antibody to which it is being referred. For example, a functional fragment or analog of an antibody of this invention can be one which can specifically bind to EGFR. In one embodiment, the antibody can prevent or substantially reduce the ability of an EGFR to induce cell proliferation.
- As used herein, the term “isolated antibody” is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and can include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. In preferred embodiments, the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain. Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- As used herein, “percent (%) amino acid sequence identity” and “homology” with respect to a peptide, polypeptide or antibody sequence refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEGALIGN (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms known in the art needed to achieve maximal alignment over the full length of the sequences being compared.
- As used herein, the term “Fab” indicates an antigen binding fragment of an Ig (regardless of how prepared) including variable domain and first constant domain.
- As used herein, the term “Fv” is the minimum antibody fragment which contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (3 loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three HVRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
- As used herein, the term “single-chain Fv” also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain. Preferably, the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the sFv to form the desired structure for antigen binding. For a review of the sFv, see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
- As used herein, the term “complementarity determining region” (CDR) refers to the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. CDRs have been described by Kabat et al., J. Biol. Chem. 252: 6609-6616 (1977); Kabat et al., U.S. Dept. of Health and Human Services, “Sequences of proteins of immunological interest” (1991); by Chothia et al., J. Mol. Biol. 196: 901-917 (1987); and MacCallum et al., J. Mol. Biol. 262: 732-745 (1996), where the definitions include overlapping or subsets of amino acid residues when compared against each other.
- As used herein, the term “humanized antibody” refers to a recombinant protein in which the CDRs from an antibody from one species; e.g., a murine or a chicken antibody, are transferred from the heavy and light variable chains of the antibody from the species into human heavy and light variable domains (framework regions). The constant domains of the antibody molecule are derived from those of a human antibody. In some cases, specific residues of the framework region of the humanized antibody, particularly those that are touching or close to the
- CDR sequences, may be modified, for example replaced with the corresponding residues from the original murine, rodent, subhuman primate, or other antibody. The humanized antibody may be achieved by various methods including (a) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues, or (b) transplanting the entire non-human variable domains, but “cloaking” them with a human-like section by replacement of surface residues. Such methods as are useful in practicing the present invention include that disclosed in Padlan, Mol. Immunol., 31(3): 169-217 (1994).
- As used herein, the term “chimeric antibody” refers to a recombinant protein that contains the variable domains of both the heavy and light antibody chains, including the complementarity determining regions (CDRs) of an antibody derived from one species, preferably a rodent antibody or a chicken antibody, more preferably a murine antibody, while the constant domains of the antibody molecule are derived from those of a human antibody.
- As used herein, the term “treatment” or “treating” of a disease is an approach for obtaining beneficial or desired results including clinical results. For purposes of the present invention, beneficial or desired clinical results include, but are not limited to, one or more of the following: alleviating one or more symptoms resulting from the disease, diminishing the extent of the disease, stabilizing the disease (e.g., preventing or delaying the worsening of the disease), preventing or delaying the spread (e.g., metastasis) of the disease, preventing or delaying the recurrence of the disease, delaying or slowing the progression of the disease, ameliorating the disease state, providing a remission (partial or total) of the disease, decreasing the dose of one or more other medications required to treat the disease, delaying the progression of the disease, increasing or improving the quality of life, increasing weight gain, and/or prolonging survival. Also encompassed by “treatment” is a reduction of pathological consequence of cancer (such as, for example, tumor volume). The methods provided herein contemplate any one or more of these aspects of treatment.
- As used herein, the term “administer” or “administration” refers to the act of injecting or otherwise physically delivering a substance as it exists outside the body (e.g., a formulation of the invention) into a patient, such as by mucosal, intradermal, intravenous, intramuscular delivery and/or any other method of physical delivery described herein or known in the art. When a disease, or a symptom thereof, is being treated, administration of the substance typically occurs after the onset of the disease or symptoms thereof. When a disease, or symptoms thereof, is being prevented, administration of the substance typically occurs before the onset of the disease or symptoms thereof.
- As interchangeably used herein, the terms “individual,” “subject,” “host,” and “patient,” refer to a mammal, including, but not limited to, murines (rats, mice), non-human primates, humans, canines, felines, ungulates (e.g., equines, bovines, ovines, porcines, caprines), etc.
- As used herein, the term “therapeutically effective amount” or “efficacious amount” refers to the amount of a subject anti-EGFL6 antibody that, when administered to a mammal or other subject for treating a disease, is sufficient to effect such treatment for the disease.
- The present invention creates anti-EGFL6 antibodies, particularly, a single-chain antibody fragments (scFv) and humanized antibody, which have ability in binding to EGFL6 and in inhibiting angiogenesis and cancer cell growth.
- In another aspect, the present invention provides an isolated anti-EGFL6 antibody or an antigen-binding portion thereof, comprising at least one of a light chain CDR1 (L-CDR1) consisting of the amino acid residue of SEQ ID NO: 1 or 2, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 1 and 2; a light chain CDR2 (L-CDR2) consisting of the amino acid residue of SEQ ID NO: 3 or 4, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 3 and 4; and a light chain CDR3 (L-CDR3) consisting of the amino acid residue SEQ ID NO: 5 or 6, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 5 and 6; and
- at least one of a heavy chain complementarity determining region 1 (H-CDR1) consisting of the amino acid residue of SEQ ID NO: 7 or 8 , or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 7 and 8; a heavy chain CDR2 (H-CDR2) consisting of the amino acid residue of SEQ ID NO: 9 or 10, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 9 and 10; and a heavy chain CDR3 (H-CDR3) consisting of the amino acid residue of SEQ ID NO: 11 or 12, or a variant having amino acid sequence with at least 80% identity to any of SEQ ID NOs: 11 and 12; such that said isolated antibody or antigen-binding portion thereof binds to EGFL6. Preferably, the sequence identity as mentioned above is at least 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
- The amino acid sequences of the complementarity determining regions in light chains and heavy chains and are listed below.
-
-
L-CDR1 L-CDR2 L-CDR3 GNDKY ETR GGYDSSAGYAGM (SEQ ID NO: 1) (SEQ ID NO: 3) (SEQ ID NO: 5) SGRYG DND GSYDRSGGVGT (SEQ ID NO: 2) (SEQ ID NO: 4) (SEQ ID NO: 6) -
-
H-CDR1 H-CDR2 H-CDR3 GFDFSSHG ISGSGSGT VRTRGSFNIVTIDT (SEQ ID NO: 7) (SEQ ID NO: 9) (SEQ ID NO: 11) GFTLSSYG IRSDGSNT AKSAYGTGYSSGRIDT (SEQ ID NO: 8) (SEQ ID NO: 10) (SEQ ID NO: 12) - In some embodiments, the isolated anti-EGFL6 antibody is a monoclonal antibody, chimeric antibody, humanized antibody or human antibody. In some embodiments, the isolated anti-EGFL6 antibody is a single chain antibody (such as Fv (scFv), IgG, Fab, (Fab)2, or (scFv′)2).
- According to the invention, the embodiments of the amino acids of the light chains and the heavy chains and of the antibodies of the invention are listed below.
-
Embodiments of Amino Acid Sequences of Light chains LTQPSSVSANLGETVKITCSGGGNDKYYGWFQQKSPGSAPVTVIYETRSR PSDIPSRFSGSKSGSTATLTITGVQAEDEAVYFCGGYDSSAGYAGMFGAG TTLTVL (SEQ ID NO: 13) (EL6_S12) LTQPSSVSANPGETVKITCSGGSGRYGWFQQKSPGTAPVTMIYDNDKRPS GIPPRFSGSTSGSTGTLIITGVQVEDEAVYFCGSYDRSGGVGTFGAGTTL TVL (SEQ ID NO: 14) (EL6_E5) -
Embodiments of Amino Acid Sequences of Heavy Chains TVTLDESGGGLQTPGGAVSLVCKASGFDFSSHGMGWVRQAPGKGLEWVAG ISGSGSGTGYAPAVKGRATISRDNGQSTLRLQLNDLRPEDTATYYCVRDV RTRGSFNIVTIDTWGHGTEVIVSSTSGQAGQ (SEQ ID NO: 15) (EL6_S12) TVTLDESGGGLHTPGGALSLVCKASGFTLSSYGMFWVRQAPGKGLEFVAY IRSDGSNTYYGAAVKGRATISRDDGQSTVRLQLNNLRAEDTGIYFCAKSA YGTGYSSGRIDTWGHGTEVIVSSTSGQAGQ (SEQ ID NO: 16) (EL6_E5) - In some embodiments, the invention provides a light chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 13 or 14.
- In some embodiments, the light chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 13 wherein the L-CDR1, L-CDR2 and L-CDR3 are replaced with SEQ ID NO: 2, SEQ ID NO: 4 and SEQ ID NO: 6, respectively. In another embodiment, the light chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 14 wherein the L-CDR1, L-CDR2 and L-CDR3 are replaced with SEQ ID NO: 1, SEQ ID NO: 3 and SEQ ID NO: 5, respectively.
- In some embodiments, the invention provides a heavy chain comprising an amino acid sequence having a sequence selected from the group consisting of SEQ ID NO: 15 or 16.
- In some embodiments, the heavy chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 15 wherein the H-CDR1, H-CDR2 and H-CDR3 are replaced with SEQ ID NO: 8, SEQ ID NO: 10 and SEQ ID NO: 12, respectively. In another embodiment, the heavy chain comprises an amino acid sequence having the sequence as set forth in SEQ ID NO: 16 wherein the H-CDR1, H-CDR2 and H-CDR3 are replaced with SEQ ID NO: 7, SEQ ID NO: 9 and SEQ ID NO: 11, respectively.
- In further embodiments, the invention comprises an isolated antibody, comprising a light chain having an amino acid sequence as set forth in the sequence selected from the group consisting of SEQ ID NOs: 13 and 14, or a variant having at least 80% identity to any of SEQID NOs: 13 and 14, and (ii) a heavy chain having an amino acid sequence as set forth in the sequence selected from the group consisting of SEQ ID NOs: 15 and 16 or a variant having at least 80% identity to any of SEQ ID NOs: 15 to 16. Preferably, the sequence identity as mentioned above is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
- In a further embodiment, the invention comprises an isolated antibody (EL6 S12), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 13 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15. In a further embodiment, the invention comprises an isolated antibody (EL6_E5), comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 14 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 16. In a further embodiment, the invention comprises an isolated antibody, comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 13 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 16. In a further embodiment, the invention comprises an isolated antibody, comprising a light chain having an amino acid sequence as set forth in SEQ ID NO: 14 and a heavy chain having an amino acid sequence as set forth in SEQ ID NO: 15.
- Techniques for preparing monoclonal antibodies against virtually any target antigen are well known in the art. See, for example, Kohler and Milstein, Nature 256: 495 (1975), and Coligan et al. (eds.), CURRENT PROTOCOLS IN IMMUNOLOGY, VOL. 1, pages 2.5.1-2.6.7 (John Wiley & Sons 1991). Briefly, monoclonal antibodies can be obtained by injecting mice or chicken with a composition comprising an antigen, removing the spleen to obtain B-lymphocytes, fusing the B-lymphocytes with myeloma cells to produce hybridomas, cloning the hybridomas, selecting positive clones which produce antibodies to the antigen, culturing the clones that produce antibodies to the antigen, and isolating the antibodies from the hybridoma cultures.
- Various techniques, such as production of chimeric or humanized antibodies, may involve procedures of antibody cloning and construction. The antigen-binding variable light chain and variable heavy chain sequences for an antibody of interest may be obtained by a variety of molecular cloning procedures, such as RT-PCR, 5′-RACE, and cDNA library screening. The variable heavy or light chain sequence genes of an antibody from a cell that expresses a murine antibody can be cloned by PCR amplification and sequenced. To confirm their authenticity, the cloned VL and VH genes can be expressed in cell culture as a chimeric antibody as described by Orlandi et al., (Proc. Natl. Acad. Sci., USA, 86: 3833 (1989)). Based on the variable heavy or light chain gene sequences, a humanized antibody can then be designed and constructed as described by Leung et al. (Mol. Immunol., 32: 1413 (1995)).
- A chimeric antibody is a recombinant protein in which the variable regions of a human antibody have been replaced by the variable regions of, for example, a mouse antibody, including the complementarity-determining regions (CDRs) of the mouse antibody. Chimeric antibodies exhibit decreased immunogenicity and increased stability when administered to a subject. Methods for constructing chimeric antibodies are well known in the art (e.g., Leung et al., 1994, Hybridoma 13: 469).
- A chimeric monoclonal antibody may be humanized by transferring the mouse CDRs from the heavy and light variable chains of the mouse immunoglobulin into the corresponding variable domains of a human antibody. The mouse framework regions (FR) in the chimeric monoclonal antibody are also replaced with human FR sequences. To preserve the stability and antigen specificity of the humanized monoclonal, one or more human FR residues may be replaced by the mouse counterpart residues. Humanized monoclonal antibodies may be used for therapeutic treatment of subjects. Techniques for production of humanized monoclonal antibodies are well known in the art (see, e.g., Jones et al., 1986, Nature, 321: 522; Riechmann et al., Nature, 1988, 332: 323; Verhoeyen et al., 1988, Science, 239: 1534; Carter et al., 1992, Proc. Nat'l Acad. Sci. USA, 89: 4285; Sandhu, Crit. Rev. Biotech., 1992, 12: 437; Tempest et al., 1991, Biotechnology 9: 266; Singer et al., J. Immun., 1993, 150: 2844).
- Phage display technology can be used to produce the anti-EGFL6 antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors. According to this technique, antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle. Because the filamentous particle contains a single-stranded DNA copy of the phage genome, selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties. Thus, the phage mimics some of the properties of the B-cell. Phage display can be performed in a variety of formats, reviewed in, e.g., Johnson, Kevin S. and Chiswell, David J., Curr. Opin Struct. Biol. 3: 564-571 (1993). Several sources of V-gene segments can be used for phage display. Clackson et al., Nature 352: 624-628 (1991) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice. In other embodiments, ribosome display technology can be used to produce the anti-EGFL6 antibodies and antibody fragments in vitro.
- Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies. However, these fragments can now be produced directly by recombinant host-cells, for example, using nucleic acids encoding anti-EGFL6 antibodies of the present disclosure. Fab, Fv and scFv antibody fragments can all be expressed in and secreted from E. coli, thus allowing the straightforward production of large amounts of these fragments. Anti-EGFL6 antibody fragments can also be isolated from the antibody phage libraries as discussed above. Alternatively, Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′)2 fragments. According to another approach, F(ab′)2 fragments can be isolated directly from recombinant host-cell culture. Production of Fab and F(ab′)2 antibody fragments with increased in vivo half-lives are described in U.S. Pat. No. 5,869,046. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv).
- Modifications can be made to a nucleic acid encoding a polypeptide described herein without diminishing its biological activity. Some modifications can be made to facilitate the cloning, expression, or incorporation of the targeting molecule into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, termination codons, a methionine added at the amino terminus to provide an initiation, site, additional amino acids placed on either terminus to create conveniently located restriction sites, or additional amino acids (such as poly His) to aid in purification steps. In addition to recombinant methods, the antibodies of the present disclosure can also be constructed in whole or in part using standard peptide synthesis well known in the art.
- As a modification to the two chain antibody purification protocol, the heavy and light chain regions are separately solubilized and reduced and then combined in the refolding solution. An exemplary yield is obtained when these two proteins are mixed in a molar ratio such that a 5 fold molar excess of one protein over the other is not exceeded. Excess oxidized glutathione or other oxidizing low molecular weight compounds can be added to the refolding solution after the redox-shuffling is completed.
- In addition to recombinant methods, the antibodies and variants thereof that are disclosed herein can also be constructed in whole or in part using standard peptide synthesis. Solid phase synthesis of the polypeptides can be accomplished by attaching the C-terminal amino acid of the sequence to an insoluble support followed by sequential addition of the remaining amino acids in the sequence. Techniques for solid phase synthesis are described by Barany & Merrifield, The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A. pp. 3-284; Merrifield et al., J. Am. Chem. Soc. 85: 2149-2156, 1963, and Stewart et al., Solid Phase Peptide Synthesis, 2nd ed., Pierce Chem. Co., Rockford, Ill., 1984. Proteins of greater length may be synthesized by condensation of the amino and carboxyl termini of shorter fragments.
- Certain embodiments relate to a pharmaceutical composition comprising the anti-EGFL6 antibody of the invention and a pharmaceutically acceptable carrier or excipient. The term “pharmaceutically acceptable carrier” is intended to include, but not limited to, a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type known to persons skilled in the art. Diluents, such as polyols, polyethylene glycol and dextrans, may be used to increase the biological half-life of the conjugate.
- The pharmaceutical compositions of the present invention can be formulated according to conventional methods (for example, Remington's Pharmaceutical Science, latest edition, Mark Publishing Company, Easton, U.S.A.), and may also contain pharmaceutically acceptable carriers and additives. Examples include, but are not limited to, surfactants, excipients, coloring agents, flavoring agents, preservatives, stabilizers, buffers, suspension agents, isotonic agents, binders, disintegrants, lubricants, fluidity promoting agents, and corrigents, and other commonly used carriers can be suitably used. Specific examples of the carriers include light anhydrous silicic acid, lactose, crystalline cellulose, mannitol, starch, carmellose calcium, carmellose sodium, hydroxypropyl cellulose, hydroxypropyl methylcellulose, polyvinylacetal diethylaminoacetate, polyvinylpyrrolidone, gelatin, medium-chain triglyceride, polyoxyethylene
hardened castor oil 60, saccharose, carboxymethyl cellulose, corn starch, inorganic salt, and such. - An embodiment is directed to a method for treating or preventing angiogenesis disorder in a subject, comprising administering an anti-EGFL6 antibody of the present disclosure to the subject. Alternatively, an embodiment is directed to a use of an anti-EGFL6 antibody of the present disclosure in the manufacture of a medicament for treating or preventing angiogenesis disorder in a subject. A disorder characterized by pathological angiogenesis refers to a disorder where abnormal or aberrant angiogenesis, alone or in combination with others, contributes to causation, origination, or symptom of the disorder. Examples of this disorder include various cancers (e.g., vascularized tumors), eye disorders, inflammatory disorders, and others.
- A further embodiment is directed to a method for inhibiting cancer cell growth or cancer metastasis in a subject comprising administering an anti-EGFL6 antibody of the present disclosure to the subject. Alternatively, a further embodiment is directed to a use of an anti-EGFL6 antibody of the present disclosure in the manufacture of a medicament for inhibiting cancer cell growth or cancer metastasis in a subject. Because angiogenesis is involved in both primary cancer growth and metastasis, the antiangiogenic treatment provided by the present disclosure is capable of inhibiting the cancer cell growth at the primary site as well as preventing metastasis of tumors at the secondary sites. Exemplary solid tumors include, but are not limited to, carcinomas of the skin, kidney, prostate, adipose tissue, lung, breast, bone, ovary, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, prostate, thyroid, squamous cell carcinomas, adenocarcinomas, small cell carcinomas, melanomas, gliomas, glioblastomas, neuroblastomas, Kaposi's sarcoma, and sarcomas (such as gastrointestinal stromal tumor). In a further embodiment, the cancer is colorectal cancer, colon cancer or rectal cancer.
- The present method also comprises administering the anti-EGFL6 antibody of the present disclosure concomitantly with, or subsequent to other standard therapies, wherein said standard therapy is selected from the group consisting of radiotherapy, surgery and chemotherapy.
- In preferred embodiments, the subject is a mammal. Exemplary mammals include human, pig, sheep, goat, horse, mouse, dog, cat, cow, etc. Diseases that may be treated with the anti-EGFL6 antibody or a pharmaceutical composition thereof include cancer, such as cancer of the liver, skin, head and neck, lung, breast, prostate, ovaries, endometrium, cervix, colon, rectum, colon and rectum, bladder, brain, stomach, pancreas or lymphatic system. Preferably, the cancer is colorectal cancer.
- The anti-EGFL6 antibody or the pharmaceutical composition thereof may be administered intravenously, intra-peritoneally, intra-arterially, intra-thecally, intra-vesically, or intratumorally. One of ordinary skill will appreciate that effective amounts of the anti-EGFL6 antibody can be determined empirically. It will be understood that, when administered to a human patient, the total daily usage of the anti- EGFL6 antibody or composition will be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular patient will depend upon a variety of factors: the type and degree of the cellular response to be achieved; activity of the specific anti-EGFL6 antibody or composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the anti-EGFL6 antibody; the duration of the treatment; drugs used in combination or coincidental with the anti-EGFL6 antibody; and like factors well known in the medical arts.
- Each of the above identified compositions and methods of treatment may additionally include an additional anti-tumor drug and the administration of an additional one or more anti-tumor drug. Anti-tumor drugs suitable for use with the present disclosure include, but are not limited to, agents that induce apoptosis, agents that inhibit adenosine deaminase function, inhibit pyrimidine biosynthesis, inhibit purine ring biosynthesis, inhibit nucleotide interconversions, inhibit ribonucleotide reductase, inhibit thymidine monophosphate (TMP) synthesis, inhibit dihydrofolate reduction, inhibit DNA synthesis, form adducts with DNA, damage DNA, inhibit DNA repair, intercalate with DNA, deaminate asparagines, inhibit RNA synthesis, inhibit protein synthesis or stability, inhibit microtubule synthesis or function, and the like. Examples of the additional anti-tumor drug include but are not limited to 1) alkaloids, including microtubule inhibitors (e.g., vincristine, vinblastine, and vindesine, etc.), microtubule stabilizers (e.g., paclitaxel (TAXOL), and docetaxel, etc.), and chromatin function inhibitors, including topoisomerase inhibitors, such as epipodophyllotoxins (e.g., etoposide (VP-16), and teniposide (VM-26), etc.), and agents that target topoisomerase I (e.g., camptothecin and isirinotecan (CPT-11), etc.); 2) covalent DNA-binding agents (alkylating agents), including nitrogen mustards (e.g., mechlorethamine, chlorambucil, cyclophosphamide, ifosphamide, and busulfan (MYLERAN), etc.), nitrosoureas (e.g., carmustine, lomustine, and semustine, etc.), and other alkylating agents (e.g., temozolomide, dacarbazine, hydroxymethylmelamine, thiotepa, and mitomycin, etc.); 3) noncovalent DNA-binding agents (antitumor antibiotics), including nucleic acid inhibitors (e.g., dactinomycin (actinomycin D), etc.), anthracyclines (e.g., daunorubicin (daunomycin, and cerubidine), doxorubicin (adriamycin), and idarubicin (idamycin), etc.), anthracenediones (e.g., anthracycline analogues, such as mitoxantrone, etc.), bleomycins (BLENOXANE), etc., and plicamycin (mithramycin), etc.; 4) antimetabolites, including antifolates (e.g., methotrexate, FOLEX, and MEXATE, etc.), purine antimetabolites (e.g., 6-mercaptopurine (6-MP, PURINETHOL), 6-thioguanine (6-TG), azathioprine, acyclovir, ganciclovir, chlorodeoxyadenosine, 2-chlorodeoxyadenosine (CdA), and 2′-deoxycoformycin (pentostatin), etc.), pyrimidine antagonists (e.g., fluoropyrimidines (e.g., 5-fluorouracil (ADRUCIL), 5-fluorodeoxyuridine (FdUrd) (floxuridine)) etc.), and cytosine arabinosides (e.g., CYTOSAR (ara-C) and fludarabine, etc.); 5) enzymes, including L-asparaginase, and hydroxyurea, etc.; 6) hormones, including glucocorticoids, antiestrogens (e.g., tamoxifen, etc.), nonsteroidal antiandrogens (e.g., flutamide, etc.), and aromatase inhibitors (e.g., anastrozole (ARIMIDEX), etc.); 7) platinum compounds (e.g., cisplatin and carboplatin, etc.); 8) monoclonal antibodies conjugated with anticancer drugs, toxins, and/or radionuclides, etc.; 9) biological response modifiers (e.g., interferons (e.g., IFN-.alpha., etc.) and interleukins (e.g., IL-2, etc.), etc.); 10) adoptive immunotherapy; 11) hematopoietic growth factors; 12) agents that induce tumor cell differentiation (e.g., all-trans-retinoic acid, etc.); 13) gene therapy techniques; 14) antisense therapy techniques; 15) tumor vaccines; 16) therapies directed against tumor metastases (e.g., batimastat, etc.); 17) angiogenesis inhibitors; 18) proteosome inhibitors (e.g., VELCADE); 19) inhibitors of acetylation and/or methylation (e.g., HDAC inhibitors); 20) modulators of NF kappa B; 21) inhibitors of cell cycle regulation (e.g., CDK inhibitors); and 22) modulators of p53 protein function.
- The present disclosure also shows that there is a connection between EGFL6 levels and cancer severity; accordingly, the expression of EGFL6 or a fragment thereof in high level in the biological sample as compared to a reference level of the expression of EGFL6 or a fragment thereof in the control sample is indicative of prediction of a metastasis or poor prognosis. The invention unexpectedly found that the anti-EGFL6 antibody of the present disclosure can be used as an indicator of a diagnosis or predication of a prognosis or an elevated risk of metastasis or future occurrence of a cancer in a subject. Accordingly, the present disclosure provides a method for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer in a subject, comprising contacting a biological sample from a subject with an anti-EGFL6 antibody of the present disclosure, quantifying the binding of EGFL6 antigen in the sample to the antibody, and comparing said binding to a reference value representing binding between the anti-EGFL6 antibody and the EGFL6 antigen determined in samples from control subjects not afflicted with a cancer.
- In one embodiment, the biological sample may be a cell, tissue, organ, organ sample, tissue biopsy, blood, plasma, serum, ascetic fluid, lymphocytes, urine, bone marrow fluid, lymphatic fluid, saliva, lachrymal fluid, mucosal fluid, amniotic fluid, or a combination thereof.
- Detectable labels suitable for conjugation to antibodies and other binding reagents include radioisotopes, fluorescent labels, enzyme-substrate labels, chromogenic labels, chemiluminescent labels and colloidal gold particles.
- Examples of the measurement method include, but are not limited to, a fluorescence immunoassay (FIA) method, an enzyme immunoassay (EIA) method, a radioimmunoassay (MA) method, a Western blotting method, dot blot, an immunohistochemical assay, Fluorescence Activated Cell Sorter (FACS), in vivo imaging and a radio-imaging assay.
- The present disclosure further provides a method for monitoring the progression of a cancer in a subject already diagnosed with a cancer. In some embodiments, monitoring can be used to evaluate whether a particular treatment is successful.
- In some embodiments, monitoring cancer progression comprises determining a first level of EGFL6 or a fragment thereof in a first biological sample obtained from a subject diagnosed with a cancer by the anti-EGFL6 antibody of the present disclosure; and determining a second level of EGFL6 or the fragment thereof in a second biological sample obtained from the subject by the anti-EGFL6 antibody of the present disclosure after a predetermined period of time; comparing the first and second levels of EGFL6 or the fragment thereof; wherein a higher level of EGFL6 or the fragment thereof in the second sample compared to the first sample is indicative of disease progression and worsening. Similarly, a lower level of EGFL6 or the fragment thereof in the second sample compared to the first sample is indicative of improvement.
- The diagnostic methods of the present disclosure may be combined with the known diagnostic methods for a cancer.
- Another aspect of the present disclosure encompasses a kit for detecting or diagnosing a cancer or an elevated risk of future occurrence of a cancer, or predicting a metastasis or prognosis of a cancer, or monitoring cancer progression in a subject. It is typically in a package which contains all elements, optionally including instructions. The package may be divided so that components are not mixed until desired. Individual components may be separately packaged within the kit. The kit may contain reagents necessary to detect the expression level of a marker gene. A kit is any manufacture (e.g., a package or container) comprising at least one reagent, e.g., an antibody reagent(s), for specifically detecting and/or measuring the expression level of a marker gene in a sample.
- A variety of kits having different components are contemplated by the current disclosure. Generally speaking, the kit will include the means for quantifying EGFL6 or more biomarkers in a subject. In another embodiment, the kit will include means for collecting a biological sample, means for quantifying EGFL6 or more biomarkers in the biological sample, and instructions for use of the kit contents. In certain aspects, the kit comprises a means for quantifying the amount of a biomarker. In further aspects, the means for quantifying the amount of a biomarker comprises reagents necessary to detect the amount of a biomarker.
- A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, the following examples are intended to illustrate but not limit the scope of invention described in the claims.
- Female white leghorn (Gallus domesticus) chickens were immunized with 50 ug of recombinant EGF6 in an equal volume of Freund's complete adjuvant by an intramuscular injection. Three additional immunizations with incomplete adjuvant were performed at intervals of 7 days. After each immunization, chicken IgY antibodies in egg yolk were collected and titrated by an enzyme-linked immunosorbent assay (ELISA) to determine the presence of humoral anti-EGFL6 antibody immune response. The egg yolk will be separated from the egg white for IgY purification using 10% Dextran sulphate according to published protocol (Akita, E. M., and Nakai, S. (1993). Production and purification of Fab′ fragments from chicken egg yolk immunoglobulin Y (IgY). J Immunol Methods 162, 155-164).
- The antibody libraries will be established based on the previous report (Andris-Widhopf, J., Rader, C., Steinberger, P., Fuller, R., and Barbas, C. F., 3rd (2000). Methods for the generation of chicken monoclonal antibody fragments by phage display. J Immunol Methods 242, 159-181. Barbas, C. F., 3rd, Kang, A. S., Lerner, R. A., and Benkovic, S. J. (1991). Assembly of combinatorial antibody libraries on phage surfaces: the gene III site. Proc Natl Acad Sci U S A 88, 7978-7982). Briefly, chicken spleens were harvested and placed immediately in Trizol. Ten ug of total RNAs will be reversely transcribed into the first-strand cDNA. After amplification using chicken-specific primers, PCR products of heavy and light chain variable (VH and VL) regions with short or long linkers will be subjected to a second round of PCR, digested with SfiI and cloned into the pComb3X vector. Recombinant DNAs were transformed into E. coli ER2738 strain by electroporation. Recombinant phage was produced by the addition of VCS-M13 helper phage, precipitated with 4
% polyethylglycol 8000 and 3% NaCl (w/v), re-suspended in phosphate-buffered saline (PBS) containing 1% bovine serum albumin (BSA). Then, 1011 plaque-forming units (pfu) of recombinant phages were added to wells pre-coated with EGFL6 protein (0.5 ug/well), and incubated at 37° C. for 2 h. Bound phages were eluted with 0.1 M HCl/glycine (pH 2.2)/0.1% BSA, neutralized with 2 M Tris base buffer and used to infect the ER2738 strain. The amplified phages were recovered as described above for the next round of selection. The panning procedure was repeated six times. The total DNAs were purified and transformed into TOP 10F′ E. coli strain. Twenty clones were randomly selected and grown from the final panning process. Bacterial cells were lysed and analyzed for scFv antibody expression and binding reactivity to EGFL6. ScFv antibodies were purified using Ni2+-charged sepharose as described by the manufacturer (Amersham Biosciences, UK).FIG. 1 shows the binding activity of anti-EGFL6 antibodies using ELISA. The total cell lysates of 14 clones randomly selected from each ELISA-positive phage library after the 6th round of bio-panning were used to examine their anti-EGFL6 activity. It was found that most scFv antibodies can specifically bind to the EGFL6 protein (seeFIG. 1 ). - The E. coli-expressed scFv antibodies were purified and incubated with the EGFL6 protein immobilized on nitrocellulose membranes. Their binding was subsequently detected by adding goat anti-chicken IgY light chain followed by HRP-conjugated donkey anti-goat Ig antibodies. After three washings, the membranes were developed with diaminobenzidine (DAB) substrate until the desired intensity was reached.
FIG. 2 shows recombinant full-length EGFL6 protein (Lane EGFL6), and N-terminus truncated fragment (Lane EGFL6-F37) and the C-terminus truncated fragment (Lane EGFL6-F396) were used to SDS-PAGE analysis under reducing condition.FIGS. 2A and 2B show full-length EGFL6 protein and EGFL6-F396 truncated fragment identified by E5 scFv (FIG. 2A ) and S12 scFv (FIG. 2B ) in the Western blotting. - Expressions of epidermal growth factor like protein 6 (EGFL6) were evaluated in the serum of cancer patients.
- As shown in
FIG. 3 , a protein expression of EGFL6 in lung, colon, ovarian, prostate, brain, uterine and breast cancer cell lines was measured by Western Blot. EGFL6 is not expressed in normal cell lines. These results suggest that EGFL6 could be found in patients with cancer and EGFL6 could serve as a cancer marker. - A cell penetration migration analysis was performed to evaluate the single chain antibodies for ability to inhibit cell migrations of the colorectal cancer cell lines HCT116. As shown in
FIG. 4 (A), the anti-EGFL6 single chain antibodies were added to the colorectal cancer cell lines HCT116 and inhibit the growth of cancer cells under cell culture conditions. The results illustrated that the antibodies Ab4, Ab5 (E5) and Ab10 were effective in inhibiting the cancer cells migrations. - In a CT26 allograft mice model, the ability for inhibiting the metastasis of the colorectal cancer cells CT26 to lung was observed after the mice were administered with the anti-EGFL6 single chain antibodies (S12 and E5) and small molecule drug Paclitaxel. The anti-EGFL6 single chain antibodies S12 and E5 were administered with a dose of 15 mg/kg once every three days while the Paclitaxel was administered with a dose of 20 mg/kg once every four days. As shown in
FIG. 4 (B), the groups treated with two of the anti-EGFL6 single chain antibodies at a dose of 15 mg/kg once every three days can effectively inhibit the formations of tumor capsule compared with the control group treated with the Paclitaxel at a dose of 20 mg/kg once every four days. - The five-week old nude mice were subcutaneously injected with 500 μl of matrigel mixed with EGF to induce angiogenesis. The nude mice were divided into four groups: (1) matrigel alone as the negative control group (Basal); (2) matrigel mixed with EGF (150 ng/mL) as the positive control group (Control); (3) the groups treated with the single chain antibody E5 at a dose of 15 mg/kg under EGF-induced condition and (4) the groups treated with the single chain antibody S12 at a dose of 15 mg/kg under EGF-induced condition. Each group had 3 nude mice and the single chain antibodies E5 and S12 were administered three times a week by the tail vein injection for one week. The nude mice were sacrificed on the eighth day. The matrix micelles in mice abdomen were removed and homogenized by the grinding rod, followed by measuring the hemoglobin contents.
- As shown in
FIG. 5 , the angiogenesis was not shown in the negative control group (Basal) injected with the matrigel alone. Comparing the negative control group (Basal), the angiogenesis was shown in the positive control group (Control) injected with the matrigel mixed with EGF after 24 hours. As shown inFIG. 5 , it was apparent that the groups treated with both of the anti-EGFL6 single chain antibodies E5 and S12 showed the effects of inhibiting angiogenesis. In addition, the nude mice were sacrificed and the matrix micelles in mice abdomen were removed and the hemoglobin contents were measured.FIG. 5 illustrated that the hemoglobin contents in the matrix micelles of the nude mice treated with the anti-EGFL6 single chain antibodies E5 and S12 did show lower values correlated with the observation of the nude mice entity. In addition, as shown inFIG. 5 , the anti-EGFL6 single chain antibodies E5 and S12 exhibited significant effects to inhibit angiogenesis. The hemoglobin contents of the groups treated with the anti-EGFL6 single chain antibodies E5 and S12 were almost equivalent to the contents of the negative control group (Basal). These results demonstrate that the anti-EGFL6 single chain antibodies E5 and S12 did have the ability of neutralizing EGFL6, and thus achieve the effects of inhibiting angiogenesis. - Humanization of variable regions of chicken scFv antibodies will be performed with the assistance of a molecular model generated by the algorithms applied in previous studies (Tsurushita et al., 2004; Zilber et al., 1990). In brief, the human V region framework used as an acceptor for the CDRs of the anti-EGFL6 scFv antibodies will be chosen based on sequence homology. Amino acid residues in the humanized V regions predicted from the three-dimensional model to be important for proper formation of the CDR structure will be substituted with the corresponding residues of chicken anti-EGFL6 scFv antibodies. Other methods will be combined and used to further fine-tune the structure of humanized anti-EGFL6 antibodies (Ewert et al., 2003; Sidhu et al., 2004).
- Two of the anti-EGFL6 humanized IgG antibodies (S12 and E5) were evaluated ability to inhibit the growth of the colorectal cancer cells HCT116, non-small cell lung cancer A549, triple negative breast cancer cell MDA-MB-231 and gilblastoma cancer cell U87 in xenograft mice. The mice were administered with indicated dose and intravenous injection twice a week. The initial tumor size was about 200 mm3. After the end of the experiment, the ratio of tumor growth inhibition (% TGI) was calculated compared with the control group. As shown in
FIG. 6 (A), both of the groups with the humanized IgG antibodies S12 and E5 have the ability for inhibiting the tumor growth (colorectal cancer cell HCT-116). The % TGI of the group with S12 antibody is 7.5% while the group with E5 antibody is 36.2%. As shown inFIG. 6 (B), the humanized IgG antibody E5 has the ability for inhibiting the tumor growth in non-small cell lung cancer A549. The %TGI of the group with E5 antibody (10 mg/kg) is 14.3% while the group with E5 antibody (20 mg/kg) is 80.8%. - As shown in
FIG. 7 (A), the groups with the humanized IgG antibody E5 have the ability for inhibiting the tumor growth (triple negative breast cancer cell MDA-MB-231). The % TGI of the group with E5 antibody (20 mg/kg) is 65.1% while the group with E5 antibody (40 mg/kg) is 65.4%. As shown inFIG. 7 (B), the groups with the single chain antibody E5 have the ability for inhibiting the tumor growth (glioblastoma cancer cell). The % TGI of the group with E5 antibody (20 mg/kg) is 36.5%. - An anti-cancer activity of humanized IgG antibody E5 combined with paclitaxel in human non-small cell lung cancer A549 xenograft model was further conducted. Paclitaxel (5 mg/kg), E5 IgG (10 mg/kg) and paclitaxel (5 mg/kg) in combination with E5 IgG (10 mg/kg) were intravenously injected to mice. As shown in
FIG. 8 , the groups with the antibody E5 IgG have the ability for inhibiting the tumor growth and paclitaxel in combination with E5 IgG has an unexpected efficacy in inhibition of tumor. The %TGI of the group with E5 antibody (10 mg/kg) is 14.3%, while the group with paclitaxel in combination with E5 IgG is 61.8%.
Claims (26)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/652,929 US11578121B2 (en) | 2017-10-01 | 2018-09-28 | Anti-EGF like domain multiple 6 (EGFL6) antibodies |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201762566509P | 2017-10-01 | 2017-10-01 | |
PCT/CN2018/108427 WO2019062871A1 (en) | 2017-10-01 | 2018-09-28 | Anti-egf like domain multiple 6 (egfl6) antibodies and their applications in cancer diagnosis and treatment |
US16/652,929 US11578121B2 (en) | 2017-10-01 | 2018-09-28 | Anti-EGF like domain multiple 6 (EGFL6) antibodies |
Publications (2)
Publication Number | Publication Date |
---|---|
US20200239560A1 true US20200239560A1 (en) | 2020-07-30 |
US11578121B2 US11578121B2 (en) | 2023-02-14 |
Family
ID=65902651
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/652,929 Active US11578121B2 (en) | 2017-10-01 | 2018-09-28 | Anti-EGF like domain multiple 6 (EGFL6) antibodies |
Country Status (5)
Country | Link |
---|---|
US (1) | US11578121B2 (en) |
KR (1) | KR20200116075A (en) |
CN (1) | CN111787946B (en) |
TW (1) | TWI696632B (en) |
WO (1) | WO2019062871A1 (en) |
Family Cites Families (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6808890B2 (en) * | 1999-07-28 | 2004-10-26 | Nuvelo, Inc. | Method of detecting a cancerous cell expressing EGFL6, and EGF mutif protein |
KR101007567B1 (en) | 2007-10-30 | 2011-01-14 | 한국생명공학연구원 | Colon cancer diagnostic markers using up-regulated genes |
CN103290100B (en) * | 2012-03-02 | 2016-12-14 | 复旦大学附属华山医院 | EGFL6 purposes in the blood serum designated object of preparation detection benign meningioma |
WO2014150720A1 (en) * | 2013-03-15 | 2014-09-25 | The Regents Of The University Of Michigan | Compositions and methods relating to inhibiting cancer cell growth and/or proliferation |
WO2016191675A2 (en) * | 2015-05-27 | 2016-12-01 | La Jolla Biologics, Inc. | Antibodies against glypican-3 and their uses in cancer diagnosis and treatment |
MX2018009499A (en) * | 2016-02-05 | 2019-05-06 | Univ Texas | Egfl6 specific monoclonal antibodies and methods of their use. |
-
2018
- 2018-09-28 WO PCT/CN2018/108427 patent/WO2019062871A1/en active Application Filing
- 2018-09-28 CN CN201880064337.5A patent/CN111787946B/en active Active
- 2018-09-28 TW TW107134565A patent/TWI696632B/en active
- 2018-09-28 KR KR1020207012703A patent/KR20200116075A/en not_active Application Discontinuation
- 2018-09-28 US US16/652,929 patent/US11578121B2/en active Active
Non-Patent Citations (1)
Title |
---|
https://www.proteinatlas.org/ENSG00000198759-EGFL6/pathology, accessed on 14 July 2022. * |
Also Published As
Publication number | Publication date |
---|---|
CN111787946A (en) | 2020-10-16 |
KR20200116075A (en) | 2020-10-08 |
US11578121B2 (en) | 2023-02-14 |
CN111787946B (en) | 2023-08-15 |
WO2019062871A1 (en) | 2019-04-04 |
TW201927811A (en) | 2019-07-16 |
TWI696632B (en) | 2020-06-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10174126B2 (en) | Antibodies binding to an intracellular PRL-1 or PRL-3 polypeptide | |
RU2595394C2 (en) | Humanised anti-cxcr4 antibodies for treating cancer | |
US9518120B2 (en) | Anti-CXCR4 antibody and its use for the detection and diagnosis of cancer | |
US8449881B2 (en) | Anti-α-enolase I antibodies for diagnosis and treatment of α-enolase I-associated diseases | |
US20190016818A1 (en) | Antibodies against glypican-3 and their uses in cancer diagnosis and treatment | |
KR102197478B1 (en) | Compositions and methods for detecting and treating esophageal cancer | |
US9611319B2 (en) | Hybridoma clones and monoclonal antibodies to fibroblast growth factor 4 | |
KR20220103921A (en) | Use of DKK-1 antagonists to treat cancer | |
JP2022543658A (en) | Anti-NAMPT antibody and use thereof | |
US11578121B2 (en) | Anti-EGF like domain multiple 6 (EGFL6) antibodies | |
JP2018516877A (en) | IGF-1R antibody and its use for diagnosis of cancer | |
TWI468176B (en) | Anti-α-enolase i antibodies for diagnosis and treatment of α-enolase i-associated diseases | |
WO2023230624A2 (en) | Epha2-targeting antibodies and their applications in cancer treatment | |
RU2706959C2 (en) | Igf-1r antibody and use thereof for diagnosing cancer | |
KR102644178B1 (en) | Novel TMEM165-CLOCK epitope and antibodies thereto | |
US20240025976A1 (en) | Gkn1 (gastrokine 1) specific antibody, and use thereof | |
US20210155709A1 (en) | Antibodies anti tumor associated antigens and method for obtaining them | |
US20220049012A1 (en) | Anti-carbonic anhydrase ix antibody |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: TAIPEI MEDICAL UNIVERSITY, TAIWAN Free format text: NUNC PRO TUNC ASSIGNMENT;ASSIGNORS:LEE, YU-CHING;PAN, SHIOW-LIN;HUANGFU, WEI-CHUN;AND OTHERS;SIGNING DATES FROM 20200622 TO 20200623;REEL/FRAME:054144/0424 Owner name: CHANGHUA CHRISTIAN MEDICAL FOUNDATION CHANGHUA CHRISTIAN HOSPITAL, TAIWAN Free format text: NUNC PRO TUNC ASSIGNMENT;ASSIGNOR:YEH, KUN-TU;REEL/FRAME:054144/0497 Effective date: 20200724 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
AS | Assignment |
Owner name: NATIONAL RESEARCH INSTITUTE OF CHINESE MEDICINE, MINISTRY OF HEALTH AND WELFARE, TAIWAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:TSAI, KENG-CHANG;REEL/FRAME:057153/0401 Effective date: 20200821 Owner name: NATIONAL RESEARCH INSTITUTE OF CHINESE MEDICINE, MINISTRY OF HEALTH AND WELFARE, TAIWAN Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:TSAI, KENG-CHANG;REEL/FRAME:057153/0387 Effective date: 20200821 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
FEPP | Fee payment procedure |
Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |