US20200171138A9 - Virus like particle with efficient epitope display - Google Patents

Virus like particle with efficient epitope display Download PDF

Info

Publication number
US20200171138A9
US20200171138A9 US15/772,186 US201615772186A US2020171138A9 US 20200171138 A9 US20200171138 A9 US 20200171138A9 US 201615772186 A US201615772186 A US 201615772186A US 2020171138 A9 US2020171138 A9 US 2020171138A9
Authority
US
United States
Prior art keywords
seq
antigen
protein
biotin
acceptor site
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
US15/772,186
Other versions
US20190022206A1 (en
US11129882B2 (en
Inventor
Adam Frederik Sander Bertelsen
Ali Salanti
Thor Theander
Susan Thrane
Christoph Mikkel Janitzek
Mette Ørskov Agerbaek
Morten Agertoug Nielsen
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Kobenhavns Universitet
Original Assignee
Kobenhavns Universitet
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Kobenhavns Universitet filed Critical Kobenhavns Universitet
Publication of US20190022206A1 publication Critical patent/US20190022206A1/en
Publication of US20200171138A9 publication Critical patent/US20200171138A9/en
Application granted granted Critical
Publication of US11129882B2 publication Critical patent/US11129882B2/en
Active legal-status Critical Current
Adjusted expiration legal-status Critical

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A61K39/0208—Specific bacteria not otherwise provided for
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A61K39/001102—Receptors, cell surface antigens or cell surface determinants
    • A61K39/001103—Receptors for growth factors
    • A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0011—Cancer antigens
    • A61K39/001148—Regulators of development
    • A61K39/00115—Apoptosis related proteins, e.g. survivin or livin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A61K39/0012—Lipids; Lipoproteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/002—Protozoa antigens
    • A61K39/015—Hemosporidia antigens, e.g. Plasmodium antigens
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525—Virus
    • A61K2039/5258—Virus-like particles
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505—Inorganic adjuvants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031—Proteins
    • A61K2039/6075—Viral proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
    • A61K2039/625—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier binding through the biotin-streptavidin system or similar
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/20011—Papillomaviridae
    • C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/20011—Papillomaviridae
    • C12N2710/20023—Virus like particles [VLP]
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to a technology and method for making a virus like particle based vaccine with efficient epitope display and capable of inducing a strong and long-term protective immune response.
  • the present invention solves the key challenge of obtaining a virus like particle which presents a larger antigen on the particle surface at high density, while being regularly spaced, and with consistent orientation; three critical factors for obtaining optimal activation of the immune system.
  • Vaccines have played, and still play, a major role in reducing the impact of infectious diseases on global health.
  • the first generation of vaccines was based on attenuated or inactivated pathogens.
  • These full-pathogen-based vaccines have proven extremely effective and, in some cases, have (e.g. small pox) led to the complete eradication of the target pathogen.
  • subunit vaccines composed solely of well-defined, purified antigen components
  • the immunogenicity of subunit vaccines based on soluble protein is, unfortunately, low compared to that of full pathogen-based vaccines.
  • To induce a high-titer antibody response it is thus often necessary to use high antigen doses, booster administrations, and co-administration of adjuvants and even so these subunit vaccines are generally not capable of inducing long-term protective immunity.
  • VLPs Virus-like particles
  • DCs dendritic cells
  • surface structures presenting an antigen at high density, while being regularly spaced, and with consistent orientation are characteristic of microbial surface antigens for which the mammalian immune system has evolved to respond vigorously to.
  • the presentation of an epitope at high density, while being regularly spaced, and with consistent orientation enables efficient cross-linking of B-cell receptors (Bachmann, M F and Zinkernagel, R M. 1997) leading to strong B-cell responses, even in the absence of T-cell help (Bachmann, M F et al., 1993; Chackerian et al., 1999; Kouskoff, V. et al., 2000) and cumulative data from several studies indicate that B-cells, in fact, discriminate antigen patterns via the degree of surface Ig-cross-linking and use antigen repetitiveness as a self/nonself discriminator.
  • VLPs immunogenicity-boosting platform for inducing immune responses against heterologous antigens by using them as molecular scaffolds for antigen presentation.
  • this has been achieved either by incorporation of antigenic epitopes into VLPs by genetic fusion (chimeric VLPs) or by conjugating antigens to preassembled VLPs.
  • the chimeric VLP approach is to date the most common method for displaying heterologous epitopes on VLPs (Pumpens, P and Grens, E. 2001; Bachmann, M F and Jennings, G T, 2004a; Chackerian, 2007; Grgacic, E V L. and Anderson, D A. 2006).
  • the present invention solves the challenges of obtaining a VLP which presents densely and regularly spaced surface antigens with consistent orientation, capable of efficiently displaying epitopes and to induce long-term protective immunity in a subject.
  • the general concept of the present invention is illustrated in FIG. 1 .
  • the present inventors have identified regions of the Papilloma Virus (PV) VLP where the inventors can insert a biotin acceptor site, without compromising the self-assembly of the particle.
  • the inventors have managed to setup a system to produce antigens fused to a monovalent streptavidin, which ensures control of the orientation of the coupled antigen.
  • PV Papilloma Virus
  • Enzymatical biotinylation of the human papilloma virus (HPV) VLPs facilitate linkage to the monovalent streptavidin/antigen and ensure control of the overall amount/stoichiometry as well as display of antigens in a densely and repetitive ordered manner with consistent orientation which is important for yielding efficient epitope display and consequently a potent immune response.
  • the described antigen display scaffold is unique as it for the first time enables coupling of virtually any antigen at high density on a VLP surface, thereby presenting ordered arrays of the particular antigens which are all held in the same orientation, thereby solving three key issues of mounting an efficient immune response.
  • the system can both be used to target self-antigens (i.e. break tolerance) as well as to efficiently target infectious organisms.
  • a main aspect of the present invention concerns a vaccine for use in the prophylaxis and/or treatment of a disease wherein the vaccine comprises:
  • the present invention concerns a vector comprising at least one polynucleotide encoding
  • the present invention concerns a host cell expressing at least one polypeptide encoded by said polynucleotide.
  • the present invention concerns a composition comprising said vaccine.
  • a further aspect of the present invention concerns a method of manufacturing a pharmaceutical composition comprising said vaccine, wherein the method comprises the steps of
  • an aspect of the present invention concerns a method of administering said vaccine to treat and/or prevent a clinical condition in a subject in need thereof comprising the steps of:
  • the present invention concerns a kit of parts comprising
  • An aspect of the invention relates to a method for inducing an immune response in a subject, the method comprising the steps of
  • FIG. 1 Schematic representation of the VAR2CSA VLP-vaccine components and the assembly system.
  • the VAR2CSA antigen encompasses the extracellular ID1-ID2a (ID1—Interdomain 1, DBL2X—Duffy binding like 2X and ID2a—Interdomain 2a) domains of the full-length VAR2CSA fused at the N-terminus to a previously described monovalent streptavidin (mSA) (Lim et al., 2011).
  • mSA monovalent streptavidin
  • HPV16 Avi-VLPs are subsequently in vitro biotinylated (the triangle represents BirA ligase) and finally mixed with the soluble mSA-vaccine antigen.
  • the HPV16 Avi-L1 VLP is theoretically expected to bind one mSA-VAR2CSA antigen per Avi-L1.
  • FIG. 2 Transmission electron microscopy of HPV AviTag-L1 virus-like particles.
  • FIG. 3 VLP/mSA-antigen coupling efficiency.
  • the figure shows SDS-PAGE gels (reduced conditions) with relative amounts of coupled mSA-antigens (mSA-ID1ID2a-HIS SEQ ID NO. 21; mSA-IL-5(C63T/C105T) SEQ ID NO. 19; HIS-GMZ2T:ggsmSA SEQ ID NO. 25; mSA-Her2-ECD
  • mSA-ID1ID2a-HIS SEQ ID NO. 21 mSA-IL-5(C63T/C105T) SEQ ID NO. 19
  • HIS-GMZ2T ggsmSA SEQ ID NO. 25
  • 23-686 SEQ ID NO. 18 AviTag-L1 protein
  • FIG. 4 Transmission electron microscopy of HPV AviTag-L1 virus-like particles coupled with different mSA-antigens (mSA-ID1ID2a-HIS SEQ ID NO. 21; mSA-IL-5(C63T/C105T) SEQ ID NO. 19; HIS-GMZ2T:ggsmSA SEQ ID NO. 25; mSA-Her2-ECD
  • the TEM pictures shows non-aggregated VLPs assembled from biotinylated HPV16 L1-Avi (SEQ ID NO. 2) constructs, respectively.
  • FIG. 5 Verification of self-assembly and subsequent in vitro biotinylation of HPV16 Avi-L1 VLPs
  • HI VLPs HPV16 Avi-L1 VLPs
  • UC ultracentrifugation
  • OptiprepTM iodixanol
  • TEM Transmission-electron microscopy
  • FIG. 6 HPV16 Avi-L1 VLP coupled to mSA-ID1-ID2a analyzed by ultracentrifugation followed by SDS-PAGE, Western blot and TEM analysis a After coupling of the mSA-ID1-ID2a antigen to the HPV16 Avi-L1 VLPs, excess antigen was removed by UC over an OptiprepTM gradient (27%/33%/39%). Reducing SDS-PAGE analysis showed the presence of two protein bands corresponding to the size of HPV16 Avi-L1 (56 kDa) and mSA-VAR2CSA (85 kDa), respectively, in the high-density fractions [4-6] post UC purification.
  • FIG. 7 Other PV VLPs with AviTagTM inserted in DE-loop.
  • HPV16 L1 VLP was used as VLP platform for proof of concept in this study.
  • the AviTagTM can also be inserted into the DE loop of the major capsid protein from other papilloma viruses while retaining the ability to self-assemble into VLPs, as demonstrated in this figure.
  • PAPVE European Elk
  • Purification of HPV118 Avi-L1 and PAPVE Avi-L1 VLPs were performed by UC over an OptiprepTM density gradient (27%/33%/39).
  • FIG. 8 Reactivity of sera from vaccinated mice by ELISA.
  • VAR2CSA-specific immunoglobulin was measured in a serial dilution of mouse anti-sera by ELISA using recombinant VAR2CSA as the solid phase capturing antigen.
  • HRP conjugated anti-mouse Ig antibodies were used for detection by measuring absorbance at OD 490 nm.
  • Serum reactivity from individual mice vaccinated with mSA-VAR2CSA coupled HPV16 Avi-L1 (HI) VLPs (blue) or uncoupled mSA-VAR2CSA (red) are shown after first (a), second (b) and third (c) immunization where each line shows the reactivity of one animal.
  • Green curves represent sera from mice vaccinated with soluble naked VAR2CSA and is a pool of sera obtained after 2 nd and 3 rd bleed.
  • FIG. 9 Display of VAR2CSA on HPV16 L1-AviTag VLPs assessed by parasite inhibition assay.
  • the functional antibody response was assessed by measuring the capacity of mouse anti-sera to inhibit binding between native VAR2CSA expressed on parasitized erythrocytes and CSA in a static binding-assay.
  • the green piles in FIG. 6 c represent anti-sera from mice vaccinated with soluble naked VAR2CSA and is a pool of sera from 2 nd and 3 rd bleed.
  • FIG. 10 Control experiment where unbiotinylated VLPs were mixed with mSA-VAR2CSA. SDS PAGE shows that ultracentrifugation efficiently separated soluble mSA-VAR2CSA from unbiotinylated VLPs.
  • FIG. 11 Immuno-tolerance to a cancer-associated self-antigen “Survivin”.
  • b The same anti-sera in ELISA using the mSA-survivin as the solid phase capturing antigen, showing that the negative control mice did produce antibodies against the ‘foreign’ mSA part.
  • the present invention solves the challenge of conjugating larger proteins (e.g. full length antigens) at high density and in a consistent orientation onto the surface of a VLP, thereby obtaining VLPs presenting densely and repetitive arrays of heterologous epitopes.
  • the solution of the present invention represents a novel approach for making a versatile VLP-based vaccine delivery platform capable of efficiently displaying antigen epitopes and of inducing long-term protective immunity.
  • FIG. 1 b A general aspect of the present invention is illustrated in FIG. 1 b.
  • PV refers to papillomavirus
  • L1 protein refers to the major capsid L1 protein from papillomavirus, which has the ability to spontaneously self-assemble into virus-like particles (VLPs).
  • VLPs virus-like particles
  • the L1 proteins of the present invention are displaying antigens.
  • virus like particle refers to one or several recombinantly expressed viral proteins which spontaneously assemble into macromolecular particulate structures mimicking the morphology of a virus coat, but lacking infectious genetic material.
  • self-assembly refers to a process in which a system of pre-existing components, under specific conditions, adopts a more organised structure through interactions between the components themselves.
  • self-assembly refers to the intrinsic capacity of L1, the major capsid protein of papillomavirus to self-assemble into virus-like particles in the absence of L2 or other papillomavirus proteins, when subjected to specific conditions.
  • the self-assembly process may be sensitive and fragile and may be influenced by factors such as, but not limited to, choice of expression host, choice of expression conditions, and conditions for maturing the virus-like particles.
  • consistent orientation refers to the orientation of the monomeric streptavidin/antigen constructs of the present invention and their spatial orientation to the major capsid protein of papillomavirus (PV L1) of the present invention.
  • PV L1 protein VLP comprising a biotin acceptor site with a biotin molecule enzymatically conjugated to the biotin acceptor site
  • the monomeric streptavidin can only be linked to a single PV L1 protein, thus creating a uniform and/or consistent presentation of said antigen with a consistent orientation.
  • a streptavidin homo-tetramer may crosslink several PV L1 proteins on the surface of a VLP, thus creating an irregular and non-consistent orientation of said antigen.
  • a homo-tetramer streptavidin as a bridging molecule e.g. for conjugating biotinylated antigens onto biotinylated VLPs, since the multiple biotin binding sites will allow cross-linking and aggregation of the biotinylated VLPs.
  • regularly spaced refers to antigens of the present invention which forms a pattern on the surface of a VLP. Such pattern may be symmetric, circle-like, and/or bouquet like pattern of antigens.
  • treatment refers to the remediation of a health problem. Treatment may also be preventive and/or prophylactic or reduce the risk of the occurrence of a disease and/or infection. Treatment may also be curative or ameliorate a disease and/or infection.
  • prophylaxis refers to the reduction of risk of the occurrence of a disease and/or infection. Prophylaxis may also refer to the prevention of the occurrence of a disease and/or infection.
  • loop refers to a secondary structure of a polypeptide where the polypeptide chain reverses its overall direction and may also be referred to as a turn.
  • vaccine cocktail refers to a mixture of antigens administered together.
  • a vaccine cocktail may be administered as a single dose or as several doses administered over a period of time. Time intervals may be, but not limited to administration within the same year, month, week, day, hour and/or minute. Co-vaccination and vaccine cocktail may be used interchangeably.
  • self-antigens refers to endogenous antigens that have been generated within previously normal cells as a result of normal cell metabolism, or because of viral or intracellular bacterial infection.
  • biotin acceptor site refers to a peptide sequence capable of binding a biotin molecule.
  • Biotin acceptor site and AviTag are interchangeably used herein.
  • sequence variant refers to a polypeptide and/or polynucleotide sequence with at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to said polypeptide and/or polynucleotide sequence.
  • VLPs virus-like particles
  • Envelope or Capsid proteins can result in the self-assembly of virus-like particles (VLPs).
  • VLPs resemble viruses, but are non-infectious as they do not contain any viral genetic material.
  • active immunization VLPs have proven highly immunogenic and provide a safer alternative to attenuated viruses since they lack genetic material.
  • VLPs are a useful tool for the development of vaccines and can be used as molecular scaffolds for efficient antigen epitope display. This has been achieved by either genetic insertion or by chemical conjugation approaches. However, it has generally not been possible to incorporate peptides longer than 20 amino acids without disrupting the self-assembly process of the chimeric VLP.
  • the present invention concerns a vaccine for use in the prophylaxis and/or treatment of a disease wherein the vaccine comprises:
  • the PV L1 protein containing a biotin acceptor site is able to form a virus like particle.
  • the inventors of the present invention have demonstrated formation of VLP's using insect cells, such as High Five of Sf9 cells incubated at 28° C. In vitro maturation may occur for 18-24 hours at 30° C.-37° C. Other conditions and expression hosts (such as Pichia Pastoris ) may work as well.
  • the antigen is capable of eliciting an immune reaction in an animal, such as a mammal, such as a cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, most preferably such as a human being; or bird such as a chicken, or fish such as a Salmon.
  • a mammal such as a cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, most preferably such as a human being; or bird such as a chicken, or fish such as a Salmon.
  • an antigen display scaffold comprising an assembled virus-like particle comprising:
  • Another aspect of the present invention relates to a method of producing a non-naturally occurring, ordered and repetitive antigen array comprising
  • the present invention is a novel, generic, and easy-to-use-approach to conjugate various antigens to a VLP.
  • the VLP-based vaccines of the present invention can be used for prophylaxis and/or treatment of a wide range of diseases.
  • the diseases which the present invention may be used for prophylaxis and/or treatment of include but are not limited to cancers, cardiovascular diseases, allergic diseases, and/or infectious diseases.
  • an antigen which is associated with at least one cancer disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the present VLP vaccine may be used for prophylaxis and/or treatment of the cancer and/or cancers which the antigen is associated with.
  • an antigen which is associated with at least one cardiovascular disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the present VLP vaccine can be used for prophylaxis and/or treatment of the cardiovascular disease and/or cardiovascular diseases which the antigen is associated with.
  • an antigen which is associated with at least one allergic disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the present VLP vaccine can be used for prophylaxis and/or treatment of the allergic disease and/or allergic diseases which the antigen is associated with.
  • an antigen which is associated with at least one infectious disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the present VLP vaccine can be used for prophylaxis and/or treatment of the infectious disease and/or infectious diseases which the antigen is associated with.
  • table 1 A non-exhaustive list of antigens which may be used by the present invention is outlined in table 1 and table 2.
  • table 1 show examples of specific diseases the antigens are associated with as well as examples of patient groups which may be in need of prophylaxis and/or treatment using the antigen-VLP vaccines of the present invention.
  • the disclosed antigens may as well be relevant for the use in other patient groups and/or against other specific or related diseases. In an embodiment at least two such as three, four, and/or five antigens may be combined.
  • the vaccine of the present invention may as well be used against other diseases and/or use other antigens.
  • the medical indication is selected from the group consisting of a cancer, a cardiovascular disease, an allergy, and/or an infectious disease.
  • the medical indication is an allergy.
  • the medical indication is a cardiovascular disease.
  • the medical indication is a cancer.
  • the antigen is a polypeptide, peptide and/or an antigenic fragment of a polypeptide associated with an abnormal physiological response such as a cardiovascular disease and/or an allergic reaction/disease.
  • an abnormal physiological response such as a cardiovascular disease and/or an allergic reaction/disease.
  • the abnormal physiological response is a cancer.
  • the antigen is a protein, peptide and/or an antigenic fragment associated with a medical indication disclosed in the present invention.
  • cancer cells One characteristic of cancer cells is abnormal expression levels of genes and proteins.
  • HER2 One example of a cancer associated gene is HER2, which is overexpressed in 20% of all breast cancers and is associated with increased metastatic potential and poor patient survival.
  • cancer cells express cancer associated antigens in a way that immunologically distinguishes them from normal cells, most cancer associated antigens are only weakly immunogenic because most cancer associated antigens are “self” proteins which are generally tolerated by the host.
  • the present invention has solved this problem by an effective antigen-VLP based vaccine which is capable of activating the immune system to react against for example cancer associated antigens and overcome the immunological tolerance to such antigens.
  • Different cancers are characterized by having different cancer associated antigens. Survivin is regarded to be overexpressed in most cancer cells and could also be used in the present invention. Therefore the present invention may be used in treatment/prophylaxis of most types of cancers that overexpress a tumor associated antigen.
  • the antigen is linked to the PV L1 protein of the present invention via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein (see FIG. 1 b for the general concept of the present invention).
  • the present invention provides effective antigen-VLP based vaccine which is capable of activating the immune system to react against for example cancer associated antigens and overcome immunological tolerance to such antigens.
  • the VLP vaccine of the present invention can be used for prophylaxis and/or treatment of the cancer which the antigen is associated with.
  • An embodiment of the present invention comprises a cancer associated antigen linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the present VLP vaccine can be used for prophylaxis and/or treatment of the cancer which the antigen is associated with.
  • the present invention is used in treatment/prophylaxis of any type of cancer which overexpresses an antigen.
  • the type of cancer which the invention may be used against is determined by the choice of antigen.
  • the vaccine of the present invention comprises an oncovirus associated antigen linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the present vaccine can be used for prophylaxis and/or treatment of the cancer which the antigen is associated with.
  • the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with a cancer selected from the group comprising of Adrenal Cancer, Anal Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain/CNS Tumors in adults, Brain/CNS Tumors In Children, Breast Cancer, Breast Cancer In Men, Cancer in Adolescents, Cancer in Children, Cancer in Young Adults, Cancer of Unknown Primary, Castleman Disease, Cervical Cancer, Colon/Rectum Cancer, Endometrial Cancer, Esophagus Cancer, Ewing Family Of Tumors, Eye Cancer, Gallbladder Cancer, Gastrointestinal Carcinoid Tumors, Gastrointestinal Stromal Tumor, Gestational Trophoblastic Disease, Hodgkin Disease, Kaposi Sarcoma, Kidney Cancer, Laryngeal and Hypopharyngeal Cancer, Leukemia, Acute Lymphocytic in Adults, Leukemia, Acute Myeloid Leukemia, Chronic Lymphocytic
  • the cancer is selected from the group consisting of breast cancer, gastric cancer, ovarian cancer, and uterine serous carcinoma.
  • VLP2 Linking the Her2/Neu (ERBB2) and/or Survivin or an antigenic fragment hereof to the VLP forms a VLP based vaccine which is capable of activating the immune system to react against for example cells with high Her2/Neu (ERBB2) and/or Survivin expression and overcome immunological tolerance.
  • the Her2/Neu (ERBB2) and/or Survivin VLP vaccine of the present invention can be used for prophylaxis and/or treatment of the herein disclosed cancer disease and/or other cancer diseases. Using a similar reasoning other cancer disease associated antigen-VLP based vaccines may be used against any cancer disease.
  • the antigen of the present invention is Her2/Neu (ERBB2) and/or Survivin or an antigenic fragment hereof, wherein the antigen is associated with and directed against at least one of the herein disclosed types of cancers.
  • ERBB2 Her2/Neu
  • Survivin or an antigenic fragment hereof wherein the antigen is associated with and directed against at least one of the herein disclosed types of cancers.
  • the present invention concerns a vaccine for use in the prophylaxis and/or treatment of one of the herein disclosed cancers wherein the vaccine comprises:
  • the antigen fused to a monovalent streptavidin is selected from the group comprising SEQ ID NO: 18, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, and/or SEQ ID NO: 47 and/or a sequence variant hereof.
  • the present invention may be used in treatment/prophylaxis of most types of cardiovascular diseases.
  • the type of cardiovascular disease which the invention may be used against is decided by the choice of antigen.
  • the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with a disease selected from the group comprising a lipid disorder such as hyperlipidemia, type I, type II, type III, type IV, or type V hyperlipidemia, secondary hypertriglyceridemia, hypercholesterolemia, familial hypercholesterolemia, xanthomatosis, cholesterol acetyltransferase deficiency, an ateriosclerotic condition (e.g., atherosclerosis), a coronary artery disease, a cardiovascular disease, and Alzheimer's disease.
  • a lipid disorder such as hyperlipidemia, type I, type II, type III, type IV, or type V hyperlipidemia, secondary hypertriglyceridemia, hypercholesterolemia, familial hypercholesterolemia, xanthomatosis, cholesterol acetyltransferase deficiency, an ateriosclerotic condition (e.g., atherosclerosis), a coronary artery
  • the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with a cardiovascular disease.
  • the cardiovascular disease is selected from the group consisting of dyslipidemia, atherosclerosis, and hypercholesterolemia.
  • PCSK9 which acts in cholesterol homeostasis.
  • Blockage of PCSK9 has medical significance and can lower the plasma and/or serum low-density lipoprotein cholesterol (LDL-C) levels. Reducing LDL-C reduces the risk of for example heart attacks.
  • LDL-C serum low-density lipoprotein cholesterol
  • PCSK9-VLP based vaccine which is capable of activating the immune system to react against for example cells with high PCSK9 expression and overcome immunological PCSK9 tolerance, thereby lowering the LDL-C levels and the risk of heart attacks.
  • the PCSK9-VLP vaccine of the present invention can be used for prophylaxis and/or treatment of the herein disclosed cardiovascular disease and/or other cardiovascular diseases. Using a similar reasoning other cardiovascular disease associated antigen-VLP based vaccines may be used against any cardiovascular disease.
  • the antigen comprises PCSK9 or an antigenic fragment hereof, wherein the antigen is associated with and directed against at least one of the herein disclosed cardiovascular disease and/or other cardiovascular diseases.
  • the present invention concerns a vaccine for use in the prophylaxis and/or treatment of at least one of the herein disclosed cardiovascular diseases wherein the vaccine comprises:
  • the antigen fused to a monovalent streptavidin comprise SEQ ID NO: 20 and/or a sequence variant hereof.
  • Interleukin 5 has been shown to play an instrumental role in eosinophilic inflammation in various types of allergies, including severe eosinophilic asthma. Eosinophils are regulated in terms of their recruitment, activation, growth, differentiation and survival by IL-5 which, consequently, has identified this cytokine as a primary target for therapeutic interventions. Linking an IL-5 antigen or a fragment hereof to the VLP of the present invention forms an IL-5-VLP based vaccine which is capable of activating the immune system to react against IL-5. Consequently an IL-5-VLP based vaccine described in the present invention may be used in the treatment/prophylaxis of eosinophilic asthma or allergy.
  • asthma or allergy disease may be used by the present invention using a similar reasoning.
  • the type of asthma or allergy disease which the invention may be used against is decided by the choice of antigen.
  • the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with one or more asthma or allergy diseases disclosed herein.
  • the asthma or allergy is selected from the group consisting of eosinophilic asthma, allergy, nasal polyposis, atopic dermatitis, eosinophilic esophagitis, hypereosinophilic syndrome, and Churg-Strauss syndrome.
  • the antigen comprises IL-5 or an antigenic fragment hereof, wherein the antigen is associated with and directed against at least one of the herein disclosed asthma or allergy diseases and/or other asthma or allergy diseases.
  • the present invention concerns a vaccine for use in the prophylaxis and/or treatment of one of the herein disclosed asthma or allergy diseases wherein the vaccine comprises:
  • the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 19 and/or a sequence variant hereof.
  • Tuberculosis and malaria are two major infectious diseases. In 2012, an estimated 207 million cases of malaria occurred which resulted in more than 500.000 deaths. Also in 2012, an estimated 8.6 million people developed tuberculosis and 1.3 million died from the disease. The current methods of treatment are insufficient and some have resulted in drug resistance. Consequently there is a need for new and efficient drugs for treatment/prophylaxis of tuberculosis and malaria.
  • Linking a malaria or tuberculosis associated-antigen or a fragment hereof to the VLP of the present invention forms a VLP based vaccine which is capable of activating the immune system to react against for example malaria or tuberculosis.
  • the present invention may be used in treatment/prophylaxis of most infectious disease.
  • the type of infectious disease which the invention may be used against is decided by the choice of antigen.
  • the antigen fused to the monovalent streptavidin of the present invention is a protein or peptide or an antigenic fragment of a polypeptide associated with an infectious disease such as tuberculosis and/or malaria.
  • an antigen from Plasmodium falciparum is fused to the monovalent streptavidin of the present invention for use in treatment/prophylaxis of malaria.
  • an antigen from Mycobacterium tuberculosis is fused to the monovalent streptavidin of the present invention for use in treatment/prophylaxis of tuberculosis.
  • the antigen is selected from the group consisting of Ag85A from Mycobacterium tuberculosis , PfRH5 from Plasmodium falciparum , VAR2CSA (domain, ID1-ID2a) from Plasmodium falciparum , CIDR1a domain, of PfEMP1 from Plasmodium falciparum , GLURP from Plasmodium falciparum , MSP3 from Plasmodium falciparum , Pfs25 from Plasmodium falciparum , CSP from Plasmodium falciparum , and PfSEA-1 from Plasmodium falciparum or an antigenic fragment of the disclosed antigens.
  • the antigen comprises a fusion construct between MSP3 and GLURP (GMZ2) from Plasmodium falciparum.
  • the antigen of the present invention comprises a protein, or an antigenic fragment hereof, from the pathogenic organism which causes the infectious disease.
  • the present invention concerns a vaccine for use in the prophylaxis and/or treatment of one of the herein disclosed infectious diseases wherein the vaccine comprises:
  • the antigen is VAR2CSA and the vaccine is for use in the prophylaxis and/or treatment of placental malaria.
  • the antigen is surviving and the vaccine is for use in the prophylaxis and/or treatment of cancer.
  • the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28 and/or a sequence variant hereof.
  • the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 21.
  • the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 24.
  • the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 28.
  • Active vaccination by delivering small doses of an antigen into a subject, is a way to activate a subject's immune system to develop adaptive immunity to the antigen. This allows a subjects body to react quickly and efficiently to future exposures.
  • An aspect of the invention relates to a method for inducing an immune response in a subject, the method comprising the steps of
  • Another aspect of the present invention relates to a method of immunizing a subject in need thereof, said method comprises the steps of:
  • Another aspect of the present invention relates to a method for obtaining a strong and long-lasting immune response in a subject in need thereof, said method comprising the steps of:
  • the method of inducing an immune response in a subject, immunizing a subject in need thereof, and/or obtaining a strong and long-lasting immune response further comprising at least one booster vaccine and/or a second active ingredient.
  • VLP virus-like particles
  • FIG. 1 b An important element of the present VLP based vaccine is the major capsid L1 protein from papillomavirus (PV), which has the ability to spontaneously self-assemble into virus-like particles (VLPs).
  • PV papillomavirus
  • FIG. 1 b The use of papillomavirus L1 proteins in the present invention is illustrated in FIG. 1 b .
  • Several hundred species of papillomaviruses traditionally referred to as “types”, are known to infect most mammals, as well as birds, snakes, and turtles.
  • the major capsid protein L1 from most papillomavirus, capable of forming a VLP may be used to carry out the present invention.
  • the PV L1 protein of the present invention is from a mammal such as but not limited to: Alces genus, Homo sapiens , cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, and chicken.
  • the PV L1 protein of the present invention is from the human PV genotype 16 and/or 118. In yet a particular embodiment the PV L1 protein is from the Alces alces.
  • Biotin acceptor site and its position in the PV L1 protein The biotin acceptor site of the present invention comprises a sequence of 15 amino acids encoded by a polynucleotide sequence. It is extremely difficult, if not impossible, to predict the consequence of modifications to VLP forming proteins, such as PV L1 proteins. Such modifications often lead to disruption of the delicate and sensitive self-assembly process of the VLPs. Successful modification of the VLP forming process is at least dependent on three factors 1) the amino acid sequence of the biotin acceptor site, 2) the insertion site, and 3) deletion/removal of amino acid residues to make room for the biotin acceptor site. The inventors have demonstrated several successful modifications to PV L1 loops without disrupting the delicate self-assembly process.
  • biotin acceptor site is fused into a loop of the PV L1 protein.
  • the present invention concerns a vaccine for use in the prophylaxis and/or treatment of a disease wherein the vaccine comprises:
  • the loop is selected from the group consisting of the DE-loop, and the HI-loop of the PV L1 protein.
  • the PV L1 protein starts with a methionine residue which is cleaved off after translation.
  • the positions given in the present disclosure are numbered using the first numbering, i.e. where the methionine is counted.
  • biotin acceptor site is inserted into the HI-loop of the L1 protein from the human PV genotype 16 at position 351/352 (SEQ ID NO: 2). In another embodiment the biotin acceptor site, is inserted into the H4-loop of the L1 protein from the human PV genotype 16 at position 431/432 (SEQ ID NO: 1). In an embodiment the biotin acceptor site is inserted into the HI-loop of the L1 protein from the human PV genotype 118 at position 360/365 where the residues 361-364 (AGKI) are deleted (SEQ ID NO: 6). In a most preferred embodiment the biotin acceptor site is inserted into the DE-loop of the L1 protein from the human PV genotype 16 at position 134/139 where the residues 135-137 (YAAN) are deleted (SEQ ID NO: 3).
  • the PV L1 protein containing the biotin acceptor site comprises the amino acid sequences selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 2, and SEQ ID NO: 6 or a biologically active sequence variant that has at least 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to any of the herein disclosed PV L1 proteins containing the biotin acceptor site sequences.
  • biological active is meant the ability to form a virus like particle.
  • biotin acceptor site of the present invention comprises the amino acid sequence GLNDIFEAQKIEWHE (SEQ ID NO 36).
  • VLPs of the present invention are made by enzymatic biotinylation.
  • Enzymatic biotinylation ensures that only a single biotin molecule is conjugated to each L1 in the VLP thus controlling the overall ratio/stoichiometry and placement of VLP proteins and biotin molecules. This control will enable display of an antigen at high density i.e. in theory one antigen per L1 protein, while being regularly spaced, and with consistent orientation on the surface of the VLPs of the present invention.
  • the biotin molecule is enzymatically conjugated to the biotin acceptor site.
  • the biotin molecule is enzymatically conjugated to the biotin acceptor site by a biotin ligase from a prokaryote, such as from a bacteria, such as from E. coli .
  • the biotin ligase is in a preferred embodiment BirA from E. coli.
  • Streptavidin from Streptomyces avidinii forms streptavidin homo-tetramers and binds up to four biotin molecules.
  • the monovalent streptavidin of the present invention forms monomers and binds a single biotin molecule.
  • the monovalent streptavidin ensures a uniform presentation of said antigens.
  • Using monovalent streptavidin further ensures control of the overall amount/stoichiometry as well as the orientation of the coupled antigen.
  • This control will enable display of an antigen at high density, while being regularly spaced, and with consistent orientation on the surface of a VLP, thus solving three major critical factors for obtaining prober activation of the immune system.
  • a streptavidin homo-tetramer may crosslink several PV L1 proteins on the surface of a VLP, thus creating an irregular presentation of said antigen, which may hamper the immune response of an antigen. It is thus an aspect of the present invention to use monovalent streptavidin fused to the antigen for linking the antigen to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • the monovalent streptavidin used by the present invention comprises or consists of the amino acid sequence of SEQ ID NO: 37.
  • each antigen is presented in immediate continuation of each PV L1 protein in a consistent orientation.
  • the ratio of PV L1 protein:biotin molecule:antigen is 1:1:1.
  • Changing the position where the monomeric streptavidin tag is fused to the antigen will allow changing the orientation of the antigen. This may be performed to enable the best possible display of the most immunogenic epitopes of the antigen. The best possible orientation may be different from antigen to antigen.
  • the antigen fused to a monovalent streptavidin further comprises a tag.
  • tags may be used for purification techniques known to the skilled person.
  • the tag may be selected from the group comprising polyhistidine tag, Calmodulin-tag, polyglutamate tag, E-tag, FLAG-tag, HA-tag, Myc-tag, S-tag, SBP-tag, Softag 1, Softag 3, Strep-tag, Strep-tag II, TC tag, V5 tag, VSV-tag, and Xpress tag.
  • Other peptide or non-peptide tags may be used instead or in combination with the above mentioned peptide tags.
  • the tag is a polyhistidine tag, such as a 4 ⁇ His, 5 ⁇ His, 6 ⁇ His, 7 ⁇ His, 8 ⁇ His, 9 ⁇ His, or 10 ⁇ His tag.
  • the monovalent streptavidin is fused to the antigen in any position. In another embodiment the monovalent streptavidin is fused to the antigen in the N-terminal, C-terminal, and/or is fused to the antigen into the coding sequence of the antigen.
  • a person of skill will know how to fuse the antigen and the monovalent streptavidin, without introducing stop-codons or causing frame shift or any other mutations.
  • a vector is a DNA molecule used as a vehicle to artificially carry foreign genetic material into a cell, where it can be replicated and/or expressed.
  • the four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes.
  • the vector itself is generally a DNA sequence that consists of an insert (transgene) and a larger sequence that serves as the “backbone” of the vector.
  • the purpose of a vector which transfers genetic information to another cell is typically to isolate, multiply, or express the insert in the target cell.
  • Expression vectors (expression constructs) specifically are for the expression of transgenes in target cells, and generally have a promoter sequence that drives expression of the transgene.
  • the heterologous expression/production of the vaccine of the present invention comprises 3 peptide components 1) a PV L1 protein containing a biotin acceptor site 2) a biotin ligase capable of biotinylating the biotin acceptor site, and 3) an antigen fused to a monovalent streptavidin.
  • each of the peptide components are encoded by a polynucleotide sequence and each of the polynucleotide sequences may be expressed on one, two, or three different plasmids.
  • one aspect of the present invention is a vector comprising at least one polynucleotide encoding
  • the vector comprises at least two, such as at least three polynucleotides of the following polypeptides:
  • PV L1 protein containing the biotin acceptor site is encoded by a polynucleotide sequence comprising:
  • the PV L1 protein containing the biotin acceptor site is encoded by a polynucleotide sequence comprising:
  • biotin acceptor site comprises the nucleotide sequence SEQ ID NO: 39.
  • Another aspect of the present invention relates to polynucleotide sequences encoding
  • the invention further relates to a host cell comprising a polynucleotide and/or a vector.
  • the polynucleotide may have a sequence that is codon-optimised. Codon optimisation methods are known in the art and allow optimised expression in a heterologous host organism or cell.
  • the host cell may be selected from the group comprising bacteria, yeast, fungi, plant, mammalian and/or insect cells.
  • Methods for expressing a first polypeptide: a PV L1 protein containing a biotin acceptor site, and/or a second polypeptide; a biotin ligase, capable of biotinylating the biotin acceptor site, and/or a third polypeptide: an antigen fused to a monovalent streptavidin in a host cell are known in the art.
  • the first, second or third polypeptide may be heterologously expressed from corresponding polynucleotide sequences cloned into the genome of the host cell or they may be comprised within a vector.
  • a first and/or second and/or third polynucleotide coding for the first and/or second and/or third polypeptide is cloned into the genome, and a first and/or second and/or third polynucleotide coding for the first and/or second and/or third polypeptide is comprised within a vector transformed or transfected into the host cell.
  • the first and/or second and/or third polynucleotide is comprised within a first vector and the first and/or second and/or third polynucleotide is comprised within a second vector and the first and/or second and/or third is comprised within a third vector.
  • Expression of the first, second, and third polypeptides in the host cell may occur in a transient manner.
  • an inducible promoter may be cloned as well to control expression of the polypeptides.
  • inducible promoters are known in the art.
  • genes coding for suppressors of gene silencing may also be cloned into the genome or into a vector transfected within the host cell.
  • the host cell may be selected from the group comprising Escherichia coli, Spodoptera frugiperda (sf9), Trichoplusia ni (BTI-TN-5B1-4), Pichia Pastoris, Saccharomyces cerevisiae, Hansenula polymorpha, Drosophila Schneider 2 (S2), Lactococcus lactis , Chinese hamster ovary (CHO), Human Embryonic Kidney 293, Nicotiana tabacum cv. Samsun NN and Solanum tuberosum cv. Solara.
  • the host cell is Escherichia coli .
  • the host cell is Spodoptera frugiperda .
  • the host cell is Pichia Pastoris .
  • the host cell is Saccharomyces cerevisiae .
  • the host cell is Hansenula polymorpha .
  • the host cell is Drosophila Schneider 2.
  • the host cell is Lactococcus lactis .
  • the host cell is Chinese hamster ovary (CHO).
  • the host cell is Human Embryonic Kidney 293.
  • the host cell is Trichoplusia ni (BTI-TN-5B1-4).
  • the host cell is Nicotiana tabacum cv. Samsun NN.
  • the host cell is Solanum tuberosum cv. Solara.
  • the present invention relates to a host cell expressing at least one polypeptide encoded by any of the polynucleotides disclosed by the present invention.
  • the host cell expresses
  • VLP's using insect cells, such as High Five ( Trichoplusia ni ) of Sf9 cells incubated at 28° C. Other conditions and expression hosts may work as well.
  • Trichoplusia ni cells are used as host cell for expression of any of the disclosed polynucleotides and/or polypeptides.
  • Trichoplusia ni cells are used to express a polypeptide having a sequence at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% identical any of the polypeptides disclosed herein.
  • composition comprising the Vaccine
  • the vaccine of the present invention is to be used in the prophylaxis and/or treatment of a disease.
  • a composition comprising the vaccine of the present invention.
  • Such compositions may further comprise for example an adjuvant, a buffer, and/or salts or a combination hereof.
  • an adjuvant is a pharmacological and/or immunological agent that modifies the effect of other agents.
  • Adjuvants may be added to a vaccine to modify the immune response by boosting it such as to give a higher amount of antibodies and/or a longer lasting protection, thus minimizing the amount of injected foreign material.
  • Adjuvants may also be used to enhance the efficacy of a vaccine by helping to subvert the immune response to particular cell types of the immune system, for example by activating the T cells instead of antibody-secreting B cells dependent on the type of the vaccine.
  • the composition comprises at least one adjuvant.
  • the adjuvant is aluminium based. Alluminumum adjuvants may be aluminum phosphate, aluminum hydroxide, amorphous aluminum hydroxyphosphate sulfate and/or a combination hereof. Other adjuvants may be included as well.
  • composition described above comprises at least one buffer.
  • the buffer is PBS and/or histidine based.
  • the buffer has a pH between pH 6-pH 7.5.
  • the buffer is isotonic such as has 0.6%-1.8% NaCl.
  • An emulsifier (also known as an “emulgent”) is a substance that stabilizes an emulsion by increasing its kinetic stability.
  • One class of emulsifiers is known as “surface active agents”, or surfactants.
  • Polysorbates are a class of emulsifiers used in some pharmaceuticals and food preparation. Common brand names for polysorbates include Alkest, Canarcel, and Tween. Some examples of polysorbates are Polysorbate 20, Polysorbate 40, Polysorbate 60, Polysorbate 80.
  • the composition of the present invention comprises an emulsifier such as one of the above described polysorbates. In a particular embodiment the composition comprises 0.001-0.02% polysorbate 80. Other polysorbates or emulsifiers may be used in the present invention as well.
  • the vaccine of the present invention is intended to be used in the prophylaxis and/or treatment of a disease. Accordingly, the present invention further provides a pharmaceutical formulation, which comprises the vaccine of the present invention and a pharmaceutically acceptable carrier therefor.
  • the pharmaceutical formulations may be prepared by conventional techniques, e.g. as described in Remington: The Science and Practice of Pharmacy 2005, Lippincott, Williams & Wilkins.
  • the pharmaceutically acceptable carriers can be either solid or liquid.
  • Solid form preparations include powders, tablets, pills, capsules, cachets, suppositories, and dispersible granules.
  • a solid carrier can be one or more excipients which may also act as diluents, flavoring agents, solubilizers, lubricants, suspending agents, binders, preservatives, wetting agents, tablet disintegrating agents, or an encapsulating material.
  • solid form preparations which are intended to be converted, shortly before use, to liquid form preparations for oral administration.
  • liquid forms include solutions, suspensions, and emulsions.
  • These preparations may contain, in addition to the active component, colorants, flavors, stabilizers, buffers, artificial and natural sweeteners, dispersants, thickeners, solubilizing agents, and the like.
  • the compounds of the present invention may be formulated for parenteral administration and may be presented in unit dose form in ampoules, pre-filled syringes, small volume infusion or in multi-dose containers, optionally with an added preservative.
  • the compositions may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, for example solutions in aqueous polyethylene glycol.
  • oily or non-aqueous carriers, diluents, solvents or vehicles include propylene glycol, polyethylene glycol, vegetable oils, and injectable organic esters, and may contain agents such as preserving, wetting, emulsifying or suspending, stabilizing and/or dispersing agents.
  • the formulation will comprise about 0.5% to 75% by weight of the active ingredient(s) with the remainder consisting of suitable pharmaceutical excipients as described herein.
  • the vaccine of the invention may be administered concurrently, simultaneously, or together with a pharmaceutically acceptable carrier or diluent, especially and preferably in the form of a pharmaceutical composition thereof, whether by oral, rectal, or parenteral (including subcutaneous) route, in an effective amount.
  • one aspect of the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a vaccine.
  • Such pharmaceutical composition may comprise an adjuvant, a buffer, and/or salts or a combination hereof.
  • the pharmaceutical composition further comprises a composition comprising a vaccine as described by the present invention.
  • the present invention further relates to a method of manufacturing a pharmaceutical composition comprising a vaccine.
  • the VLP based vaccine of the present invention may at least be manufactured by the following steps:
  • steps may be included for example a) isolation/purification of the VLP to yield a high purity/quality product. This will be accomplished using different techniques for protein purification. For this purpose several separation steps will be carried out using the differences in for instance protein size, physico-chemical properties, binding affinity or biological activity b) formulation by adding stabilizers to prolong the storage life or preservatives to allow multi-dose vials to be used safely as needed c) all components that constitute the final vaccine are combined and mixed uniformly e.g. in a single vial or syringe d) the vaccine is put in recipient vessel (e.g. a vial or a syringe) and sealed with sterile stoppers.
  • recipient vessel e.g. a vial or a syringe
  • the main routes of administration are oral and parenteral in order to introduce the agent into the blood stream to ultimately target the sites of desired action.
  • Appropriate dosage forms for such administration may be prepared by conventional techniques.
  • Oral administration is normally for enteral drug delivery, wherein the agent is delivered through the enteral mucosa.
  • Parenteral administration is any administration route not being the oral/enteral route whereby the medicament avoids first-pass degradation in the liver. Accordingly, parenteral administration includes any injections and infusions, for example bolus injection or continuous infusion, such as intravenous administration, intramuscular administration, subcutaneous administration. Furthermore, parenteral administration includes inhalations and topical administration.
  • the agent may be administered topically to cross any mucosal membrane of an animal to which the biologically active substance is to be given, e.g. in the nose, vagina, eye, mouth, genital tract, lungs, gastrointestinal tract, or rectum, preferably the mucosa of the nose, or mouth, and accordingly, parenteral administration may also include buccal, sublingual, nasal, rectal, vaginal and intraperitoneal administration as well as pulmonal and bronchial administration by inhalation or installation. Also, the agent may be administered topically to cross the skin.
  • the subcutaneous and intramuscular forms of parenteral administration are generally preferred.
  • the agent according to the invention may be used as a local treatment, ie. be introduced directly to the site(s) of action as will be described below.
  • one agent may be applied to the skin or mucosa directly, or the agent may be injected into the diseased tissue or to an end artery leading directly to the diseased tissue.
  • Another aspect of the present invention relates to a method of administering a vaccine to treat and/or prevent a clinical condition in a subject in need thereof, comprising the steps of
  • a preferred embodiment relates to a method of administering a vaccine to treat and/or prevent cancer, as disclosed herein, in a subject in need thereof, comprising the steps of
  • a preferred embodiment relates to a method of administering a vaccine to treat and/or prevent a cardiovascular disease, as disclosed herein, in a subject in need thereof, comprising the steps of
  • the vaccine of the present invention is administered by any type of injections or infusions selected from the group of bolus injection, continuous infusion, intravenous administration, intramuscular administration, subcutaneous administration, inhalation or topical administration or a combination hereof.
  • the vaccine is administered by intramuscular administration and/or intravenous administration.
  • a booster dose is an extra administration of a vaccine after an earlier dose. After initial immunization, a booster injection or booster dose is a re-exposure to the immunizing antigen cell. It is intended to increase immunity against that antigen back to protective levels after it has been shown to have decreased or after a specified period.
  • the vaccine of the present invention is administered any number of times from one, two, three, four times or more.
  • the vaccine is boosted by administration in a form and/or body part different from the previous administration.
  • the vaccine is administered to the area most likely to be the receptacle of a given disease or infection which the vaccine is intended to prevent/reduce the risk of.
  • the recipient of the vaccine (the subject) of the present invention is an animal, for example a mammal, such as a Homo sapiens , cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, and/or chicken.
  • the subject is a Homo sapiens.
  • Administration of more than one vaccine is known in the art and refers to this concept as co-vaccination or to give a vaccine cocktail.
  • the vaccine is co-administered with any other vaccine.
  • the vaccine forms a part of a vaccine cocktail.
  • kit of parts comprises a second active ingredient or vaccine component for therapeutic use in the treatment or prevention of one or more of the diseased disclosed in the present invention.
  • the vaccine of the invention is administered separate, sequential, or simultaneously with at least one other pharmaceutical active ingredient and/or vaccine component.
  • the dosage requirements will vary with the particular drug composition employed, the route of administration and the particular subject being treated. It will also be recognized by one of skill in the art that the optimal quantity and spacing of individual dosages of a compound will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the particular patient being treated, and that such optimums can be determined by conventional techniques. It will also be appreciated by one of skill in the art that the optimal course of treatment, i.e., the number of doses of a compound given per day for a defined number of days, can be ascertained using conventional course of treatment determination tests.
  • the daily oral dosage regimen will preferably be from about 0.01 to about 80 mg/kg of total body weight.
  • the daily parenteral dosage regimen about 0.001 to about 80 mg/kg of total body weight.
  • the daily topical dosage regimen will preferably be from 0.1 mg to 150 mg, administered one to four, preferably two or three times daily.
  • the daily inhalation dosage regimen will preferably be from about 0.01 mg/kg to about 1 mg/kg per day.
  • unit dosage form refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of a compound, alone or in combination with other agents, calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier, or vehicle.
  • the specifications for the unit dosage forms of the present invention depend on the particular compound or compounds employed and the effect to be achieved, as well as the pharmacodynamics associated with each compound in the host.
  • the dose administered should be an “effective amount” or an amount necessary to achieve an “effective level” in the individual patient.
  • the actual dose and schedule can vary, depending on inter-individual differences in pharmacokinetics, drug distribution, age, gender, size, health and metabolism.
  • the “effective level” can be defined, for example, as the blood or tissue level desired in the patient that corresponds to a concentration of one or more compounds according to the invention.
  • VLPs without disrupting the delicate and sensitive self-assembly process
  • the inventors have below shown several examples of successful introduction of a biotin acceptor site into various VLP loops without disrupting the self-assembly process.
  • the inventors have shown enzymatic biotinylation of the biotin acceptor site as well as coupled several antigen/monovalent streptavidin fusion proteins to the VLPs. Immunological testing of the VLP vaccines have been initiated.
  • the examples below are non-limiting to the scope of the invention.
  • the chimeric HPV16 Avi-L1 gene sequences were constructed by insertion of the biotin acceptor sequence (AviTagTM), GLNDIFEAQKIEWHE, into the DE- (aa positions 134-139), FG- (aa positions 279-286), HI- (aa positions 351-352) or H4- ⁇ J coil (aa positions 431-432) after having deleted any intervening amino acids (HPV16 L1 accession number DQ155283.1).
  • Gene sequences were further modified to contain an EcoRV restriction site followed by a polyhedrin promotor sequence at the N-terminus and a stop-codon followed by a NotI restriction site at the C-terminus.
  • the synthetic gene sequences were finally codon-optimized for recombinant expression in Trichoplusia ni cells and synthesized by Geneart (Life Technologies).
  • HPV16 Avi-L1 gene fragments were cloned into the EcoRV/NotI sites of the pAcGP67A vector (BD Biosciences) deleting the gp67 secretion signal sequence.
  • linearized BakPak viral DNA (BD Biosciences) was co-transfected with pAcGP67A/Avi-L1 into Sf9 insect cells using Lipofectamine 2000 10 Reagent (Invitrogen, 11668-019) and incubated at 28° C. for 3-5 days.
  • Recombinant Baculovirus was harvested from the supernatant and used to generate a high-titer virus stock, which was used for infection of High-Five insect cells.
  • Infected High-Five cells were incubated for 48 hours at 28° C. with shaking.
  • In vitro maturation and purification of HPV16 Avi-L1 VLPs were performed as previously described (Buck et al., 2005, Buck et al., 2007).
  • cell lysates were harvested and VLPs were allowed to mature in maturation-buffer (0.5% Triton-X-100, 0.1% Benzonase® Nuclease (Sigma-Aldrich), 25 mM (NH 4 ) 2 SO 4 and 4 mM MgCl 2 ) for 18 h at 37° C.
  • VLPs were subsequently purified by ultracentrifugation through an OptiprepTM step gradient (27%/33%/39%) as previously described (22).
  • VLPs were dialyzed in PBS (0.02% PS80) and incubated for 30 min at 30° C. with biotin and Biotin ligase (BirA) according to instructions from Avidity (Aurora, Colo.). Excess biotin was removed by dialysis in PBS (0.32 M NaCl, 0.02% PS80) and protein concentration was determined using BCA analysis.
  • Heterologous vaccine antigens were genetically fused with a GGS linker at either their C- or N-terminus to a previously described (refs)/patented (U.S. Pat. No. 8,586,708 B2) engineered monovalent streptavidin (mSA) (SEQ ID NO: 37), thereby introducing biotin binding capability to the expressed mSA-antigen fusion proteins.
  • mSA-antigen fusion genes expressed in E. coli were designed with a 6 ⁇ Histidine tag and NcoI/BamHI restriction sites for subcloning into pET-15b vector.
  • mSA-antigen fusion genes expressed in either S2 cells, Human Embryonic Kidney 293 (HEK293) cells or in Baculovirus infected insect cells were designed with flanking EcoRI/BamHI (N-terminal) and NotI (C-terminal) sites and a 6 ⁇ Histidine tag and were subcloned into the pHP34s, pcDNATM4/HisMax or pAcGP67A (BD Biosciences) vector, respectively.
  • Example 5 Particle Size Measurement by Dynamic Light Scattering (DLS)
  • the hydrodynamic diameter (referred to as size) of the VLP was measured using a particle analyzer, DynaPro NanoStar (WYATT Technology), equipped with a 658 nm laser.
  • VLP samples were diluted to 0.2 mg/mL with PBS (0.32 M NaCl, 0.02% PS80) and 70 ⁇ l of each VLP sample was loaded into a disposable low volume cuvette and mounted into the DLS chamber. After 1 min equilibration, the size distribution was obtained by DLS measurement at 25° C. Each sample was measured 2 times with 20 runs in each measurement. The most predominant average sizes of particles in the population were calculated from the measurements and recorded together with the % polydispersity (% Pd).
  • the degree of biotinylation of the AviTag-VLPs is estimated by comparison with known quantities of fully biotinylated C-terminal AviTag Maltose Binding Protein (MBP-AviTag protein) using a typical ELISA setup. Briefly, the standard MBP-AviTag protein and AviTag-VLPs are adsorbed to the wells of a 96-well maxisorb plate (Nunc 456537) at known protein quantities (1-45 ng, 5 ng increments).
  • the overall amounts of antigen coupled onto the VLPs was estimated by comparing the relative amounts of antigen/HPV L1 protein on a reduced SDS-PAGE gel ( FIG. 3 ).
  • the material for this analysis was made by firstly mixing biotinylated VLPs with an excess amount of the mSA-antigen and then separating the mSA-antigen/VLP complexes from the excess mSA-antigen by density gradient ultracentrifugation.
  • the VLPs were also examined by transmission electron microscopy to assess their integrity after coupling of different mSA-antigens ( FIG. 4 ).
  • VLP1-7 and antigen/mSA A1-A11 Sequences of the constructs are found in table 5.
  • VLP1 VLP2 VLP3 VLP4 VLP5 VLP6 VLP7 A1 No Yes Yes No N/A No No coupling VLPs VLPs VLPs A2 No Yes Yes No N/A No No coupling VLPs VLPs VLPs A3 No N/A N/A No N/A No No coupling VLPs VLPs VLPs A4 No Yes Yes No N/A No No No coupling VLPs VLPs VLPs VLPs A5 No Yes Yes No N/A No No coupling VLPs VLPs VLPs VLPs A6 No Yes Yes No N/A No No No coupling VLPs VLPs VLPs A7 No Yes Yes No N/A No No coupling VLPs VLPs VLPs VLPs A8 No Yes Yes No N/A No No coupling VLPs VLPs VLPs A9 No Yes Yes No N/A No No coupling
  • the chimeric mSA-VAR2CSA gene sequence was designed with a small Gly-Gly-Ser linker separating the monomeric Streptavidin (mSA) [GenBank: 4JNJ_A] from the ID1-ID2a domains of VAR2CSA [FCR3 strain, GenBank: GU249598] (amino terminus). Both the VAR2CSA and mSA-VAR2CSA gene fragments were further modified to contain a C-terminal 6 ⁇ histidine tag and flanking BamHI and NotI restriction sites used for sub-cloning into the Baculovirus vector, pAcGP67A (BD Biosciences).
  • Linearized Bakpak6 Baculovirus DNA (BD Biosciences) was co-transfected with pAcGP67A-VAR2CSA or pAcGP67A-mSA-VAR2CSA into Sf9 insect cells for generation of recombinant virus particles. Histidine-tagged recombinant protein was purified on Ni 2+ sepharose columns from the supernatant of Baculovirus infected High-Five insect cells using an ⁇ KTAxpress purification system (GE-Healthcare).
  • VLP-VAR2CSA vaccine For production of the VLP-VAR2CSA vaccine, biotinylated HPV16 Avi-L1 VLPs were mixed with 3 ⁇ molar excess of mSA-VAR2CSA and the sample was incubated at 4° C. for 18-24 hours with gentle shaking. Unbound mSA-VAR2CSA was removed by ultracentrifugation over an OptiprepTM step gradient (27%, 33%, 39%) as previously described (Buck et al., 2004).
  • VLP-VAR2CSA vaccine was dialyzed in PBS (0.32 M NaCl, 0.02% PS80) and the relative concentration of VLP-bound mSA-VAR2CSA was estimated by SDS-PAGE using a BSA standard dilution range. Post ultracentrifugation fractions were analyzed by SDS-PAGE or blotted onto a nitrocellulose membrane (GE-Healthcare RPN203E) for detection of L1 or mSA-VAR2CSA (via a 6 ⁇ histidine tag) with CamVir-1 (AbD Serotec, Bio-Rad, 7135-2804) or Penta ⁇ His HRP (QIAGEN, 34460) respectively.
  • VAR2CSA (1 ⁇ g/ml in PBS) was coated on Nunc MaxiSorp plates overnight at 4° C. Plates were incubated with blocking buffer for 1 hour at room temperature (RT) to inhibit non-specific binding to the plate. Plates were washed three times in between different steps. Serum samples were diluted in blocking buffer (1:100), added to the wells in three fold dilutions, and incubated for 1 hour at RT. Horseradish peroxidase (HRP)-conjugated polyclonal rabbit anti-mouse Ig (P260 DAKO, Denmark) was diluted 1:3000 in blocking buffer and incubated for 1 hour. Finally, color reactions were developed for 7 min by adding o-phenylenediamine substrate. The HRP enzymatic reaction was stopped by adding 2.5 M H 2 SO 4 and the optical density was measured at 490 nm using an ELISA plate reader (VersaMax Molecular Devices).
  • HRP horseradish peroxidase
  • Parasites were maintained in culture as described (23). Briefly, parasites were cultured in 5% hematocrit of human blood (group 0+) in RPMI 1640 (Sigma) supplemented with 0.125 ⁇ g/ml Albumax II (Invitrogen) and 2% normal human serum. Atmospheric air was exchanged with a mixture of 1% oxygen and 5% carbon dioxide in nitrogen, whereafter incubation was done at 37° C. under static conditions with ad hoc change of culture medium. The FCR3 isolate was selected for binding to CSA by panning on BeWo cells as described (Haase et al., 2006). Parasite isolates tested negative for mycoplasma (Lonza) and were regularly genotyped using nested GLURP and MSP-2 primers in a single PCR step, as described (Snounou et al., 1999).
  • Tritium labeled late-stage IEs were MACS purified and added to the 96 well plate in a concentration of 200,000 cells per well. Titrations of serum were added in a total volume of 100 ⁇ l in triplicate wells. After incubation for 90 min at 37° C., unbound IEs were washed away by a pipetting robot (Beckman-Coulter).
  • the remaining IEs were harvested onto a filter plate (Perkin-Elmer). After addition of scintillation fluid (Perkin-Elmer) the counts per minute (CPM) recording the number of non-inhibited IE was determined by liquid scintillation counting on a Topcount NXT (Perkin-Elmer). Data were adjusted to percentage of binding by dividing test result with the mean value of wells with IE incubated without serum.
  • CPM counts per minute
  • the biotin acceptor site (AviTagTM) sequence was genetically inserted as described above at four different positions in the HPV16 L1 sequence, which based on the crystal structure of HPV16 L1 capsid protein, correspond to surface exposed loops in the assembled VLP structure.
  • the chimeric Avi-L1 constructs were expressed in High-Five cells and allowed to assemble into VLPs ( FIG. 1 b ). Formation of VLPs was confirmed by performing density gradient ultracentrifugation followed by SDS-PAGE analysis.
  • FIG. 5 c The identity of Avi-L1 proteins in the high-density fractions was confirmed by western blot analysis using a monoclonal anti-HPV16 L1 antibody ( FIG. 5 c ).
  • VLP assembly of the Avi-L1 constructs was verified by transmission electron microscopy (TEM) as described above showing a heterogeneous population of VLPs of different sizes (28-60 nm) ( FIG. 5 b ), representing different icosahedral assembly symmetries of which roughly 30% had the size/appearance of native HPV16 L1 VLPs.
  • the particles were subsequently biotinylated ( FIG. 5 c ) and analyzed by TEM.
  • VAR2CSA The shortest truncated VAR2CSA polypeptide sequence that is able to bind CSA covers the ID1-ID2a region of the full-length protein ( FIG. 1 a ).
  • This construct (herein referred to as VAR2CSA) was genetically fused at the amino terminus to monomeric streptavidin (mSA) which can bind biotin with high affinity.
  • mSA monomeric streptavidin
  • streptavidin which is advantageous to native streptavidin as the latter contains four biotin binding sites.
  • the chimeric construct expressed high levels of soluble protein and retained a structure capable of binding CSA (data not shown).
  • mSA-VAR2CSA Purified mSA-VAR2CSA was subsequently mixed with the biotinylated VLP (1:3 HPV L1/antigen), and examined by ultracentrifugation followed by SDS-PAGE and western blot analysis.
  • Excess mSA-VAR2CSA was present in the low-density fractions [12-14] ( FIG. 6 a & c ).
  • Antigen-coupled VLPs were further examined by TEM, showing particles of a comparably larger size ( ⁇ 70 nm) than the non-coupled VLPs ( ⁇ 30-60 nm) ( FIG. 6 b ). This observation was further examined by dynamic light scattering (DLS) analysis, which confirmed that mixing of mSA-VAR2CSA with biotinylated Avi-L1 VLPs resulted in measurably larger particles with an average diameter of ⁇ 70 nm (12.9% Pd) compared to naked Avi-L1 VLPs ( ⁇ 60 nm, 23.9% Pd).
  • DLS dynamic light scattering
  • mSA-VAR2CSA VLP vaccine consists of non-aggregated HPV16 Avi-L1 VLPs displaying dense, repetitive arrays of the mSA-VAR2CSA antigen presented in a consistent orientation, as illustrated schematically in FIG. 1 b.
  • the HPV16 L1 genotype used as VLP platform in this study, constitutes one of the most prevalent oncogenic HPV types. This genotype is included in all licensed HPV vaccines, which are being administered to millions of young women every year. Thus, the immunogenicity of this VLP platform could be impeded by pre-existing immunity towards the HPV L1 major capsid protein.
  • the AviTagTM sequence was inserted in the L1 major capsid protein of the European elk PV as well as in HPV genotype 118 at a position corresponding to the fusion site in the HPV16 Avi-L1 (DE) ( FIG. 7 a ).
  • mice Female C57BL/6 mice (Taconic, Denmark) were immunized by intramuscular injection with 5 ⁇ g VLP-coupled mSA-VAR2CSA, soluble mSA-VAR2CSA or soluble naked VAR2CSA on day 0 with no adjuvant. Two booster injections with 2.5 ⁇ g of the respective antigens were given on days 21 and 42. Immune-serum was collected on days 14, 35 and 56.
  • the immunogenicity of the mSA-VAR2CSA VLP vaccine was then tested.
  • ELISA was used to measure total immunoglobulin (Ig) levels against VAR2CSA in sera obtained from mice immunized with mSA-VAR2CSA VLP, soluble mSA-VAR2CSA or soluble naked VAR2CSA ( FIG. 8 ).
  • Ig immunoglobulin
  • the VAR2CSA specific Ig levels were higher in sera from mice immunized with the mSA-VAR2CSA Avi-L1 VLP vaccine than in sera from mice immunized with soluble naked VAR2CSA ( FIG. 8 c ).
  • Example 18 Fluorescenceality of the mSA-VAR2CSA VLP Vaccine Induced Anti-VAR2 Antibodies
  • Antisera were examined for their ability to block the binding between native VAR2CSA expressed on the surface of parasite-infected erythrocytes and immobilized CSA. After first immunization, none of the three vaccines (mSA-VAR2CSA VLP, soluble mSA-VAR2CSA or soluble naked VAR2CSA) had induced efficient levels of functional binding-inhibitory antibodies, leading to full binding of parasites ( FIG. 9 a ). However, after the second round of immunizations 1:50 diluted serum from mSA-VAR2CSA VLP immunized mice inhibited the binding between IE and CSA by approximately 70%.
  • the soluble mSA-VAR2CSA vaccine only inhibited approximately 20%, while no inhibition was seen for the soluble naked VAR2CSA vaccine ( FIG. 9 b ).
  • 1:200 diluted serum from mice immunized with the mSA-VAR2CSA VLP vaccine showed roughly 90% binding-inhibition, while the sera from mice immunized with the soluble mSA-VAR2CSA vaccine inhibited parasite binding by approximately 60%.
  • the soluble naked VAR2CSA vaccine failed to induce any binding-inhibitory antibodies ( FIG. 9 c ).
  • the avidity values of serum antibodies were determined by measuring the resistance of Ab-target complexes to 8 M urea by ELISA. Analyzed sera were obtained after the 2 nd immunization. Antibody titres of individual mouse sera were firstly normalized by dilution. After the serum incubation, triplicate wells were treated with either PBS or 8 M urea for 5 minutes. Subsequently, the wells were washed with PBS, and the ELISA was performed as previously described. The avidity value was calculated as the ratio of the mean OD value of urea-treated wells to PBS control wells multiplied by 100.
  • VLP virus-like particle
  • mSA monovalent streptavidin
  • the obtained anti-sera were tested in ELISA using naked survivin (no mSA) as the solid phase capturing antigen. In this way we could directly test what effect the VLP-display had on the ability of the mice to induce humoral immunity against the self-antigen.
  • mice 1-3 (immunized with Survivin displayed on VLP) were able to break self-tolerance, whereas mouse 4 and 5 are unable to generate a response against soluble survivin.
  • our working procedure will be to firstly couple HER2 (mSA:Her2-ECD
  • the antigen specific Ig and IgG titer will be estimated in a 2 fold dilution series of the sera.
  • a positive seroconversion is defined as ELISA OD measurements above 2 ⁇ standard deviation of a mock immunized animal. Serum conversion and induction of specific antibodies to HER2 is further confirmed by western blotting using the sera and cell lysates from different cancerous cell lines (e.g. melanoma, prostate, breast and lung cancer).
  • tumor cells expressing HER2 and/or Survivin are injected into the left flank. This is being done in both vaccinated animals and mock immunized animals, to study the prophylactic effect of the vaccine. Tumor growth is monitored by measuring the size of the growing tumor as well as by scanning of the animal when using luciferase transfected cell lines. In another setup we are studying the therapeutic effect of the vaccine by immunizing animals with established tumors and monitoring tumor regression/progression by size measurements and/or by fluorescent scannings.
  • the goal of making a VLP-based vaccine based on the PCSK9 antigen is to induce a humoral response capable of lowering blood cholesterol. Therefore, to test the VLP:avi platform we measure cholesterol levels in plasma and serum samples obtained from VLP-PCSK9 immunized mice and compare against the levels measured in mice immunized with the non-coupled PCSK9 antigen, as previously described. Cholesterol levels in plasma and serum samples are measured using a WAKO Cholesterol E Assay kit (Cat#439-17501) following the manufacturers' instructions. Dilutions of cholesterol standard or test plasma/serum samples (4 ⁇ l volume) are added to wells of a 96-well plate and 196 ⁇ l of prepared cholesterol reagent added. The plate is incubated for 5 minutes at 37° C. and the absorbance of the developed color read at 600 nm within 30 minutes.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Oncology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Zoology (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Cell Biology (AREA)
  • Virology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to a virus like particle (VLP) based vaccine. The virus-like particle constitutes a non-naturally occurring, ordered and repetitive antigen array display scaffold which can obtain a strong and long-lasting immune response in a subject. The VLP based vaccine may be used for the prophylaxis and/or treatment of a disease including, but is not limited to, cancer, cardiovascular, infectious, asthma, and/or allergy diseases/disorders.

Description

    FIELD OF INVENTION
  • The present invention relates to a technology and method for making a virus like particle based vaccine with efficient epitope display and capable of inducing a strong and long-term protective immune response. The present invention solves the key challenge of obtaining a virus like particle which presents a larger antigen on the particle surface at high density, while being regularly spaced, and with consistent orientation; three critical factors for obtaining optimal activation of the immune system.
    • BACKGROUND OF INVENTION
  • Vaccines have played, and still play, a major role in reducing the impact of infectious diseases on global health. The first generation of vaccines was based on attenuated or inactivated pathogens. These full-pathogen-based vaccines have proven extremely effective and, in some cases, have (e.g. small pox) led to the complete eradication of the target pathogen. There are however serious concerns associated with using full-pathogens for immunization as these have been seen to induce severe side effects at some frequency in populations, underscoring the need to develop safer vaccines (Plotkin S A et. al 2005). Along with the recent advances in recombinant DNA technology and genetic engineering, modern vaccine research has put effort into identifying critical antigenic targets of neutralizing antibodies with the aim of developing so called ‘subunit vaccines’ composed solely of well-defined, purified antigen components (Murray K. et al. 1988). The immunogenicity of subunit vaccines based on soluble protein is, unfortunately, low compared to that of full pathogen-based vaccines. To induce a high-titer antibody response it is thus often necessary to use high antigen doses, booster administrations, and co-administration of adjuvants and even so these subunit vaccines are generally not capable of inducing long-term protective immunity. This is indeed exemplified by the many vaccine failures observed with soluble proteins during the past several years and point to an important fact: that the size and the spatial assembly of the vaccine antigen component is critical for proper activation of the immune system, demonstrating the importance of qualitative immune responses beyond quantitative ones.
  • Virus-like particles (VLPs), which are both highly immunogenic and safe, represent a major advancement in the development of subunit vaccines, combining many of the advantages of full pathogen-based vaccines and recombinant subunit vaccines. VLPs are composed of one or several recombinantly expressed viral proteins which spontaneously assemble into macromolecular particulate structures mimicking the morphology of the native virus coat—but lacking infectious genetic material. The particulate nature and size of VLPs (22-150 nm) appears to be optimal for efficient uptake by professional antigen presenting cells, particularly dendritic cells (DCs) as well as for entry into lymph vessels (Bachmann, M F, Jennings, G T. 2010). Furthermore, surface structures presenting an antigen at high density, while being regularly spaced, and with consistent orientation are characteristic of microbial surface antigens for which the mammalian immune system has evolved to respond vigorously to. At the molecular level, the presentation of an epitope at high density, while being regularly spaced, and with consistent orientation enables efficient cross-linking of B-cell receptors (Bachmann, M F and Zinkernagel, R M. 1997) leading to strong B-cell responses, even in the absence of T-cell help (Bachmann, M F et al., 1993; Chackerian et al., 1999; Kouskoff, V. et al., 2000) and cumulative data from several studies indicate that B-cells, in fact, discriminate antigen patterns via the degree of surface Ig-cross-linking and use antigen repetitiveness as a self/nonself discriminator.
  • It has long been an attractive goal to exploit the VLPs as an immunogenicity-boosting platform for inducing immune responses against heterologous antigens by using them as molecular scaffolds for antigen presentation. Traditionally this has been achieved either by incorporation of antigenic epitopes into VLPs by genetic fusion (chimeric VLPs) or by conjugating antigens to preassembled VLPs. The chimeric VLP approach is to date the most common method for displaying heterologous epitopes on VLPs (Pumpens, P and Grens, E. 2001; Bachmann, M F and Jennings, G T, 2004a; Chackerian, 2007; Grgacic, E V L. and Anderson, D A. 2006). However, this strategy is severely limited by both the size and nature of epitopes that can be inserted into VLPs, especially in their immunodominant regions, and it has in general not been possible to insert peptides longer than 20 amino acids without disrupting the fragile self-assembly process of the VLPs. In addition, this approach requires that critical epitopes have already been identified in the target antigen and that these can be presented in an immunodominant region on the VLP surface while maintaining its native conformation. Therefore, despite a still growing understanding of the VLP structure/assembly process, generating chimeric VLPs is still a trial-and-error process and it remains impossible to predict whether individual peptides will be compatible with VLP assembly or whether insertions will be immunogenic. Finally, due to the small size of inserted peptide sequences the induced antibody response will essentially be monoclonal, which in some cases will set a limit to the potency of protection.
  • On the other hand chemical conjugation e.g. through chemical biotinylation of exposed lysine residues allows the attachment of diverse kinds of target antigens (incl. non-protein targets) to VLPs and this approach is generally not restricted by the size of the antigen (Raja K S. Et al. 2003 and others). However with this approach it is very challenging, if not impossible, to control the orientation and the total amount/stoichiometry of the coupled antigen, affecting both the density and regularity of displayed epitopes, and thus potentially limiting the immune response. In addition to this, chemical coupling procedures are rarely compatible with large scale vaccine production. As a result the current technologies are not sufficient to ensure VLP display of antigens at high density, while being regularly spaced, and with consistent orientation, which are three critical factors for obtaining strong and long lasting activation of the immune system.
  • In brief:
      • Induction of a strong and long lasting immune response to pathogens as well as disease associated antigens is very difficult to obtain with subunit vaccines.
      • Virus like particle (VLP) presentation of antigens has proven to be very efficient in inducing the highly functional long-term immune responses.
      • Coupling of an antigen onto the surface of a VLP, to ensure a high density display of regularly spaced epitopes, pose a major biotechnological challenge.
      • Specifically, the main challenge of current VLP delivery platforms is to present an antigen on the surface of the VLP, at high density, and with a consistent orientation to enable a regular, high density, spacing of displayed epitopes, which is important for inducing long-term protective immunity.
    SUMMARY OF INVENTION
  • The present invention solves the challenges of obtaining a VLP which presents densely and regularly spaced surface antigens with consistent orientation, capable of efficiently displaying epitopes and to induce long-term protective immunity in a subject. The general concept of the present invention is illustrated in FIG. 1. The present inventors have identified regions of the Papilloma Virus (PV) VLP where the inventors can insert a biotin acceptor site, without compromising the self-assembly of the particle. In addition, the inventors have managed to setup a system to produce antigens fused to a monovalent streptavidin, which ensures control of the orientation of the coupled antigen. Enzymatical biotinylation of the human papilloma virus (HPV) VLPs facilitate linkage to the monovalent streptavidin/antigen and ensure control of the overall amount/stoichiometry as well as display of antigens in a densely and repetitive ordered manner with consistent orientation which is important for yielding efficient epitope display and consequently a potent immune response. The described antigen display scaffold is unique as it for the first time enables coupling of virtually any antigen at high density on a VLP surface, thereby presenting ordered arrays of the particular antigens which are all held in the same orientation, thereby solving three key issues of mounting an efficient immune response. The system can both be used to target self-antigens (i.e. break tolerance) as well as to efficiently target infectious organisms.
  • The problems described above are solved by the aspects and embodiments of the present invention characterized in the claims. As illustrated in FIG. 1, a main aspect of the present invention concerns a vaccine for use in the prophylaxis and/or treatment of a disease wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an antigen fused to a monovalent streptavidin,
        wherein the antigen and PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In another aspect the present invention concerns a vector comprising at least one polynucleotide encoding
      • i. a PV L1 protein containing a biotin acceptor site, and
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site, and
      • iii. an antigen fused to a monovalent streptavidin as illustrated on FIG. 1.
  • In another aspect the present invention concerns a host cell expressing at least one polypeptide encoded by said polynucleotide.
  • In another aspect the present invention concerns a composition comprising said vaccine.
  • A further aspect of the present invention concerns a method of manufacturing a pharmaceutical composition comprising said vaccine, wherein the method comprises the steps of
      • i. obtaining a first polypeptide; a PV L1 protein containing a biotin acceptor site, and
      • ii. obtaining a second polypeptide; a biotin ligase, capable of biotinylating the biotin acceptor site, and
      • iii. obtaining a third polypeptide; an antigen fused to a monovalent streptavidin, and
      • iv. subjecting the first polypeptide to conditions which enable formation of virus like particles, and
      • v. enable enzymatic biotinylating of the biotin acceptor site of said virus like particles using said second polypeptide, and
      • vi. obtaining a vaccine by linkage of the third polypeptide and said virus like particles via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of said virus like particles, and
      • vii. generating a composition comprising said vaccine,
        thereby obtaining a pharmaceutical composition.
  • Yet an aspect of the present invention concerns a method of administering said vaccine to treat and/or prevent a clinical condition in a subject in need thereof comprising the steps of:
      • i. obtaining a composition comprising at least one vaccine, and/or
      • ii. administering said composition to a subject at least once for prophylaxis and/or treatment of a disease.
  • In another aspect the present invention concerns a kit of parts comprising
      • i. a composition comprising a vaccine, and
      • ii. a medical instrument or other means for administering the vaccine, and
      • iii. instructions on how to use the kit of parts.
  • An aspect of the invention relates to a method for inducing an immune response in a subject, the method comprising the steps of
      • i. obtaining a composition comprising at least one vaccine, and
      • ii. administering said composition to a subject at least once for prophylaxis and/or treatment of a disease.
    DESCRIPTION OF DRAWINGS
  • FIG. 1. Schematic representation of the VAR2CSA VLP-vaccine components and the assembly system.
  • a. Structure of HPV16 L1 major capsid protein. The biotin acceptor sequence (AviTag™) was successfully inserted into the protruding DE and HI loops and the H4-βJ coil (blue boxes) of the HPV16 L1. Gray boxes represent regions (loops and coils) of the L1 protein where the AviTag™ could not be inserted (FG loop) or has not been investigated. The VAR2CSA antigen encompasses the extracellular ID1-ID2a (ID1—Interdomain 1, DBL2X—Duffy binding like 2X and ID2a—Interdomain 2a) domains of the full-length VAR2CSA fused at the N-terminus to a previously described monovalent streptavidin (mSA) (Lim et al., 2011). b. Production process of HPV16 Avi-L1 VLPs displaying consistently oriented mSA-VAR2 antigens in a high-density repetitive manner. The HPV16 Avi-L1 and the mSA-vaccine antigen are separately expressed. The HPV16 Avi-VLPs are subsequently in vitro biotinylated (the triangle represents BirA ligase) and finally mixed with the soluble mSA-vaccine antigen. The HPV16 Avi-L1 VLP is theoretically expected to bind one mSA-VAR2CSA antigen per Avi-L1.
  • FIG. 2: Transmission electron microscopy of HPV AviTag-L1 virus-like particles. The TEM pictures shows non-aggregated VLPs (size range: 28-60 nm) assembled from biotinylated HPV16 L1-Avi (SEQ ID NO. 1-3) constructs, respectively. Scale bar=200 nm.
  • FIG. 3: VLP/mSA-antigen coupling efficiency. The figure shows SDS-PAGE gels (reduced conditions) with relative amounts of coupled mSA-antigens (mSA-ID1ID2a-HIS SEQ ID NO. 21; mSA-IL-5(C63T/C105T) SEQ ID NO. 19; HIS-GMZ2T:ggsmSA SEQ ID NO. 25; mSA-Her2-ECD|23-686 SEQ ID NO. 18) and AviTag-L1 protein (SEQ ID NO. 2). There is an estimated 0.8-1.0 mSA-antigen per AviTag-L1 protein in the VLP containing fractions.
  • FIG. 4: Transmission electron microscopy of HPV AviTag-L1 virus-like particles coupled with different mSA-antigens (mSA-ID1ID2a-HIS SEQ ID NO. 21; mSA-IL-5(C63T/C105T) SEQ ID NO. 19; HIS-GMZ2T:ggsmSA SEQ ID NO. 25; mSA-Her2-ECD|23-686 SEQ ID NO. 18) and AviTag-L1 protein (SEQ ID NO. 2). The TEM pictures shows non-aggregated VLPs assembled from biotinylated HPV16 L1-Avi (SEQ ID NO. 2) constructs, respectively. The apparent average size of the mSA-antigen coupled VLPs seems (˜5-10 nm) larger than corresponding non-coupled VLPs. Scale bar=200 nm.
  • FIG. 5. Verification of self-assembly and subsequent in vitro biotinylation of HPV16 Avi-L1 VLPs
  • a. Purification of HPV16 Avi-L1 VLPs (HI) VLPs was performed by ultracentrifugation (UC) on an iodixanol (Optiprep™) density-gradient (27%/33%/39%). Subsequent reduced SDS-PAGE analyses showed the presence of a 56 kDa protein band (theoretical size of Avi-L1) in the high-density UC fractions [4-6] containing particulate material. b. Transmission-electron microscopy (TEM) analysis of material representing UC fraction 4 post UC purification. To verify the integrity of the chimeric HPV16 Avi-L1 (HI) VLPs, an aliquot of diluted particles was placed on carbon-coated grids, negatively stained with 2% phosphotungstic acid (pH=7.0) and examined by transmission electron microscopy (TEM) using a CM 100 BioTWIN at magnification ×36,000 (Å), scale bar 80 nm. c. Western blot analysis of fraction 4 post UC purification. The blot demonstrates the presence of HPV16 Avi-L1 (56 kDa) detected by Camvir-1 (lane one) and successful biotinylation of HPV16 Avi-L1 using Strep-HRP to detect biotin (lane two).
  • FIG. 6. HPV16 Avi-L1 VLP coupled to mSA-ID1-ID2a analyzed by ultracentrifugation followed by SDS-PAGE, Western blot and TEM analysis a After coupling of the mSA-ID1-ID2a antigen to the HPV16 Avi-L1 VLPs, excess antigen was removed by UC over an Optiprep™ gradient (27%/33%/39%). Reducing SDS-PAGE analysis showed the presence of two protein bands corresponding to the size of HPV16 Avi-L1 (56 kDa) and mSA-VAR2CSA (85 kDa), respectively, in the high-density fractions [4-6] post UC purification. Excess unbound mSA-VAR2CSA was present in the higher UC fractions [12-14] containing soluble proteins. b Transmission electron microscopy (TEM) analysis of material from UC fraction 4 containing HPV16 Avi-L1 VLPs coupled with mSA-VAR2CSA. An aliquot of diluted particles was placed on carbon-coated grids, negatively stained with 2% phosphotungstic acid (pH=7.0) and examined by transmission electron microscopy (TEM) using a CM 100 BioTWIN at magnification×36,000 (Å). Black scale bar 200 nm, enhanced section white scale bar 40 nm. c Western blot analysis of fraction 4 post UC purification of mixed HPV16 Avi-L1 and mSA-VAR2CSA. The blot confirms the presence of HPV16 Avi-L1 and mSA-VAR2CSA detected by Camvir-1 and α-PENTA HIS-tag, respectively.
  • FIG. 7. Other PV VLPs with AviTag™ inserted in DE-loop.
  • The HPV16 L1 VLP was used as VLP platform for proof of concept in this study. However, the AviTag™ can also be inserted into the DE loop of the major capsid protein from other papilloma viruses while retaining the ability to self-assemble into VLPs, as demonstrated in this figure. a Multiple sequence alignment of the HPV16 L1, HPV118 L1 and major capsid protein from European Elk (Alces alces) papilloma virus (PAPVE). b Purification of HPV118 Avi-L1 and PAPVE Avi-L1 VLPs were performed by UC over an Optiprep™ density gradient (27%/33%/39). Subsequent reduced SDS-PAGE analysis of high-density UC fractions [3-5] show the presence of a protein band of 56 kDa corresponding to the full-length Avi-L1 protein. These fractions also contain an intense protein band of approximately 43 kDa, which may represent a truncated Avi-L1 product.
  • FIG. 8. Reactivity of sera from vaccinated mice by ELISA.
  • C57BL/6 mice were immunized three times with three-week intervals. Serum samples were collected two weeks after each immunization. Total VAR2CSA-specific immunoglobulin was measured in a serial dilution of mouse anti-sera by ELISA using recombinant VAR2CSA as the solid phase capturing antigen. HRP conjugated anti-mouse Ig antibodies were used for detection by measuring absorbance at OD 490 nm. Serum reactivity from individual mice vaccinated with mSA-VAR2CSA coupled HPV16 Avi-L1 (HI) VLPs (blue) or uncoupled mSA-VAR2CSA (red) are shown after first (a), second (b) and third (c) immunization where each line shows the reactivity of one animal. Green curves represent sera from mice vaccinated with soluble naked VAR2CSA and is a pool of sera obtained after 2nd and 3rd bleed.
  • FIG. 9. Display of VAR2CSA on HPV16 L1-AviTag VLPs assessed by parasite inhibition assay.
  • The functional antibody response was assessed by measuring the capacity of mouse anti-sera to inhibit binding between native VAR2CSA expressed on parasitized erythrocytes and CSA in a static binding-assay. P. falciparum (FCR3 genotype)-infected red blood cells, expressing the native VAR2CSA, were first incubated with mouse anti-serum (4 fold dilution series, starting from 1:50) and then allowed to incubate on decorin coated plates for 90 min. Unbound IE were washed away and the remaining IEs were quantified. Normalized parasite binding after incubation with pooled anti-sera from mice (n=5) vaccinated with mSA-VAR2CSA-coupled HPV16 Avi-L1 VLPs (blue) or soluble mSA-VAR2CSA (red) are shown after first (a), second (b) and third (c) immunization. The green piles in FIG. 6c represent anti-sera from mice vaccinated with soluble naked VAR2CSA and is a pool of sera from 2nd and 3rd bleed.
  • FIG. 10. Control experiment where unbiotinylated VLPs were mixed with mSA-VAR2CSA. SDS PAGE shows that ultracentrifugation efficiently separated soluble mSA-VAR2CSA from unbiotinylated VLPs.
  • FIG. 11. Immuno-tolerance to a cancer-associated self-antigen “Survivin”. a. All the survivin-VLP (mSA-Survivin coupled to HPV Avi-L1 (HI-LOOP)) immunized mice (n=3) induced high-titre antibody responses against the mSA-survivin self-antigen, whereas the negative control vaccine was not able to break immune-tolerance in the immunized mice (no sero-conversion). b. The same anti-sera in ELISA using the mSA-survivin as the solid phase capturing antigen, showing that the negative control mice did produce antibodies against the ‘foreign’ mSA part.
    •  DETAILED DESCRIPTION OF THE INVENTION
  • The present invention solves the challenge of conjugating larger proteins (e.g. full length antigens) at high density and in a consistent orientation onto the surface of a VLP, thereby obtaining VLPs presenting densely and repetitive arrays of heterologous epitopes. The solution of the present invention represents a novel approach for making a versatile VLP-based vaccine delivery platform capable of efficiently displaying antigen epitopes and of inducing long-term protective immunity.
  • A general aspect of the present invention is illustrated in FIG. 1 b.
    • Definitions
  • The term “PV” refers to papillomavirus.
  • The term “L1 protein” refers to the major capsid L1 protein from papillomavirus, which has the ability to spontaneously self-assemble into virus-like particles (VLPs). The L1 proteins of the present invention are displaying antigens.
  • The term “virus like particle” or “VLP” refers to one or several recombinantly expressed viral proteins which spontaneously assemble into macromolecular particulate structures mimicking the morphology of a virus coat, but lacking infectious genetic material.
  • The term “self-assembly” refers to a process in which a system of pre-existing components, under specific conditions, adopts a more organised structure through interactions between the components themselves. In the present context, self-assembly refers to the intrinsic capacity of L1, the major capsid protein of papillomavirus to self-assemble into virus-like particles in the absence of L2 or other papillomavirus proteins, when subjected to specific conditions. The self-assembly process may be sensitive and fragile and may be influenced by factors such as, but not limited to, choice of expression host, choice of expression conditions, and conditions for maturing the virus-like particles.
  • The term “consistent orientation”, as used herein, refers to the orientation of the monomeric streptavidin/antigen constructs of the present invention and their spatial orientation to the major capsid protein of papillomavirus (PV L1) of the present invention. When linking an antigen fused to a monomeric streptavidin to a PV L1 protein VLP comprising a biotin acceptor site with a biotin molecule enzymatically conjugated to the biotin acceptor site, the monomeric streptavidin can only be linked to a single PV L1 protein, thus creating a uniform and/or consistent presentation of said antigen with a consistent orientation. In contrast a streptavidin homo-tetramer may crosslink several PV L1 proteins on the surface of a VLP, thus creating an irregular and non-consistent orientation of said antigen. Besides, it is highly challenging to use a homo-tetramer streptavidin as a bridging molecule e.g. for conjugating biotinylated antigens onto biotinylated VLPs, since the multiple biotin binding sites will allow cross-linking and aggregation of the biotinylated VLPs.
  • The term “regularly spaced” as used herein, refers to antigens of the present invention which forms a pattern on the surface of a VLP. Such pattern may be symmetric, circle-like, and/or bouquet like pattern of antigens.
  • The term “treatment” refers to the remediation of a health problem. Treatment may also be preventive and/or prophylactic or reduce the risk of the occurrence of a disease and/or infection. Treatment may also be curative or ameliorate a disease and/or infection.
  • The term “prophylaxis” refers to the reduction of risk of the occurrence of a disease and/or infection. Prophylaxis may also refer to the prevention of the occurrence of a disease and/or infection.
  • The term “loop” refers to a secondary structure of a polypeptide where the polypeptide chain reverses its overall direction and may also be referred to as a turn.
  • The term “vaccine cocktail” refers to a mixture of antigens administered together. A vaccine cocktail may be administered as a single dose or as several doses administered over a period of time. Time intervals may be, but not limited to administration within the same year, month, week, day, hour and/or minute. Co-vaccination and vaccine cocktail may be used interchangeably.
  • The term “self-antigens” refers to endogenous antigens that have been generated within previously normal cells as a result of normal cell metabolism, or because of viral or intracellular bacterial infection.
  • The term “biotin acceptor site” refers to a peptide sequence capable of binding a biotin molecule. Biotin acceptor site and AviTag are interchangeably used herein.
  • The term “sequence variant” refers to a polypeptide and/or polynucleotide sequence with at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to said polypeptide and/or polynucleotide sequence.
  • VLP Based Vaccine
  • The expression of viral structural proteins, such as Envelope or Capsid proteins, can result in the self-assembly of virus-like particles (VLPs). VLPs resemble viruses, but are non-infectious as they do not contain any viral genetic material. For the purpose of active immunization VLPs have proven highly immunogenic and provide a safer alternative to attenuated viruses since they lack genetic material. Besides, VLPs are a useful tool for the development of vaccines and can be used as molecular scaffolds for efficient antigen epitope display. This has been achieved by either genetic insertion or by chemical conjugation approaches. However, it has generally not been possible to incorporate peptides longer than 20 amino acids without disrupting the self-assembly process of the chimeric VLP. At the same time the current technologies using chemical conjugation are not sufficient to enable VLP-presentation of larger proteins at high density and with a consistent orientation to ensure an orderly, high density, display of repetitive antigen epitopes, which are critical factors for obtaining strong and long-lasting immune responses.
  • The present inventors have solved these problems by a novel approach to linking antigens to a PV L1 VLP using a biotin acceptor site, a biotin molecule and a monovalent streptavidin tag without disrupting the self-assembly of the VLP. Thus in a main aspect, as illustrated in FIG. 1b , the present invention concerns a vaccine for use in the prophylaxis and/or treatment of a disease wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an antigen fused to a monovalent streptavidin,
        wherein the antigen and PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In an embodiment the PV L1 protein containing a biotin acceptor site is able to form a virus like particle.
  • The inventors of the present invention have demonstrated formation of VLP's using insect cells, such as High Five of Sf9 cells incubated at 28° C. In vitro maturation may occur for 18-24 hours at 30° C.-37° C. Other conditions and expression hosts (such as Pichia Pastoris) may work as well.
  • In an embodiment the antigen is capable of eliciting an immune reaction in an animal, such as a mammal, such as a cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, most preferably such as a human being; or bird such as a chicken, or fish such as a Salmon.
  • It has long been an attractive goal to exploit the VLPs as an immunogenicity-boosting platform for inducing immune responses against heterologous antigens by using them as molecular scaffolds for antigen display. Thus another aspect of the present invention relates to an antigen display scaffold, comprising an assembled virus-like particle comprising:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an antigen fused to a monovalent streptavidin,
        wherein the antigen and PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form an antigen display scaffold.
  • Another aspect of the present invention relates to a method of producing a non-naturally occurring, ordered and repetitive antigen array comprising
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an antigen fused to a monovalent streptavidin,
        wherein the antigen and PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a non-naturally occurring, ordered and repetitive antigen array.
  • Diseases and Medical Indications
  • The present invention is a novel, generic, and easy-to-use-approach to conjugate various antigens to a VLP. Depending on the antigen the VLP-based vaccines of the present invention can be used for prophylaxis and/or treatment of a wide range of diseases. The diseases which the present invention may be used for prophylaxis and/or treatment of include but are not limited to cancers, cardiovascular diseases, allergic diseases, and/or infectious diseases.
  • In an embodiment an antigen which is associated with at least one cancer disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein. In a further embodiment the present VLP vaccine may be used for prophylaxis and/or treatment of the cancer and/or cancers which the antigen is associated with.
  • In an embodiment an antigen which is associated with at least one cardiovascular disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein. In a further embodiment the present VLP vaccine can be used for prophylaxis and/or treatment of the cardiovascular disease and/or cardiovascular diseases which the antigen is associated with.
  • In an embodiment an antigen which is associated with at least one allergic disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein. In a further embodiment the present VLP vaccine can be used for prophylaxis and/or treatment of the allergic disease and/or allergic diseases which the antigen is associated with.
  • In an embodiment an antigen which is associated with at least one infectious disease is linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein. In a further embodiment the present VLP vaccine can be used for prophylaxis and/or treatment of the infectious disease and/or infectious diseases which the antigen is associated with.
  • A non-exhaustive list of antigens which may be used by the present invention is outlined in table 1 and table 2. In addition table 1 show examples of specific diseases the antigens are associated with as well as examples of patient groups which may be in need of prophylaxis and/or treatment using the antigen-VLP vaccines of the present invention.
  • TABLE 1
    Non-exhaustive list of antigens or parts hereof that could be used in
    treatment of specific diseases/medical indications in various patient groups.
    Examples of Examples of a specific
    antigens (non- disease (non- Examples of patient group (non-
    exhaustive) exhaustive) exhaustive)
    Her2/Neu Breast cancer Females overexpressing Her2
    (ERBB2)
    Her2/Neu Gastric cancer Males and Females overexpressing
    (ERBB2) Her2
    Her2/Neu Ovarian cancer Females overexpressing Her2
    (ERBB2)
    Her2/Neu Uterine serous Postmenopausal Females
    (ERBB2) carcinoma overexpressing Her2
    Survivin Cancer types Males and non-pregnant Females
    overexpressing Survivin overexpressing Survivin
    PCSK9 cardiovascular disease Males and Females with dyslipidemia
    PCSK9 cardiovascular disease Males and Females with atherosclerosis
    PCSK9 cardiovascular disease Males and Females with
    hypercholesterolemia
    Interleukin-5 Asthma Males and Females with eosinophilia
    Interleukin-5 nasal polyposis Males and Females with eosinophilia
    Interleukin-5 atopic dermatitis Males and Females with eosinophilia
    Interleukin-5 eosinophilic esophagitis Males and Females with eosinophilia
    Interleukin-5 Hypereosinophilic Males and Females with eosinophilia
    syndrome
    Interleukin-5 Churg-Strauss Males and Females with eosinophilia
    syndrome
    Ag85A Tuberculosis Males and Females with tuberculosis
    PfRH5 Malaria Males and Females with malaria
    VAR2CSA Malaria Females with malaria
    PfEMP1, CIDR1a Malaria Males and Females with malaria
    GLURP Malaria Males and Females with malaria
    MSP3 Malaria Males and Females with malaria
    Pfs25 Malaria Males and Females with malaria
    CSP Malaria Males and Females with malaria
    PfSEA-1 Malaria Males and Females with malaria
  • The disclosed antigens may as well be relevant for the use in other patient groups and/or against other specific or related diseases. In an embodiment at least two such as three, four, and/or five antigens may be combined.
  • TABLE 2
    Non-exhaustive list of diseases/medical indications and target
    antigen/organisms of the present VLP vaccine.
    Disease: Target antigen/Organism:
    Cancer: Her2/Neu (ERBB2)/Homo Sapiens
    Survivin (Baculoviral IAP repeat-containing protein 5)/
    Homo Sapiens
    Cardio- PCSK9 (Proprotein convertase subtilisin/kexin type 9)/
    vascular Homo Sapiens
    disease:
    Asthma/ IL-5 (Interleukin-5)/Homo Sapiens
    Allergies:
    Tuber- Ag85A (Diacylglycerol cyltransferase/mycolyltransferase)/
    culosis: Mycobacterium tuberculosis
    Malaria: Reticulocyte-binding protein homologue 5 (PfRH5)/
    Plasmodium falciparum
    VAR2CSA (domain, ID1-ID2a)/Plasmodium falciparum
    CIDR1a domain of PfEMP1, Plasmodium falciparum
    Glutamate rich protein (GLURP)/Plasmodium falciparum
    Merozoite surface protein 3 (MSP3)/Plasmodium
    falciparum
    25 kDa ookinete surface antigen (Pfs25)/Plasmodium
    falciparum
    Circumsporozoite protein (CSP)/Plasmodium falciparum
    Schizont egress antigen-1 (PfSEA-1)/Plasmodium
    falciparum
  • The vaccine of the present invention may as well be used against other diseases and/or use other antigens.
  • In an embodiment of the present invention the medical indication is selected from the group consisting of a cancer, a cardiovascular disease, an allergy, and/or an infectious disease. In a particular embodiment the medical indication is an allergy. In another particular embodiment the medical indication is a cardiovascular disease. In a most preferred embodiment the medical indication is a cancer.
  • In another embodiment the antigen is a polypeptide, peptide and/or an antigenic fragment of a polypeptide associated with an abnormal physiological response such as a cardiovascular disease and/or an allergic reaction/disease. In a particular embodiment the abnormal physiological response is a cancer.
  • In a further embodiment the antigen is a protein, peptide and/or an antigenic fragment associated with a medical indication disclosed in the present invention.
  • Cancer and Associated Antigens
  • In 2012 more than 14 million adults were diagnosed with cancer and there were more than 8 million deaths from cancer, globally. Consequently, there is a need for efficient cancer therapeutics.
  • One characteristic of cancer cells is abnormal expression levels of genes and proteins. One example of a cancer associated gene is HER2, which is overexpressed in 20% of all breast cancers and is associated with increased metastatic potential and poor patient survival. Although cancer cells express cancer associated antigens in a way that immunologically distinguishes them from normal cells, most cancer associated antigens are only weakly immunogenic because most cancer associated antigens are “self” proteins which are generally tolerated by the host. The present invention has solved this problem by an effective antigen-VLP based vaccine which is capable of activating the immune system to react against for example cancer associated antigens and overcome the immunological tolerance to such antigens. Different cancers are characterized by having different cancer associated antigens. Survivin is regarded to be overexpressed in most cancer cells and could also be used in the present invention. Therefore the present invention may be used in treatment/prophylaxis of most types of cancers that overexpress a tumor associated antigen.
  • The antigen is linked to the PV L1 protein of the present invention via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein (see FIG. 1b for the general concept of the present invention). Thereby the present invention provides effective antigen-VLP based vaccine which is capable of activating the immune system to react against for example cancer associated antigens and overcome immunological tolerance to such antigens. In an embodiment the VLP vaccine of the present invention can be used for prophylaxis and/or treatment of the cancer which the antigen is associated with.
  • An embodiment of the present invention comprises a cancer associated antigen linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein. In a further embodiment the present VLP vaccine can be used for prophylaxis and/or treatment of the cancer which the antigen is associated with.
  • In another embodiment the present invention is used in treatment/prophylaxis of any type of cancer which overexpresses an antigen. The type of cancer which the invention may be used against is determined by the choice of antigen.
  • It is known that oncovirus can cause cancer. Therefore in an embodiment the vaccine of the present invention comprises an oncovirus associated antigen linked to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • In a further embodiment the present vaccine can be used for prophylaxis and/or treatment of the cancer which the antigen is associated with.
  • In an embodiment the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with a cancer selected from the group comprising of Adrenal Cancer, Anal Cancer, Bile Duct Cancer, Bladder Cancer, Bone Cancer, Brain/CNS Tumors in adults, Brain/CNS Tumors In Children, Breast Cancer, Breast Cancer In Men, Cancer in Adolescents, Cancer in Children, Cancer in Young Adults, Cancer of Unknown Primary, Castleman Disease, Cervical Cancer, Colon/Rectum Cancer, Endometrial Cancer, Esophagus Cancer, Ewing Family Of Tumors, Eye Cancer, Gallbladder Cancer, Gastrointestinal Carcinoid Tumors, Gastrointestinal Stromal Tumor, Gestational Trophoblastic Disease, Hodgkin Disease, Kaposi Sarcoma, Kidney Cancer, Laryngeal and Hypopharyngeal Cancer, Leukemia, Acute Lymphocytic in Adults, Leukemia, Acute Myeloid Leukemia, Chronic Lymphocytic Leukemia, Chronic Myeloid Leukemia, Chronic Myelomonocytic Leukemia, Leukemia in Children, Liver Cancer, Lung Cancer, Non-Small Cell Lung Cancer, Small Cell Lung Cancer, Lung Carcinoid Tumor, Lymphoma, Lymphoma of the Skin, Malignant Mesothelioma, Multiple Myeloma, Myelodysplastic Syndrome, Nasal Cavity and Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma, Non-Hodgkin Lymphoma, Non-Hodgkin Lymphoma In Children, Oral Cavity and Oropharyngeal Cancer, Osteosarcoma, Ovarian Cancer, Pancreatic Cancer, Penile Cancer, Pituitary Tumors, Prostate Cancer, Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer, Adult Soft Tissue Cancer Sarcoma, Skin Cancer, Basal and Squamous Cell Skin Cancer, Melanoma Skin Cancer, Merkel Cell Skin cancer, Small Intestine Cancer, Stomach Cancer, Testicular Cancer, Thymus Cancer, Thyroid Cancer, Uterine Sarcoma, Vaginal Cancer, Vulvar Cancer, Waldenstrom Macroglobulinemia, and Wilms Tumor.
  • In a preferred embodiment the cancer is selected from the group consisting of breast cancer, gastric cancer, ovarian cancer, and uterine serous carcinoma.
  • Linking the Her2/Neu (ERBB2) and/or Survivin or an antigenic fragment hereof to the VLP forms a VLP based vaccine which is capable of activating the immune system to react against for example cells with high Her2/Neu (ERBB2) and/or Survivin expression and overcome immunological tolerance. In an embodiment the Her2/Neu (ERBB2) and/or Survivin VLP vaccine of the present invention can be used for prophylaxis and/or treatment of the herein disclosed cancer disease and/or other cancer diseases. Using a similar reasoning other cancer disease associated antigen-VLP based vaccines may be used against any cancer disease.
  • In an embodiment the antigen of the present invention is Her2/Neu (ERBB2) and/or Survivin or an antigenic fragment hereof, wherein the antigen is associated with and directed against at least one of the herein disclosed types of cancers.
  • In a most preferred embodiment the present invention concerns a vaccine for use in the prophylaxis and/or treatment of one of the herein disclosed cancers wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. a cancer associated antigen such as Her2/Neu (ERBB2) and/or Survivin or an antigenic fragment of Her2/Neu (ERBB2) and/or Survivin fused to a monovalent streptavidin,
        wherein the antigen and the PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In an embodiment the antigen fused to a monovalent streptavidin is selected from the group comprising SEQ ID NO: 18, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, and/or SEQ ID NO: 47 and/or a sequence variant hereof.
  • Cardiovascular Diseases and Associated Antigens
  • An estimated 17.3 million people died from cardiovascular diseases in 2008, representing 30% of all global deaths. Addressing risk factors such as tobacco use, unhealthy diet and obesity, physical inactivity, high blood pressure, diabetes and raised lipids are important for prevention of cardiovascular diseases. However, the need for preventive pharmaceutical measures is increasingly important. The present invention may be used in treatment/prophylaxis of most types of cardiovascular diseases. The type of cardiovascular disease which the invention may be used against is decided by the choice of antigen.
  • In an embodiment of the invention the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with a disease selected from the group comprising a lipid disorder such as hyperlipidemia, type I, type II, type III, type IV, or type V hyperlipidemia, secondary hypertriglyceridemia, hypercholesterolemia, familial hypercholesterolemia, xanthomatosis, cholesterol acetyltransferase deficiency, an ateriosclerotic condition (e.g., atherosclerosis), a coronary artery disease, a cardiovascular disease, and Alzheimer's disease.
  • In an embodiment of the invention the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with a cardiovascular disease. In a further embodiment the cardiovascular disease is selected from the group consisting of dyslipidemia, atherosclerosis, and hypercholesterolemia.
  • One example of a polypeptide associated with a cardiovascular disease is PCSK9 which acts in cholesterol homeostasis. Blockage of PCSK9 has medical significance and can lower the plasma and/or serum low-density lipoprotein cholesterol (LDL-C) levels. Reducing LDL-C reduces the risk of for example heart attacks.
  • Linking the PCSK9 antigen to the VLP forms a PCSK9-VLP based vaccine which is capable of activating the immune system to react against for example cells with high PCSK9 expression and overcome immunological PCSK9 tolerance, thereby lowering the LDL-C levels and the risk of heart attacks. In an embodiment the PCSK9-VLP vaccine of the present invention can be used for prophylaxis and/or treatment of the herein disclosed cardiovascular disease and/or other cardiovascular diseases. Using a similar reasoning other cardiovascular disease associated antigen-VLP based vaccines may be used against any cardiovascular disease.
  • In a preferred embodiment the antigen comprises PCSK9 or an antigenic fragment hereof, wherein the antigen is associated with and directed against at least one of the herein disclosed cardiovascular disease and/or other cardiovascular diseases.
  • In a most preferred embodiment the present invention concerns a vaccine for use in the prophylaxis and/or treatment of at least one of the herein disclosed cardiovascular diseases wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. a cardiovascular disease associated antigen such as PCSK9 or an antigenic fragment hereof fused to a monovalent streptavidin,
        wherein the antigen and the PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In an embodiment the antigen fused to a monovalent streptavidin comprise SEQ ID NO: 20 and/or a sequence variant hereof.
  • Asthma or Allergy Diseases and Associated Antigens
  • The prevalence of allergic diseases worldwide is rising dramatically in both developed and developing countries. According to World Health Organization statistics, hundreds of millions of subjects in the world suffer from allergic rhinitis and it is estimated that 300 million have asthma markedly affecting the quality of life of these individuals and negatively impacting the socio-economic welfare of society.
  • Interleukin 5 (IL-5) has been shown to play an instrumental role in eosinophilic inflammation in various types of allergies, including severe eosinophilic asthma. Eosinophils are regulated in terms of their recruitment, activation, growth, differentiation and survival by IL-5 which, consequently, has identified this cytokine as a primary target for therapeutic interventions. Linking an IL-5 antigen or a fragment hereof to the VLP of the present invention forms an IL-5-VLP based vaccine which is capable of activating the immune system to react against IL-5. Consequently an IL-5-VLP based vaccine described in the present invention may be used in the treatment/prophylaxis of eosinophilic asthma or allergy. Other allergy-associated antigens (e.g. IgE) may be used by the present invention using a similar reasoning. The type of asthma or allergy disease which the invention may be used against is decided by the choice of antigen. In an embodiment the antigen is a protein or peptide or an antigenic fragment of a polypeptide associated with one or more asthma or allergy diseases disclosed herein. In a preferred embodiment the asthma or allergy is selected from the group consisting of eosinophilic asthma, allergy, nasal polyposis, atopic dermatitis, eosinophilic esophagitis, hypereosinophilic syndrome, and Churg-Strauss syndrome.
  • In a preferred embodiment the antigen comprises IL-5 or an antigenic fragment hereof, wherein the antigen is associated with and directed against at least one of the herein disclosed asthma or allergy diseases and/or other asthma or allergy diseases.
  • In a most preferred embodiment the present invention concerns a vaccine for use in the prophylaxis and/or treatment of one of the herein disclosed asthma or allergy diseases wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an allergy associated antigen such as IL-5 or an antigenic fragment hereof fused to a monovalent streptavidin,
        wherein the antigen and the PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In an embodiment the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 19 and/or a sequence variant hereof.
  • Infectious Diseases and Associated Antigens
  • Tuberculosis and malaria are two major infectious diseases. In 2012, an estimated 207 million cases of malaria occurred which resulted in more than 500.000 deaths. Also in 2012, an estimated 8.6 million people developed tuberculosis and 1.3 million died from the disease. The current methods of treatment are insufficient and some have resulted in drug resistance. Consequently there is a need for new and efficient drugs for treatment/prophylaxis of tuberculosis and malaria. Linking a malaria or tuberculosis associated-antigen or a fragment hereof to the VLP of the present invention forms a VLP based vaccine which is capable of activating the immune system to react against for example malaria or tuberculosis. Using a similar line of reasoning the present invention may be used in treatment/prophylaxis of most infectious disease. The type of infectious disease which the invention may be used against is decided by the choice of antigen.
  • In an embodiment the antigen fused to the monovalent streptavidin of the present invention is a protein or peptide or an antigenic fragment of a polypeptide associated with an infectious disease such as tuberculosis and/or malaria.
  • In a further embodiment an antigen from Plasmodium falciparum is fused to the monovalent streptavidin of the present invention for use in treatment/prophylaxis of malaria.
  • In a further embodiment an antigen from Mycobacterium tuberculosis is fused to the monovalent streptavidin of the present invention for use in treatment/prophylaxis of tuberculosis.
  • In a further embodiment the antigen is selected from the group consisting of Ag85A from Mycobacterium tuberculosis, PfRH5 from Plasmodium falciparum, VAR2CSA (domain, ID1-ID2a) from Plasmodium falciparum, CIDR1a domain, of PfEMP1 from Plasmodium falciparum, GLURP from Plasmodium falciparum, MSP3 from Plasmodium falciparum, Pfs25 from Plasmodium falciparum, CSP from Plasmodium falciparum, and PfSEA-1 from Plasmodium falciparum or an antigenic fragment of the disclosed antigens. In another embodiment the antigen comprises a fusion construct between MSP3 and GLURP (GMZ2) from Plasmodium falciparum.
  • In another embodiment the antigen of the present invention comprises a protein, or an antigenic fragment hereof, from the pathogenic organism which causes the infectious disease.
  • In a most preferred embodiment the present invention concerns a vaccine for use in the prophylaxis and/or treatment of one of the herein disclosed infectious diseases wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an antigen associated with an infectious disease such as Ag85A from Mycobacterium tuberculosis, PfRH5 from Plasmodium falciparum, VAR2CSA (domain, ID1-ID2a) from Plasmodium falciparum, CIDR1a domain, of PfEMP1 from Plasmodium falciparum, GLURP from Plasmodium falciparum, MSP3 from Plasmodium falciparum, Pfs25 from Plasmodium falciparum, CSP from Plasmodium falciparum, and/or PfSEA-1 from Plasmodium falciparum or an antigenic fragment hereof fused to a monovalent streptavidin,
        wherein the antigen and the PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In a preferred embodiment, the antigen is VAR2CSA and the vaccine is for use in the prophylaxis and/or treatment of placental malaria.
  • In another preferred embodiment, the antigen is surviving and the vaccine is for use in the prophylaxis and/or treatment of cancer.
  • In an embodiment the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, or SEQ ID NO: 28 and/or a sequence variant hereof. In a preferred embodiment the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 21. In a more preferred embodiment the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 24. In a most preferred embodiment the antigen fused to a monovalent streptavidin comprises SEQ ID NO: 28.
  • Induction of an Immune Response in a Subject
  • Active vaccination (immunization), by delivering small doses of an antigen into a subject, is a way to activate a subject's immune system to develop adaptive immunity to the antigen. This allows a subjects body to react quickly and efficiently to future exposures.
  • An aspect of the invention relates to a method for inducing an immune response in a subject, the method comprising the steps of
      • i. obtaining a composition comprising at least one vaccine of the present invention and/or
      • ii. administering said composition to a subject at least once for prophylaxis and/or treatment of a disease,
        thereby inducing an immune response in the subject.
  • Another aspect of the present invention relates to a method of immunizing a subject in need thereof, said method comprises the steps of:
      • i. obtaining a composition comprising at least one vaccine of the present invention, and/or
      • ii. administering said composition to a subject at least once for prophylaxis and/or treatment of a disease.
        thereby immunizing the subject in need thereof.
  • Another aspect of the present invention relates to a method for obtaining a strong and long-lasting immune response in a subject in need thereof, said method comprising the steps of:
      • i. obtaining composition comprising a vaccine of the present invention, and/or
      • ii. administering the vaccine to treat and/or prevent a clinical condition in an subject in need thereof,
        wherein the vaccine obtain a strong and long-lasting immune response in the subject.
  • In an embodiment the method of inducing an immune response in a subject, immunizing a subject in need thereof, and/or obtaining a strong and long-lasting immune response further comprising at least one booster vaccine and/or a second active ingredient.
  • Origin of the PV L1 Protein
  • An important element of the present VLP based vaccine is the major capsid L1 protein from papillomavirus (PV), which has the ability to spontaneously self-assemble into virus-like particles (VLPs). The use of papillomavirus L1 proteins in the present invention is illustrated in FIG. 1b . Several hundred species of papillomaviruses, traditionally referred to as “types”, are known to infect most mammals, as well as birds, snakes, and turtles. In principle the major capsid protein L1 from most papillomavirus, capable of forming a VLP, may be used to carry out the present invention.
  • In an embodiment the PV L1 protein of the present invention is from a mammal such as but not limited to: Alces genus, Homo sapiens, cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, and chicken.
  • In a most preferred embodiment the PV L1 protein of the present invention is from the human PV genotype 16 and/or 118. In yet a particular embodiment the PV L1 protein is from the Alces alces.
  • Biotin acceptor site and its position in the PV L1 protein The biotin acceptor site of the present invention comprises a sequence of 15 amino acids encoded by a polynucleotide sequence. It is extremely difficult, if not impossible, to predict the consequence of modifications to VLP forming proteins, such as PV L1 proteins. Such modifications often lead to disruption of the delicate and sensitive self-assembly process of the VLPs. Successful modification of the VLP forming process is at least dependent on three factors 1) the amino acid sequence of the biotin acceptor site, 2) the insertion site, and 3) deletion/removal of amino acid residues to make room for the biotin acceptor site. The inventors have demonstrated several successful modifications to PV L1 loops without disrupting the delicate self-assembly process.
  • In an embodiment the biotin acceptor site is fused into a loop of the PV L1 protein.
  • In an embodiment the present invention concerns a vaccine for use in the prophylaxis and/or treatment of a disease wherein the vaccine comprises:
      • i. a papilloma virus (PV) L1 protein containing a biotin acceptor site in a loop of the PV L1 protein, and
      • ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
      • iii. an antigen fused to a monovalent streptavidin,
        wherein the antigen and PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
  • In another embodiment the loop is selected from the group consisting of the DE-loop, and the HI-loop of the PV L1 protein. The PV L1 protein starts with a methionine residue which is cleaved off after translation. There are thus two ways of numbering the amino acid residues of the PV L1 protein: either the methionine residue is the first, or the methionine residue is not counted and the following serine residue is the first. The positions given in the present disclosure are numbered using the first numbering, i.e. where the methionine is counted.
  • In an embodiment the biotin acceptor site is inserted into the HI-loop of the L1 protein from the human PV genotype 16 at position 351/352 (SEQ ID NO: 2). In another embodiment the biotin acceptor site, is inserted into the H4-loop of the L1 protein from the human PV genotype 16 at position 431/432 (SEQ ID NO: 1). In an embodiment the biotin acceptor site is inserted into the HI-loop of the L1 protein from the human PV genotype 118 at position 360/365 where the residues 361-364 (AGKI) are deleted (SEQ ID NO: 6). In a most preferred embodiment the biotin acceptor site is inserted into the DE-loop of the L1 protein from the human PV genotype 16 at position 134/139 where the residues 135-137 (YAAN) are deleted (SEQ ID NO: 3).
  • In an embodiment the PV L1 protein containing the biotin acceptor site comprises the amino acid sequences selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 2, and SEQ ID NO: 6 or a biologically active sequence variant that has at least 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to any of the herein disclosed PV L1 proteins containing the biotin acceptor site sequences. By “biological active” is meant the ability to form a virus like particle.
  • In an embodiment the biotin acceptor site of the present invention comprises the amino acid sequence GLNDIFEAQKIEWHE (SEQ ID NO 36).
  • Enzymatic Biotinylation
  • In general, two approaches for biotinylation of proteins exists; chemical biotinylation and enzymatic biotinylation. Chemical biotinylation such as biotinylation of exposed lysine residues allows the attachment to VLPs of diverse kinds of target antigens (incl. non-protein targets) and this approach is generally not restricted by the size of the antigen (Raja K S. et al., 2003). However, with this strategy it is very challenging to control the overall amount/stoichiometry as well as the orientation of the coupled antigen. Finally, chemical coupling procedures are rarely compatible with large scale vaccine production. The main challenge of current VLP platforms is to present the antigen on the surface of the VLP, at high density, in a regularly spaced order with a consistent orientation for an efficient epitope display which are capable of inducing long-term protective immunity.
  • In order to solve these challenges the VLPs of the present invention are made by enzymatic biotinylation. Enzymatic biotinylation ensures that only a single biotin molecule is conjugated to each L1 in the VLP thus controlling the overall ratio/stoichiometry and placement of VLP proteins and biotin molecules. This control will enable display of an antigen at high density i.e. in theory one antigen per L1 protein, while being regularly spaced, and with consistent orientation on the surface of the VLPs of the present invention.
  • Thus, in an embodiment the biotin molecule is enzymatically conjugated to the biotin acceptor site. In another embodiment the biotin molecule is enzymatically conjugated to the biotin acceptor site by a biotin ligase from a prokaryote, such as from a bacteria, such as from E. coli. The biotin ligase is in a preferred embodiment BirA from E. coli.
  • Antigen Fused to a Monovalent Streptavidin
  • Streptavidin from Streptomyces avidinii forms streptavidin homo-tetramers and binds up to four biotin molecules. The monovalent streptavidin of the present invention forms monomers and binds a single biotin molecule. Thus when linking the antigen fused to a monovalent streptavidin to the VLP of the present invention, the monovalent streptavidin ensures a uniform presentation of said antigens. Using monovalent streptavidin further ensures control of the overall amount/stoichiometry as well as the orientation of the coupled antigen. This control will enable display of an antigen at high density, while being regularly spaced, and with consistent orientation on the surface of a VLP, thus solving three major critical factors for obtaining prober activation of the immune system. In contrast a streptavidin homo-tetramer may crosslink several PV L1 proteins on the surface of a VLP, thus creating an irregular presentation of said antigen, which may hamper the immune response of an antigen. It is thus an aspect of the present invention to use monovalent streptavidin fused to the antigen for linking the antigen to the PV L1 protein via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein.
  • In an embodiment the monovalent streptavidin used by the present invention comprises or consists of the amino acid sequence of SEQ ID NO: 37.
  • In another embodiment each antigen is presented in immediate continuation of each PV L1 protein in a consistent orientation.
  • In another embodiment the ratio of PV L1 protein:biotin molecule:antigen is 1:1:1.
  • Changing the position where the monomeric streptavidin tag is fused to the antigen will allow changing the orientation of the antigen. This may be performed to enable the best possible display of the most immunogenic epitopes of the antigen. The best possible orientation may be different from antigen to antigen.
  • In another embodiment the antigen fused to a monovalent streptavidin further comprises a tag. Such tags may be used for purification techniques known to the skilled person. The tag may be selected from the group comprising polyhistidine tag, Calmodulin-tag, polyglutamate tag, E-tag, FLAG-tag, HA-tag, Myc-tag, S-tag, SBP-tag, Softag 1, Softag 3, Strep-tag, Strep-tag II, TC tag, V5 tag, VSV-tag, and Xpress tag. Other peptide or non-peptide tags may be used instead or in combination with the above mentioned peptide tags. In a particular embodiment the tag is a polyhistidine tag, such as a 4×His, 5×His, 6×His, 7×His, 8×His, 9×His, or 10×His tag.
  • In an embodiment the monovalent streptavidin is fused to the antigen in any position. In another embodiment the monovalent streptavidin is fused to the antigen in the N-terminal, C-terminal, and/or is fused to the antigen into the coding sequence of the antigen. A person of skill will know how to fuse the antigen and the monovalent streptavidin, without introducing stop-codons or causing frame shift or any other mutations.
  • In another embodiment the monovalent streptavidin fused to the antigen comprises
      • i. a polypeptide sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28, or
      • ii. a sequence variant of said polypeptide sequence, wherein the sequence variant has at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to the sequences of the group comprising SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28.
  • In a preferred embodiment the monovalent streptavidin fused to the antigen comprises
      • i. a polypeptide sequence comprising SEQ ID NO: 19, and/or
      • ii. a sequence variant of said polypeptide sequence, wherein the sequence variant has at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to SEQ ID NO: 19.
  • In a most preferred embodiment the monovalent streptavidin fused to the antigen comprises
      • i. a polypeptide sequence comprising SEQ ID NO: 18, and/or
      • ii. a sequence variant of said polypeptide sequence, wherein the sequence variant has at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to SEQ ID NO: 18.
  • Vector and Polynucleotide/Polypeptide Sequences
  • In molecular cloning, a vector is a DNA molecule used as a vehicle to artificially carry foreign genetic material into a cell, where it can be replicated and/or expressed. The four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes. The vector itself is generally a DNA sequence that consists of an insert (transgene) and a larger sequence that serves as the “backbone” of the vector. The purpose of a vector which transfers genetic information to another cell is typically to isolate, multiply, or express the insert in the target cell. Expression vectors (expression constructs) specifically are for the expression of transgenes in target cells, and generally have a promoter sequence that drives expression of the transgene.
  • The heterologous expression/production of the vaccine of the present invention comprises 3 peptide components 1) a PV L1 protein containing a biotin acceptor site 2) a biotin ligase capable of biotinylating the biotin acceptor site, and 3) an antigen fused to a monovalent streptavidin. Thus in an embodiment of the present invention each of the peptide components are encoded by a polynucleotide sequence and each of the polynucleotide sequences may be expressed on one, two, or three different plasmids.
  • To enable heterologous expression/production of the vaccine one aspect of the present invention is a vector comprising at least one polynucleotide encoding
      • i. a PV L1 protein containing a biotin acceptor site, and/or
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site, and/or
      • iii. an antigen fused to a monovalent streptavidin.
  • In another embodiment the vector comprises at least two, such as at least three polynucleotides of the following polypeptides:
      • i. a PV L1 protein containing a biotin acceptor site, and/or
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site, and/or
      • iii. an antigen fused to a monovalent streptavidin.
  • In a further embodiment the PV L1 protein containing the biotin acceptor site is encoded by a polynucleotide sequence comprising:
      • i. a polynucleotide sequence selected from the group comprising SEQ ID 11, SEQ ID 12, SEQ ID 13, SEQ ID 14, SEQ ID 15, SEQ ID 16, SEQ ID 17, and/or
      • ii. a sequence variant of said polynucleotide sequence, wherein the sequence variant has at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to said SEQ ID 11, SEQ ID 12, SEQ ID 13, SEQ ID 14, SEQ ID 15, SEQ ID 16, SEQ ID 17, and/or
      • iii. a sequence variant of said polynucleotide, wherein the codon usage is altered.
  • In a preferred embodiment the PV L1 protein containing the biotin acceptor site is encoded by a polynucleotide sequence comprising:
      • i. a polynucleotide sequence selected from the group comprising, SEQ ID 12, and/or SEQ ID 13, and/or
      • ii. a sequence variant of said polynucleotide sequence, wherein the sequence variant has at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to said, SEQ ID 12, and/or SEQ ID 13, and/or
      • iii. a sequence variant of said polynucleotide, wherein the codon usage is altered.
  • In a further embodiment the antigen fused to the monovalent streptavidin has a polynucleotide sequence comprising:
      • i. a polynucleotide sequence selected from the group consisting of SEQ ID 29, SEQ ID 30, SEQ ID 31, SEQ ID 32, SEQ ID 33, SEQ ID 34, SEQ ID 35, and/or
      • ii. a sequence variant of said polynucleotide sequence, wherein the sequence variant has at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% sequence identity to said SEQ ID 11, SEQ ID 12, SEQ ID 13, SEQ ID 14, SEQ ID 15, SEQ ID 16, SEQ ID 17, and/or
      • iii. a sequence variant of said polynucleotide, wherein the codon usage is altered.
  • In an embodiment the biotin acceptor site, comprises the nucleotide sequence SEQ ID NO: 39.
  • Another aspect of the present invention relates to polynucleotide sequences encoding
      • i. a PV L1 protein containing a biotin acceptor site, and/or
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site, and/or
      • iii. an antigen fused to a monovalent streptavidin.
  • In a preferred embodiment the present invention relates to polynucleotide sequences encoding
      • i. a PV L1 protein containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site comprising SEQ ID 38, and/or
      • iii. an antigen fused to a monovalent streptavidin comprising SEQ ID NO: 19.
  • In a more preferred embodiment the present invention relates to polynucleotide sequences encoding
      • i. a PV L1 protein containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site comprising SEQ ID 38, and/or
      • iii. an antigen fused to a monovalent streptavidin comprising SEQ ID NO: 20.
  • In a most preferred embodiment the present invention relates to polynucleotide sequences encoding
      • i. a PV L1 protein containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
      • ii. a biotin ligase capable of biotinylating the biotin acceptor site comprising SEQ ID 38, and/or
      • iii. an antigen fused to a monovalent streptavidin comprising SEQ ID NO: 18.
  • Host Cell
  • The invention further relates to a host cell comprising a polynucleotide and/or a vector. The polynucleotide may have a sequence that is codon-optimised. Codon optimisation methods are known in the art and allow optimised expression in a heterologous host organism or cell. In an embodiment the host cell may be selected from the group comprising bacteria, yeast, fungi, plant, mammalian and/or insect cells. Methods for expressing a first polypeptide: a PV L1 protein containing a biotin acceptor site, and/or a second polypeptide; a biotin ligase, capable of biotinylating the biotin acceptor site, and/or a third polypeptide: an antigen fused to a monovalent streptavidin in a host cell are known in the art. The first, second or third polypeptide may be heterologously expressed from corresponding polynucleotide sequences cloned into the genome of the host cell or they may be comprised within a vector. For example, a first and/or second and/or third polynucleotide coding for the first and/or second and/or third polypeptide is cloned into the genome, and a first and/or second and/or third polynucleotide coding for the first and/or second and/or third polypeptide is comprised within a vector transformed or transfected into the host cell. Alternatively, the first and/or second and/or third polynucleotide is comprised within a first vector and the first and/or second and/or third polynucleotide is comprised within a second vector and the first and/or second and/or third is comprised within a third vector.
  • Expression of the first, second, and third polypeptides in the host cell may occur in a transient manner. When the polynucleotide encoding one of the polypeptides is cloned into the genome, an inducible promoter may be cloned as well to control expression of the polypeptides. Such inducible promoters are known in the art. Alternatively, genes coding for suppressors of gene silencing may also be cloned into the genome or into a vector transfected within the host cell.
  • In a particular embodiment the host cell may be selected from the group comprising Escherichia coli, Spodoptera frugiperda (sf9), Trichoplusia ni (BTI-TN-5B1-4), Pichia Pastoris, Saccharomyces cerevisiae, Hansenula polymorpha, Drosophila Schneider 2 (S2), Lactococcus lactis, Chinese hamster ovary (CHO), Human Embryonic Kidney 293, Nicotiana tabacum cv. Samsun NN and Solanum tuberosum cv. Solara. Thus in an embodiment, the host cell is Escherichia coli. In another embodiment, the host cell is Spodoptera frugiperda. In another embodiment, the host cell is Pichia Pastoris. In another embodiment, the host cell is Saccharomyces cerevisiae. In another embodiment, the host cell is Hansenula polymorpha. In another embodiment, the host cell is Drosophila Schneider 2. In another embodiment, the host cell is Lactococcus lactis. In another embodiment, the host cell is Chinese hamster ovary (CHO). In another embodiment, the host cell is Human Embryonic Kidney 293. In another embodiment, the host cell is Trichoplusia ni (BTI-TN-5B1-4). In another embodiment, the host cell is Nicotiana tabacum cv. Samsun NN. In another embodiment, the host cell is Solanum tuberosum cv. Solara.
  • In another aspect the present invention relates to a host cell expressing at least one polypeptide encoded by any of the polynucleotides disclosed by the present invention.
  • In an embodiment the host cell expresses:
      • i. a first polypeptide; a PV L1 protein containing a biotin acceptor site, and/or
      • ii. a second polypeptide; a biotin ligase, capable of biotinylating the biotin acceptor site, and/or
      • iii. a third polypeptide; an antigen fused to a monovalent streptavidin,
        wherein the cell is selected from the group comprising bacteria, yeast, fungi, plant, mammalian and/or insect cells.
  • In a further embodiment the host cell, expresses
      • i. a first polypeptide having a sequence at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% identical to SEQ ID NO: 3 [DE-loop, HPV genotype 16], SEQ ID NO: 2 [HI-loop, HPV genotype 16], SEQ ID NO: 6 [HI-loop, HPV118]; and/or
      • ii. a second polypeptide having a sequence at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% identical to SEQ ID NO: 38, and/or
      • iii. a third polypeptide having a sequence at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% identical to SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28,
        wherein the cell is selected from the group comprising bacteria, yeast, fungi, plant, mammalian and/or insect cells.
  • In a preferred embodiment the host cell expresses:
      • i. a first polypeptide; a PV L1 protein containing a biotin acceptor site comprising SEQ ID NO: 2, and/or
      • ii. a second polypeptide; a biotin ligase, capable of biotinylating the biotin acceptor site comprising SEQ ID NO: 38, and/or
      • iii. a third polypeptide; an antigen fused to a monovalent streptavidin comprising SEQ ID NO:18,
        wherein the cell is selected from the group comprising bacteria, yeast, fungi, plant, mammalian and/or insect cells.
  • The inventors of the present invention have demonstrated formation of VLP's using insect cells, such as High Five (Trichoplusia ni) of Sf9 cells incubated at 28° C. Other conditions and expression hosts may work as well.
  • In a particular embodiment Trichoplusia ni cells are used as host cell for expression of any of the disclosed polynucleotides and/or polypeptides. In another embodiment Trichoplusia ni cells are used to express a polypeptide having a sequence at least 70%, such as 75%, such as 80%, such as 85%, such as 90%, such as 95%, such as 96%, such as, 97%, such as 98%, such as 99%, such as 99.5%, such as 100% identical any of the polypeptides disclosed herein.
  • Composition Comprising the Vaccine
  • The vaccine of the present invention is to be used in the prophylaxis and/or treatment of a disease. Thus, one aspect of the present invention relates to a composition comprising the vaccine of the present invention. Such compositions may further comprise for example an adjuvant, a buffer, and/or salts or a combination hereof.
  • An adjuvant is a pharmacological and/or immunological agent that modifies the effect of other agents. Adjuvants may be added to a vaccine to modify the immune response by boosting it such as to give a higher amount of antibodies and/or a longer lasting protection, thus minimizing the amount of injected foreign material. Adjuvants may also be used to enhance the efficacy of a vaccine by helping to subvert the immune response to particular cell types of the immune system, for example by activating the T cells instead of antibody-secreting B cells dependent on the type of the vaccine. Thus in an embodiment the composition comprises at least one adjuvant. In an embodiment the adjuvant is aluminium based. Alluminumum adjuvants may be aluminum phosphate, aluminum hydroxide, amorphous aluminum hydroxyphosphate sulfate and/or a combination hereof. Other adjuvants may be included as well.
  • In another embodiment the composition described above comprises at least one buffer. In an embodiment the buffer is PBS and/or histidine based. In another embodiment the buffer has a pH between pH 6-pH 7.5. In an embodiment the buffer, is isotonic such as has 0.6%-1.8% NaCl.
  • An emulsifier (also known as an “emulgent”) is a substance that stabilizes an emulsion by increasing its kinetic stability. One class of emulsifiers is known as “surface active agents”, or surfactants. Polysorbates are a class of emulsifiers used in some pharmaceuticals and food preparation. Common brand names for polysorbates include Alkest, Canarcel, and Tween. Some examples of polysorbates are Polysorbate 20, Polysorbate 40, Polysorbate 60, Polysorbate 80. In an embodiment the composition of the present invention comprises an emulsifier such as one of the above described polysorbates. In a particular embodiment the composition comprises 0.001-0.02% polysorbate 80. Other polysorbates or emulsifiers may be used in the present invention as well.
  • A Pharmaceutical Composition Comprising the Vaccine
  • The vaccine of the present invention is intended to be used in the prophylaxis and/or treatment of a disease. Accordingly, the present invention further provides a pharmaceutical formulation, which comprises the vaccine of the present invention and a pharmaceutically acceptable carrier therefor. The pharmaceutical formulations may be prepared by conventional techniques, e.g. as described in Remington: The Science and Practice of Pharmacy 2005, Lippincott, Williams & Wilkins.
  • The pharmaceutically acceptable carriers can be either solid or liquid. Solid form preparations include powders, tablets, pills, capsules, cachets, suppositories, and dispersible granules. A solid carrier can be one or more excipients which may also act as diluents, flavoring agents, solubilizers, lubricants, suspending agents, binders, preservatives, wetting agents, tablet disintegrating agents, or an encapsulating material.
  • Also included are solid form preparations which are intended to be converted, shortly before use, to liquid form preparations for oral administration. Such liquid forms include solutions, suspensions, and emulsions. These preparations may contain, in addition to the active component, colorants, flavors, stabilizers, buffers, artificial and natural sweeteners, dispersants, thickeners, solubilizing agents, and the like. 3
  • The compounds of the present invention may be formulated for parenteral administration and may be presented in unit dose form in ampoules, pre-filled syringes, small volume infusion or in multi-dose containers, optionally with an added preservative. The compositions may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, for example solutions in aqueous polyethylene glycol. Examples of oily or non-aqueous carriers, diluents, solvents or vehicles include propylene glycol, polyethylene glycol, vegetable oils, and injectable organic esters, and may contain agents such as preserving, wetting, emulsifying or suspending, stabilizing and/or dispersing agents. Preferably, the formulation will comprise about 0.5% to 75% by weight of the active ingredient(s) with the remainder consisting of suitable pharmaceutical excipients as described herein.
  • The vaccine of the invention may be administered concurrently, simultaneously, or together with a pharmaceutically acceptable carrier or diluent, especially and preferably in the form of a pharmaceutical composition thereof, whether by oral, rectal, or parenteral (including subcutaneous) route, in an effective amount.
  • Thus, one aspect of the present invention relates to a pharmaceutical composition comprising a vaccine. Such pharmaceutical composition may comprise an adjuvant, a buffer, and/or salts or a combination hereof.
  • In an embodiment the pharmaceutical composition, further comprises a composition comprising a vaccine as described by the present invention.
  • A Method of Manufacture a Pharmaceutical Composition Comprising a Vaccine
  • The present invention further relates to a method of manufacturing a pharmaceutical composition comprising a vaccine. In one aspect the VLP based vaccine of the present invention, may at least be manufactured by the following steps:
      • i. obtaining a first polypeptide comprising: a PV L1 protein containing a biotin acceptor site, and/or
      • ii. obtaining a second polypeptide: a biotin ligase capable of biotinylating the biotin acceptor site, and/or
      • iii. obtaining a third polypeptide: an antigen fused to a monovalent streptavidin, and
      • iv. subjecting the first polypeptide to conditions which enable formation of virus like particles, and/or
      • v. enabling enzymatic biotinylation of the biotin acceptor site of said virus like particles using said second polypeptide, and/or
      • vi. obtaining a vaccine by linkage of the third polypeptide and said virus like particles via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of said virus like particles, and/or
      • vii. generating a composition comprising said vaccine.
        thereby obtaining a pharmaceutical composition.
  • In the manufacture of the pharmaceutical composition other steps may be included for example a) isolation/purification of the VLP to yield a high purity/quality product. This will be accomplished using different techniques for protein purification. For this purpose several separation steps will be carried out using the differences in for instance protein size, physico-chemical properties, binding affinity or biological activity b) formulation by adding stabilizers to prolong the storage life or preservatives to allow multi-dose vials to be used safely as needed c) all components that constitute the final vaccine are combined and mixed uniformly e.g. in a single vial or syringe d) the vaccine is put in recipient vessel (e.g. a vial or a syringe) and sealed with sterile stoppers.
  • All the processes described above will have to comply with the standards defined for Good Manufacturing Practices (GMP) that will involve several quality controls and an adequate infrastructure and separation of activities to avoid cross-contamination. Finally, the vaccine may be labeled and distributed worldwide.
  • Method of Administering a Vaccine
  • Routes of Administration
  • Systemic treatment. The main routes of administration are oral and parenteral in order to introduce the agent into the blood stream to ultimately target the sites of desired action. Appropriate dosage forms for such administration may be prepared by conventional techniques.
  • Oral administration. Oral administration is normally for enteral drug delivery, wherein the agent is delivered through the enteral mucosa.
  • Parenteral administration. Parenteral administration is any administration route not being the oral/enteral route whereby the medicament avoids first-pass degradation in the liver. Accordingly, parenteral administration includes any injections and infusions, for example bolus injection or continuous infusion, such as intravenous administration, intramuscular administration, subcutaneous administration. Furthermore, parenteral administration includes inhalations and topical administration.
  • Accordingly, the agent may be administered topically to cross any mucosal membrane of an animal to which the biologically active substance is to be given, e.g. in the nose, vagina, eye, mouth, genital tract, lungs, gastrointestinal tract, or rectum, preferably the mucosa of the nose, or mouth, and accordingly, parenteral administration may also include buccal, sublingual, nasal, rectal, vaginal and intraperitoneal administration as well as pulmonal and bronchial administration by inhalation or installation. Also, the agent may be administered topically to cross the skin.
  • The subcutaneous and intramuscular forms of parenteral administration are generally preferred.
  • Local treatment. The agent according to the invention may be used as a local treatment, ie. be introduced directly to the site(s) of action as will be described below.
  • Thus one agent may be applied to the skin or mucosa directly, or the agent may be injected into the diseased tissue or to an end artery leading directly to the diseased tissue.
  • Thus another aspect of the present invention relates to a method of administering a vaccine to treat and/or prevent a clinical condition in a subject in need thereof, comprising the steps of
      • i. obtaining a composition comprising at least one vaccine according to the present invention, and/or
      • ii. administering said composition to a subject at least once for prophylaxis and/or treatment of a disease.
  • A preferred embodiment relates to a method of administering a vaccine to treat and/or prevent cancer, as disclosed herein, in a subject in need thereof, comprising the steps of
      • i. obtaining a composition comprising at least one vaccine as
      • ii. administering said composition to a subject intramuscular and/or intravenous at least once for prophylaxis and/or treatment of a cancer.
  • A preferred embodiment relates to a method of administering a vaccine to treat and/or prevent a cardiovascular disease, as disclosed herein, in a subject in need thereof, comprising the steps of
      • i. obtaining a composition comprising at least one vaccine as disclosed herein, and/or
      • ii. administering said composition to a subject intramuscular and/or intravenous at least once for prophylaxis and/or treatment of a cardiovascular disease.
  • In another embodiment the vaccine of the present invention is administered by any type of injections or infusions selected from the group of bolus injection, continuous infusion, intravenous administration, intramuscular administration, subcutaneous administration, inhalation or topical administration or a combination hereof. In a particular embodiment the vaccine is administered by intramuscular administration and/or intravenous administration.
  • In medicine, a booster dose is an extra administration of a vaccine after an earlier dose. After initial immunization, a booster injection or booster dose is a re-exposure to the immunizing antigen cell. It is intended to increase immunity against that antigen back to protective levels after it has been shown to have decreased or after a specified period. In an embodiment the vaccine of the present invention is administered any number of times from one, two, three, four times or more.
  • In a further embodiment the vaccine is boosted by administration in a form and/or body part different from the previous administration. In another embodiment the vaccine is administered to the area most likely to be the receptacle of a given disease or infection which the vaccine is intended to prevent/reduce the risk of.
  • In another embodiment the recipient of the vaccine (the subject) of the present invention is an animal, for example a mammal, such as a Homo sapiens, cow, pig, horse, sheep, goat, llama, mouse, rat, monkey, and/or chicken. In a particular embodiment the subject is a Homo sapiens.
  • Administration of more than one vaccine is known in the art and refers to this concept as co-vaccination or to give a vaccine cocktail. Thus, in an embodiment of the vaccine, is co-administered with any other vaccine. In another embodiment the vaccine forms a part of a vaccine cocktail.
  • A Kit of Parts
  • In another aspect of the present invention relates to a kit of parts comprising
      • i. a composition comprising a vaccine of the present invention, and/or
      • ii. a medical instrument or other means for administering the vaccine, and/or
      • iii. instructions on how to use the kit of parts.
  • In an embodiment the kit of parts comprises a second active ingredient or vaccine component for therapeutic use in the treatment or prevention of one or more of the diseased disclosed in the present invention.
  • In an embodiment the vaccine of the invention is administered separate, sequential, or simultaneously with at least one other pharmaceutical active ingredient and/or vaccine component.
  • Dosages and Dosing Regimes
  • The dosage requirements will vary with the particular drug composition employed, the route of administration and the particular subject being treated. It will also be recognized by one of skill in the art that the optimal quantity and spacing of individual dosages of a compound will be determined by the nature and extent of the condition being treated, the form, route and site of administration, and the particular patient being treated, and that such optimums can be determined by conventional techniques. It will also be appreciated by one of skill in the art that the optimal course of treatment, i.e., the number of doses of a compound given per day for a defined number of days, can be ascertained using conventional course of treatment determination tests.
  • The daily oral dosage regimen will preferably be from about 0.01 to about 80 mg/kg of total body weight. The daily parenteral dosage regimen about 0.001 to about 80 mg/kg of total body weight. The daily topical dosage regimen will preferably be from 0.1 mg to 150 mg, administered one to four, preferably two or three times daily. The daily inhalation dosage regimen will preferably be from about 0.01 mg/kg to about 1 mg/kg per day.
  • The term “unit dosage form” refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of a compound, alone or in combination with other agents, calculated in an amount sufficient to produce the desired effect in association with a pharmaceutically acceptable diluent, carrier, or vehicle. The specifications for the unit dosage forms of the present invention depend on the particular compound or compounds employed and the effect to be achieved, as well as the pharmacodynamics associated with each compound in the host. The dose administered should be an “effective amount” or an amount necessary to achieve an “effective level” in the individual patient.
  • When the “effective level” is used as the preferred endpoint for dosing, the actual dose and schedule can vary, depending on inter-individual differences in pharmacokinetics, drug distribution, age, gender, size, health and metabolism. The “effective level” can be defined, for example, as the blood or tissue level desired in the patient that corresponds to a concentration of one or more compounds according to the invention.
    • EXAMPLES
  • Modification of VLPs without disrupting the delicate and sensitive self-assembly process is challenging. The inventors have below shown several examples of successful introduction of a biotin acceptor site into various VLP loops without disrupting the self-assembly process. In addition the inventors have shown enzymatic biotinylation of the biotin acceptor site as well as coupled several antigen/monovalent streptavidin fusion proteins to the VLPs. Immunological testing of the VLP vaccines have been initiated. The examples below are non-limiting to the scope of the invention.
    • Example 1—Design of Chimeric HPV16 Avi-L1 Coat Proteins
  • The chimeric HPV16 Avi-L1 gene sequences were constructed by insertion of the biotin acceptor sequence (AviTag™), GLNDIFEAQKIEWHE, into the DE- (aa positions 134-139), FG- (aa positions 279-286), HI- (aa positions 351-352) or H4-βJ coil (aa positions 431-432) after having deleted any intervening amino acids (HPV16 L1 accession number DQ155283.1). Gene sequences were further modified to contain an EcoRV restriction site followed by a polyhedrin promotor sequence at the N-terminus and a stop-codon followed by a NotI restriction site at the C-terminus. The synthetic gene sequences were finally codon-optimized for recombinant expression in Trichoplusia ni cells and synthesized by Geneart (Life Technologies).
    • Example 2—Expression and Purification of Chimeric HPV16 Avi-L1-VLPs
  • The HPV16 Avi-L1 gene fragments were cloned into the EcoRV/NotI sites of the pAcGP67A vector (BD Biosciences) deleting the gp67 secretion signal sequence. To generate recombinant virus particles, linearized BakPak viral DNA (BD Biosciences) was co-transfected with pAcGP67A/Avi-L1 into Sf9 insect cells using Lipofectamine 2000 10 Reagent (Invitrogen, 11668-019) and incubated at 28° C. for 3-5 days. Recombinant Baculovirus was harvested from the supernatant and used to generate a high-titer virus stock, which was used for infection of High-Five insect cells. Infected High-Five cells were incubated for 48 hours at 28° C. with shaking. In vitro maturation and purification of HPV16 Avi-L1 VLPs were performed as previously described (Buck et al., 2005, Buck et al., 2007). In brief, cell lysates were harvested and VLPs were allowed to mature in maturation-buffer (0.5% Triton-X-100, 0.1% Benzonase® Nuclease (Sigma-Aldrich), 25 mM (NH4)2SO4 and 4 mM MgCl2) for 18 h at 37° C. Matured VLPs were subsequently purified by ultracentrifugation through an Optiprep™ step gradient (27%/33%/39%) as previously described (22). VLPs were dialyzed in PBS (0.02% PS80) and incubated for 30 min at 30° C. with biotin and Biotin ligase (BirA) according to instructions from Avidity (Aurora, Colo.). Excess biotin was removed by dialysis in PBS (0.32 M NaCl, 0.02% PS80) and protein concentration was determined using BCA analysis. Collected ultracentrifugation fractions were analyzed with NuPAGE® Bis-Tris Protein gels (Life Technologies) or blotted onto a nitrocellulose membrane (GE-Healthcare, RPN203E) for detection of L1 or biotin with CamVir-1 (AbD Serotec, Bio-Rad, 7135-2804) or Streptavidin-HRP (Life Technologies, 43-4323), respectively. Densitometric analysis of SDS-PAGE gels was done using ImageJ.
    • Example 3—Gene Design and Recombinant Expression of Biotin-Binding Vaccine Antigens
  • Heterologous vaccine antigens were genetically fused with a GGS linker at either their C- or N-terminus to a previously described (refs)/patented (U.S. Pat. No. 8,586,708 B2) engineered monovalent streptavidin (mSA) (SEQ ID NO: 37), thereby introducing biotin binding capability to the expressed mSA-antigen fusion proteins. mSA-antigen fusion genes expressed in E. coli were designed with a 6×Histidine tag and NcoI/BamHI restriction sites for subcloning into pET-15b vector. mSA-antigen fusion genes expressed in either S2 cells, Human Embryonic Kidney 293 (HEK293) cells or in Baculovirus infected insect cells were designed with flanking EcoRI/BamHI (N-terminal) and NotI (C-terminal) sites and a 6×Histidine tag and were subcloned into the pHP34s, pcDNA™4/HisMax or pAcGP67A (BD Biosciences) vector, respectively.
    • Example 4—Characterisation of Particles
  • Electron Microscopy—Negative Staining
  • An aliquot of diluted VLPs was adsorbed to 200-mesh mica carbon-coated grids and negatively stained with 2% phosphotungstic acid (pH=7.0). The sample was examined with a CM 100 BioTWIN electron microscope (Phillips, Amsterdam) at an accelerating voltage of 80 kV. Photographic records were performed on an Olympus Veleta camera. Particle sizes were estimated using ImageJ. Representative pictures are shown in FIG. 2.
    • Example 5—Particle Size Measurement by Dynamic Light Scattering (DLS)
  • The hydrodynamic diameter (referred to as size) of the VLP was measured using a particle analyzer, DynaPro NanoStar (WYATT Technology), equipped with a 658 nm laser. VLP samples were diluted to 0.2 mg/mL with PBS (0.32 M NaCl, 0.02% PS80) and 70 μl of each VLP sample was loaded into a disposable low volume cuvette and mounted into the DLS chamber. After 1 min equilibration, the size distribution was obtained by DLS measurement at 25° C. Each sample was measured 2 times with 20 runs in each measurement. The most predominant average sizes of particles in the population were calculated from the measurements and recorded together with the % polydispersity (% Pd).
    • Example 6—Determination of the Extent of Biotinylation of AviTag-VLPs
  • The degree of biotinylation of the AviTag-VLPs is estimated by comparison with known quantities of fully biotinylated C-terminal AviTag Maltose Binding Protein (MBP-AviTag protein) using a typical ELISA setup. Briefly, the standard MBP-AviTag protein and AviTag-VLPs are adsorbed to the wells of a 96-well maxisorb plate (Nunc 456537) at known protein quantities (1-45 ng, 5 ng increments). Extraneous biotin is removed by washing with TBST buffer (10 mM Tris, pH 7.5, 150 mM NaCl, 0.05% Tween 20) and the plate is blocked by adding 300 μl blocking solution (PBS plus 40 μg/ml BSA) to each well. The streptavidin-horseradish peroxidase solution is then added into each well and incubated with gentle shaking for 1 hour at room temperature. Finally, the biotin associated with the biotin acceptor site is detected by its interaction with streptavidin-conjugated horseradish peroxidase by monitoring the absorption at 490 nm after adding the developing solution (3 OPD tablets dissolved in 12 ml d-water with 10 μl H2O2).
    • Example 7—Verification of the mSA-Antigen Coupling onto (Biotin Acceptor Site)—VLPs
  • The overall amounts of antigen coupled onto the VLPs was estimated by comparing the relative amounts of antigen/HPV L1 protein on a reduced SDS-PAGE gel (FIG. 3). The material for this analysis was made by firstly mixing biotinylated VLPs with an excess amount of the mSA-antigen and then separating the mSA-antigen/VLP complexes from the excess mSA-antigen by density gradient ultracentrifugation. The VLPs were also examined by transmission electron microscopy to assess their integrity after coupling of different mSA-antigens (FIG. 4). Specifically, an aliquot of diluted particles (post mSA-coupling and removal of excess mSA-antigen) was placed on 200-mesh mica carbon-coated grids, negatively stained with 2% phosphotungstic acid (pH=7.0) and examined by transmission electron microscopy (TEM) using a CM 100 BioTWIN.
    • Example 8—Coupling of Antigens to VLPs
  • The inventors have partially tested the coupling of 7 different VLPs with 12 different antigen/monovalent streptavidin fusion proteins. The results have been obtained as described above and are summarized in table 3.
  • TABLE 3
    Coupling of VLP1-7 and antigen/mSA A1-A11.
    Sequences of the constructs are found in table 5.
    VLP1 VLP2 VLP3 VLP4 VLP5 VLP6 VLP7
    A1 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A2 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A3 No N/A N/A No N/A No No
    coupling VLPs VLPs VLPs
    A4 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A5 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A6 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A7 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A8 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A9 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A10 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A11 No Yes Yes No N/A No No
    coupling VLPs VLPs VLPs
    A12 No Yes N/A No N/A No No
    coupling VLPs VLPs VLPs
    • Example 9—Expression and Purification of VAR2CSA and mSA-VAR2CSA
  • The chimeric mSA-VAR2CSA gene sequence was designed with a small Gly-Gly-Ser linker separating the monomeric Streptavidin (mSA) [GenBank: 4JNJ_A] from the ID1-ID2a domains of VAR2CSA [FCR3 strain, GenBank: GU249598] (amino terminus). Both the VAR2CSA and mSA-VAR2CSA gene fragments were further modified to contain a C-terminal 6× histidine tag and flanking BamHI and NotI restriction sites used for sub-cloning into the Baculovirus vector, pAcGP67A (BD Biosciences). Linearized Bakpak6 Baculovirus DNA (BD Biosciences) was co-transfected with pAcGP67A-VAR2CSA or pAcGP67A-mSA-VAR2CSA into Sf9 insect cells for generation of recombinant virus particles. Histidine-tagged recombinant protein was purified on Ni2+ sepharose columns from the supernatant of Baculovirus infected High-Five insect cells using an ÄKTAxpress purification system (GE-Healthcare).
    • Example 10—Conjugation and Purification of mSA-VAR2CSA to L1-Avi VLPs
  • For production of the VLP-VAR2CSA vaccine, biotinylated HPV16 Avi-L1 VLPs were mixed with 3× molar excess of mSA-VAR2CSA and the sample was incubated at 4° C. for 18-24 hours with gentle shaking. Unbound mSA-VAR2CSA was removed by ultracentrifugation over an Optiprep™ step gradient (27%, 33%, 39%) as previously described (Buck et al., 2004).
  • The VLP-VAR2CSA vaccine was dialyzed in PBS (0.32 M NaCl, 0.02% PS80) and the relative concentration of VLP-bound mSA-VAR2CSA was estimated by SDS-PAGE using a BSA standard dilution range. Post ultracentrifugation fractions were analyzed by SDS-PAGE or blotted onto a nitrocellulose membrane (GE-Healthcare RPN203E) for detection of L1 or mSA-VAR2CSA (via a 6× histidine tag) with CamVir-1 (AbD Serotec, Bio-Rad, 7135-2804) or Penta□His HRP (QIAGEN, 34460) respectively.
    • Example 11—Anti-VAR2CSA Antibody Response Measured by ELISA
  • Recombinant VAR2CSA (1 μg/ml in PBS) was coated on Nunc MaxiSorp plates overnight at 4° C. Plates were incubated with blocking buffer for 1 hour at room temperature (RT) to inhibit non-specific binding to the plate. Plates were washed three times in between different steps. Serum samples were diluted in blocking buffer (1:100), added to the wells in three fold dilutions, and incubated for 1 hour at RT. Horseradish peroxidase (HRP)-conjugated polyclonal rabbit anti-mouse Ig (P260 DAKO, Denmark) was diluted 1:3000 in blocking buffer and incubated for 1 hour. Finally, color reactions were developed for 7 min by adding o-phenylenediamine substrate. The HRP enzymatic reaction was stopped by adding 2.5 M H2SO4 and the optical density was measured at 490 nm using an ELISA plate reader (VersaMax Molecular Devices).
    • Example 12—Parasite Culture
  • Parasites were maintained in culture as described (23). Briefly, parasites were cultured in 5% hematocrit of human blood (group 0+) in RPMI 1640 (Sigma) supplemented with 0.125 μg/ml Albumax II (Invitrogen) and 2% normal human serum. Atmospheric air was exchanged with a mixture of 1% oxygen and 5% carbon dioxide in nitrogen, whereafter incubation was done at 37° C. under static conditions with ad hoc change of culture medium. The FCR3 isolate was selected for binding to CSA by panning on BeWo cells as described (Haase et al., 2006). Parasite isolates tested negative for mycoplasma (Lonza) and were regularly genotyped using nested GLURP and MSP-2 primers in a single PCR step, as described (Snounou et al., 1999).
    • Example 13—Inhibition of Binding Assays
  • Parasite DNA was labeled with Tritium by overnight incorporation of titrated hypoxanthine. A 96 well plate (Falcon) was coated with 2 μg/ml of Decorin (Sigma-Aldrich) overnight and blocked with 2% bovine serum albumin (Sigma) as described (Nielsen et al., 2009). Tritium labeled late-stage IEs were MACS purified and added to the 96 well plate in a concentration of 200,000 cells per well. Titrations of serum were added in a total volume of 100 μl in triplicate wells. After incubation for 90 min at 37° C., unbound IEs were washed away by a pipetting robot (Beckman-Coulter). The remaining IEs were harvested onto a filter plate (Perkin-Elmer). After addition of scintillation fluid (Perkin-Elmer) the counts per minute (CPM) recording the number of non-inhibited IE was determined by liquid scintillation counting on a Topcount NXT (Perkin-Elmer). Data were adjusted to percentage of binding by dividing test result with the mean value of wells with IE incubated without serum.
    • Example 14—Generation of Biotinylated HPV Avi-L1 VLPs
  • The biotin acceptor site (AviTag™) sequence was genetically inserted as described above at four different positions in the HPV16 L1 sequence, which based on the crystal structure of HPV16 L1 capsid protein, correspond to surface exposed loops in the assembled VLP structure. The chimeric Avi-L1 constructs were expressed in High-Five cells and allowed to assemble into VLPs (FIG. 1b ). Formation of VLPs was confirmed by performing density gradient ultracentrifugation followed by SDS-PAGE analysis. This analysis indicated that three of the recombinant proteins, Avi-L1 (HI), Avi-L1 (DE) and Avi-L1 (H4-βJ coil) formed VLPs as the majority of the expressed protein were present in high molecular/density fractions 4-6 after ultracentrifugation (FIG. 5a ). The Avi-L1 (FG) protein was exclusively found in the low density fractions containing non-particulate soluble protein, indicating that the AviTag™ insertion, in this case, prevented VLP assembly.
  • The identity of Avi-L1 proteins in the high-density fractions was confirmed by western blot analysis using a monoclonal anti-HPV16 L1 antibody (FIG. 5c ). VLP assembly of the Avi-L1 constructs was verified by transmission electron microscopy (TEM) as described above showing a heterogeneous population of VLPs of different sizes (28-60 nm) (FIG. 5b ), representing different icosahedral assembly symmetries of which roughly 30% had the size/appearance of native HPV16 L1 VLPs. The particles were subsequently biotinylated (FIG. 5c ) and analyzed by TEM.
    • Example 15—Construction of the Displayed Antigen VAR2CSA
  • The shortest truncated VAR2CSA polypeptide sequence that is able to bind CSA covers the ID1-ID2a region of the full-length protein (FIG. 1a ). This construct (herein referred to as VAR2CSA) was genetically fused at the amino terminus to monomeric streptavidin (mSA) which can bind biotin with high affinity. To avoid VLP aggregation we used a monomeric form of streptavidin which is advantageous to native streptavidin as the latter contains four biotin binding sites. The chimeric construct expressed high levels of soluble protein and retained a structure capable of binding CSA (data not shown). Purified mSA-VAR2CSA was subsequently mixed with the biotinylated VLP (1:3 HPV L1/antigen), and examined by ultracentrifugation followed by SDS-PAGE and western blot analysis. High-density ultracentrifugation fractions [4-5] contained both mSA-VAR2CSA and Avi-L1 protein, which was estimated by densitometric analysis to be present at a 0.6:1 molar ratio. Excess mSA-VAR2CSA was present in the low-density fractions [12-14] (FIG. 6 a&c). The co-localization of Avi-L1 and mSA-VAR2CSA, indicated that the mSA-VAR2CSA antigen was bound to the surface of Avi-L1 VLPs at high density and that these large protein complexes had been separated from the excess soluble mSA-VAR2CSA (FIG. 6a ). To confirm that co-localization of mSA-VAR2CSA and Avi-L1 VLPs was caused by the specific interaction between mSA and biotin, the procedure was repeated using unbiotinylated VLPs. This control experiment showed that ultracentrifugation efficiently separated soluble mSA-VAR2CSA from unbiotinylated VLPs (FIG. 10).
  • Antigen-coupled VLPs were further examined by TEM, showing particles of a comparably larger size (˜70 nm) than the non-coupled VLPs (˜30-60 nm) (FIG. 6b ). This observation was further examined by dynamic light scattering (DLS) analysis, which confirmed that mixing of mSA-VAR2CSA with biotinylated Avi-L1 VLPs resulted in measurably larger particles with an average diameter of ˜70 nm (12.9% Pd) compared to naked Avi-L1 VLPs (<60 nm, 23.9% Pd). Importantly, this analysis also confirmed that such large complexes were not formed after mixing unbiotinylated VLPs with mSA-VAR2CSA, demonstrating that mSA-VAR2CSA is, in fact, bound to the surface of Avi-L1 VLPs via the specific affinity interaction between mSA and biotin.
  • Together, these results indicate that the produced mSA-VAR2CSA VLP vaccine consists of non-aggregated HPV16 Avi-L1 VLPs displaying dense, repetitive arrays of the mSA-VAR2CSA antigen presented in a consistent orientation, as illustrated schematically in FIG. 1 b.
    • Example 16—Inserting AviTag™ into Other Coat Proteins Forming Papilloma VLP
  • The HPV16 L1 genotype, used as VLP platform in this study, constitutes one of the most prevalent oncogenic HPV types. This genotype is included in all licensed HPV vaccines, which are being administered to millions of young women every year. Thus, the immunogenicity of this VLP platform could be impeded by pre-existing immunity towards the HPV L1 major capsid protein. We therefore examined whether insertion of the AviTag™ sequence was compatible with VLP formation in other HPV genotypes as well as in non-human PV. The AviTag™ sequence was inserted in the L1 major capsid protein of the European elk PV as well as in HPV genotype 118 at a position corresponding to the fusion site in the HPV16 Avi-L1 (DE) (FIG. 7a ). The two protein sequences were expressed and purified as previously described. For both constructs a L1 band of the expected protein size (56 kDa) was found in the high-density ultracentrifugation fractions although the majority of protein present in these fractions was of a lower molecular size, possibly representing a L1 truncation (FIG. 7b ).
  • These data indicate that insertion of the AviTag™ sequence into other PV types is a feasible strategy for avoiding the potential issue of pre-existing immunity.
    • Example 17—Immunization of Mice
  • Female C57BL/6 mice (Taconic, Denmark) were immunized by intramuscular injection with 5 μg VLP-coupled mSA-VAR2CSA, soluble mSA-VAR2CSA or soluble naked VAR2CSA on day 0 with no adjuvant. Two booster injections with 2.5 μg of the respective antigens were given on days 21 and 42. Immune-serum was collected on days 14, 35 and 56.
  • The immunogenicity of the mSA-VAR2CSA VLP vaccine was then tested. ELISA was used to measure total immunoglobulin (Ig) levels against VAR2CSA in sera obtained from mice immunized with mSA-VAR2CSA VLP, soluble mSA-VAR2CSA or soluble naked VAR2CSA (FIG. 8). After three immunizations the VAR2CSA specific Ig levels were higher in sera from mice immunized with the mSA-VAR2CSA Avi-L1 VLP vaccine than in sera from mice immunized with soluble naked VAR2CSA (FIG. 8c ). After 1st and 2nd immunization sera from mSA-VAR2CSA Avi-L1 VLP immunized mice had statistically significantly higher Ig endpoint titers compared with sera from mice immunized with the soluble mSA-VAR2CSA vaccine (P=0.014 and P=0.018, respectively). This difference was, however, not statistically significant after the 3rd immunization (P=0.058) (Table 4) where both vaccines seem to have reached a similar plateau.
  • TABLE 4
    Serum endpoint titers (median {25 and 75 percentiles}) obtained with the
    different immunogens
    After first After second After third
    immunization immunization immunization
    1. Soluble Not done Not done  8,100a
    VAR2CSA  {8,100:8,100}
    2. Soluble mSA- 24,300a 218,700a 218,700a
    VAR2CSA {24,300:24,300}  {72,900:218,700} {72,900:218,700}
    3. mSA- 72,900a 656,100a 218,700a
    VAR2CSA Avi- {72,900:218,700} {656,100:656,100} {218,700:656,100}
    L1 VLP
    P-Valueb 0.014 (2. vs 3.) 0.018 (2. vs 3.) 0.0072 (1. vs 2.)
    0.0072 (1. vs 3.)
     0.058 (2. vs 3.)
    aEndpoint titer, defined as the reciprocal of the highest serum dilution giving an OD measurement above the cutoff. The cutoff was set to be three standard deviations above the mean negative control reading.
    bP values were calculated using Wilcoxon rank sum test.
    • Example 18—Functionality of the mSA-VAR2CSA VLP Vaccine Induced Anti-VAR2 Antibodies
  • Antisera were examined for their ability to block the binding between native VAR2CSA expressed on the surface of parasite-infected erythrocytes and immobilized CSA. After first immunization, none of the three vaccines (mSA-VAR2CSA VLP, soluble mSA-VAR2CSA or soluble naked VAR2CSA) had induced efficient levels of functional binding-inhibitory antibodies, leading to full binding of parasites (FIG. 9a ). However, after the second round of immunizations 1:50 diluted serum from mSA-VAR2CSA VLP immunized mice inhibited the binding between IE and CSA by approximately 70%. In comparison, the soluble mSA-VAR2CSA vaccine only inhibited approximately 20%, while no inhibition was seen for the soluble naked VAR2CSA vaccine (FIG. 9b ). After three immunizations, 1:200 diluted serum from mice immunized with the mSA-VAR2CSA VLP vaccine showed roughly 90% binding-inhibition, while the sera from mice immunized with the soluble mSA-VAR2CSA vaccine inhibited parasite binding by approximately 60%. By contrast, the soluble naked VAR2CSA vaccine failed to induce any binding-inhibitory antibodies (FIG. 9c ).
  • These data show that the mSA-VAR2CSA VLP vaccine displays higher ability to inhibit binding between IE and CSA.
    • Example 19—Measurement of Antibody Avidity
  • The avidity values of serum antibodies (Ab) were determined by measuring the resistance of Ab-target complexes to 8 M urea by ELISA. Analyzed sera were obtained after the 2nd immunization. Antibody titres of individual mouse sera were firstly normalized by dilution. After the serum incubation, triplicate wells were treated with either PBS or 8 M urea for 5 minutes. Subsequently, the wells were washed with PBS, and the ELISA was performed as previously described. The avidity value was calculated as the ratio of the mean OD value of urea-treated wells to PBS control wells multiplied by 100. A non-parametric two-sample Wilcoxon rank-sum (Mann-Whitney) test showed that sera from mice immunized with the VAR2CSA AviL1 VLP vaccine had significantly higher avidity values compared to mice immunized with soluble mSA-VAR2CSA (P value: 0.0275).
  • Statistical Analysis:
  • Two-sample Wilcoxon rank-sum (Mann-Whitney) test
    group obs rank sum expected
    1 4 29 20
    2 5 16 25
    combined 9 45 45
    unadjusted variance 16.67
    adjustment for ties 0.00
    adjusted variance 16.67
    Ho: reducall(group == 1) = reducall(group == 2)
    z = 2.205
    Prob > |z| = 0.0275
    • Example 20—Survivin
  • We wanted to examine if our virus-like particle (VLP) antigen presentation platform was able to overcome immune-tolerance to a cancer-associated self-antigen “Survivin”. This was tested by coupling monovalent streptavidin (mSA)-Survivin fusion proteins to the surface of biotinylated HPV Avi-L1 (HI-loop) VLPs. Three mice were immunized with this VLP-based survivin vaccine. Negative control mice (n=2) were immunized with the same amount (5 μg) of mSA-Survivin, but mixed with unbiotinylated Avi-L1 (HI-loop) VLPs. Both vaccines were formulated using ALUM adjuvant. Mice were immunized three times at three week intervals and sera were obtained two weeks after each immunization.
  • The obtained anti-sera were tested in ELISA using naked survivin (no mSA) as the solid phase capturing antigen. In this way we could directly test what effect the VLP-display had on the ability of the mice to induce humoral immunity against the self-antigen.
  • The results clearly show that all the survivin-VLP (mSA-Survivin coupled to HPV Avi-L1 (HI-LOOP)) immunized mice (n=3) induced high-titre antibody responses against the mSA-survivin self-antigen, whereas the negative control vaccine was not able to break immune-tolerance in the immunized mice (no sero-conversion) (FIG. 11a ). The ability to break immune-tolerance thus relies solely on the virus-like display and is not a result of e.g. fusing the self-antigen to mSA.
  • By testing the same anti-sera in ELISA using the mSA-survivin as the solid phase capturing antigen we could see the negative control mice did produce antibodies against the ‘foreign’ mSA part (FIG. 11b ).
  • This experiment shows that after three immunizations mouse 1-3 (immunized with Survivin displayed on VLP) were able to break self-tolerance, whereas mouse 4 and 5 are unable to generate a response against soluble survivin.
    • Example 20—Testing of VLP:Avi Platform to Induce Humoral Immunity Against Self-Antigens
  • To demonstrate the capacity of the VLP:Avi platform to break immune tolerance to self-antigens, associated with both cardiovascular disease (PCSK9), allergy (IL-5) and cancer (Her2), we will genetically fuse the self-antigens to the monovalent mSA and coupled them onto biotinylated (biotin acceptor site)-VLPs, as previously described. In some cases (IL-5) we will at first use the mouse gene homologues for the immunization of mice. Specifically, our working procedure will be to firstly couple HER2 (mSA:Her2-ECD|23-6861), and PCSK9(PCSK9|31-692|:mSA-HIS) to the (biotin acceptor site)-VLPs, immunize, and measure seroconversion of the animals in group a) mice immunized with conjugated VLPs and b) mice immunized with the non-coupled soluble antigen. The antigen specific Ig and IgG titer will be estimated in a 2 fold dilution series of the sera. A positive seroconversion is defined as ELISA OD measurements above 2× standard deviation of a mock immunized animal. Serum conversion and induction of specific antibodies to HER2 is further confirmed by western blotting using the sera and cell lysates from different cancerous cell lines (e.g. melanoma, prostate, breast and lung cancer).
    • Example 21—Testing of VLP:Avi Platform to Induce Cancer Inhibitory Antibodies
  • We are establishing animal models to study the effect of immunizing animals with tumor antigens on the growth of an established subcutaneous tumor. 100.000 tumor cells expressing HER2 and/or Survivin are injected into the left flank. This is being done in both vaccinated animals and mock immunized animals, to study the prophylactic effect of the vaccine. Tumor growth is monitored by measuring the size of the growing tumor as well as by scanning of the animal when using luciferase transfected cell lines. In another setup we are studying the therapeutic effect of the vaccine by immunizing animals with established tumors and monitoring tumor regression/progression by size measurements and/or by fluorescent scannings.
    • Example 22—Testing of VLP:Avi Platform to Induce Anti-PCSK9 Antibodies Capable of Lowering Plasma/Serum Cholesterol Levels
  • The goal of making a VLP-based vaccine based on the PCSK9 antigen is to induce a humoral response capable of lowering blood cholesterol. Therefore, to test the VLP:avi platform we measure cholesterol levels in plasma and serum samples obtained from VLP-PCSK9 immunized mice and compare against the levels measured in mice immunized with the non-coupled PCSK9 antigen, as previously described. Cholesterol levels in plasma and serum samples are measured using a WAKO Cholesterol E Assay kit (Cat#439-17501) following the manufacturers' instructions. Dilutions of cholesterol standard or test plasma/serum samples (4 μl volume) are added to wells of a 96-well plate and 196 μl of prepared cholesterol reagent added. The plate is incubated for 5 minutes at 37° C. and the absorbance of the developed color read at 600 nm within 30 minutes.
  • Sequences
  • TABLE 5
    Overview of the sequences disclosed in the present invention
    Seq ID NO protein (DNA)
    (biotin acceptor site)/AviTag-VLPs:
     1 VLP1 >L1avi1 (H4-loop, HPV16)
    (11)
     2 VLP2 >L1avi2 (HI-loop, HPV16)
    (12)
     3 VLP3 >L1avi3 (DE-loop, HPV16)
    (13)
     4 VLP4 >L1avi4 (FG-loop, HPV16)
    (14)
     5 major capsid L1 protein [Human
    papillomavirus type 16] Protein
     6 VLP5 >L1avi2 (HI-loop, HPV118)
    (15)
     7 VLP6 >L1avi3 (DE-loop, HPV118)
    (16)
     8 L1 [Human papillomavirus type 118]
     9 VLP7 >PAPVE-L1avi3
    (17)
    10 Major capsid protein L1 OS = European
    elk papillomavirus
    Antigens:
    18 A1 >mSA-Her2-ECD|23-686
    19 A2 >mSA-IL-5(C63T/C105T)
    20 A3 >PCSK9|31-692|:mSA:HIS
    (29)
    21 A4 >mSA-ID1ID2a-HIS
    (30)
    22 AS >mSA-RO-HIS
    (31)
    23 A6 >HIS-RO-mSA
    (32)
    24 A7 >HIS-GMZ2ggsmSA
    (33)
    25 A8 >HIS-GMZ2T:ggsmSA
    (34)
    26 A9 >mSA-PfRH5-HIS
    35
    27 A10 >mSA-Pfs25-HIS
    28 A11 >HIS-PfCSP(aa92-397)-mSA
    40 A12 >Survivin:mSA (Homo Sapiens)
    41 A13 >mSA:Survivin (Homo Sapiens)
    42 A14 >Survivin(F101A/L102A):mSA (Homo
    Sapiens)
    43 A15 >mSA:Survivin(F101A/L102A) (Homo
    Sapiens)
    44 (48) A16 >mSA:Survivin(F101A/L102A) (Mus
    Musculus)
    45 (49) A17 >Survivin(F101A/L102A):mSA (Mus
    Musculus)
    46 (50) A18 >mSA:Survivin (Mus Musculus)
    47 (51) A19 >Survivin:mSA (Mus Musculus)
    52 (53) A20 >mSA:CIDR1a-HIS
    Misc.
    36 (39) Biotin acceptor site amino acid
    sequence
    37 monovalent streptavidin
    38 BirA Escherichia coli (strain K12)
    GN = birA PE = 1 SV = 1
    >SEQ ID NO: 1 [H4-loop, HPV genotype 16] L1Avi1 Protein
    MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
    KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
    GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG
    SPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICK
    YPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGSGSTANLA
    SSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMS
    LCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWN
    FGLQPPPGGTLEDTYRFVTSQAIACQKHGLNDIFEAQKIEWHETPPAPKEDPLKKYTF
    WEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRK
    LELSGR
    >SEQ ID NO: 2 [HI-loop, HPV genotype 16] L1Avi2 Protein
    MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
    KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
    GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG
    SPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICK
    YPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGXXWIYXXQ
    XLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRST
    NMSLCAAISTSGLNDIFEAQKIEWHEETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTA
    DVMTYIHSMNSTILEDWNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKK
    YTFWEVNLKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRK
    KRKLELSGR
    >SEQ ID NO: 3 [DE-loop, HPV genotype 16] L1avi3 Protein
    MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
    KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
    GISGHPLLNKLDDTENASAGLNDIFEAQKIEWHEAGVDNRECISMDYKQTQLCLIGCK
    PPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSE
    VPLDICTSICKYPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIK
    GSGSTANLASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVV
    DTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHS
    MNSTILEDWNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVN
    LKEKFSADLDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKLEL
    >SEQ ID NO: 4 [FG-loop HPV genotype 16] L1avi4) Protein
    MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
    KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
    GISGHPLLNKLDDTENASAAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKGSPCT
    NVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSICKYPDYI
    KMVSEPYGDSLFFYLRREQMFVRHLFNRAGAVGENVPDDLYIKGLNDIFEAQKIEWH
    EASSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTN
    MSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILED
    WNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSAD
    LDQFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKLELSGRF
    >SEQ ID NO: 5 gi|9627108|ref|NP_041332.1| major capsid L1 protein [Human
    papillomavirus type 16] Protein
    MSLWLPSEATVYLPPVPVSKVVSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNN
    KILVPKVSGLQYRVFRIHLPDPNKFGFPDTSFYNPDTQRLVWACVGVEVGRGQPLGV
    GISGHPLLNKLDDTENASAYAANAGVDNRECISMDYKQTQLCLIGCKPPIGEHWGKG
    SPCTNVAVNPGDCPPLELINTVIQDGDMVHTGFGAMDFTTLQANKSEVPLDICTSICK
    YPDYIKMVSEPYGDSLFFYLRREQMFVRHLFNRAGTVGENVPDDLYIKGSGSTANLA
    SSNYFPTPSGSMVTSDAQIFNKPYWLQRAQGHNNGICWGNQLFVTVVDTTRSTNMS
    LCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLTADVMTYIHSMNSTILEDWN
    FGLQPPPGGTLEDTYRFVTQAIACQKHTPPAPKEDDPLKKYTFWEVNLKEKFSADLD
    QFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKL
    >SEQ ID NO: 6 L1Avi2 (HIloop, HPV118genotype) Protein
    MAVWQAASGKVYLPPSTPVARVQSTDEYVERTNIYYHAFTDRLLTVGHPYFNIFNND
    GNKLEVPKVSGNQHRVFRLRLPDPNRFALADMSVYNPDKERLVWAITGLEIGRGQPL
    GVGTSGHPLFNKFNDTENGNKYTNTSTDDRQNISFDPKQLQMFIIGCTPCIGEHWDR
    APACVEDEQLGRCPPIELVNTFIQDDDMADIGYGNLNFKALQQNRSDVSLDIVDEICKY
    PDFLKMQNDVYGDACFFYARREQCYARRFFVRGGKPGDDIPAEQIDAGKLKNEFYIP
    AAGGQAQGQLGNSMYFPTVSGSLVSSDAQLFNRPFWLQRAQGHNNGILWGNQLFV
    TVLDNTRNTNFSIAVYSEGLNDIFEAQKIEWHEQDIANYDSSKSREYQRHVEEYEVSMI
    LQLCKIPLKPEVLAHINAMNPAILEDWQLGFIPTPDNPIHDTYRYIDSLATRCPDKVPAK
    EKEDPYGKYVFWNVDLSERLSLDLDQYPLGRKFLFQAGLRQKSVNGSVTRTVSRGA
    KRKRKSGR
    >SEQ ID NO: 7 L1avi3 (DEloop, HPV118genotype) Protein
    MAVWQAASGKVYLPPSTPVARVQSTDEYVERTNIYYHAFTDRLLTVGHPYFNIFNND
    GNKLEVPKVSGNQHRVFRLRLPDPNRFALADMSVYNPDKERLVWAITGLEIGRGQPL
    GVGTSGHPLFNKFNDTENGNGLNDIFEAQKIEWHETSTDDRQNISFDPKQLQMFIIGC
    TPCIGEHWDRAPACVEDEQLGRCPPIELVNTFIQDDDMADIGYGNLNFKALQQNRSD
    VSLDIVDEICKYPDFLKMQNDVYGDACFFYARREQCYARRFFVRGGKPGDDIPAEQID
    AGKLKNEFYIPAAGGQAQGQLGNSMYFPTVSGSLVSSDAQLFNRPFWLQRAQGHNN
    GILWGNQLFVTVLDNTRNTNFSIAVYSEQDIANYDSSKSREYQRHVEEYEVSMILQLC
    KIPLKPEVLAHINAMNPAILEDWQLGFIPTPDNPIHDTYRYIDSLATRCPDKVPAKEKED
    PYGKYVFWNVDLSERLSLDLDQYPLGRKFLFQAGLRQKSVNGSVTRTVSRGAKRKR
    KSGRF
    >SEQ ID NO: 8 gi|256807737|gb|ACV30153.1| L1 [Human papillomavirus
    type 118] Protein
    MAVWQAASGKVYLPPSTPVARVQSTDEYVERTNIYYHAFTDRLLTVGHPYFNIFNND
    GNKLEVPKVSGNQHRVFRLRLPDPNRFALADMSVYNPDKERLVWAITGLEIGRGQPL
    GVGTSGHPLFNKFNDTENGNKYTNTSTDDRQNISFDPKQLQMFIIGCTPCIGEHWDR
    APACVEDEQLGRCPPIELVNTFIQDDDMADIGYGNLNFKALQQNRSDVSLDIVDEICKY
    PDFLKMQNDVYGDACFFYARREQCYARRFFVRGGKPGDDIPAEQIDAGKLKNEFYIP
    AAGGQAQGQLGNSMYFPTVSGSLVSSDAQLFNRPFWLQRAQGHNNGILWGNQLFV
    TVLDNTRNTNFSIAVYSEAGKIQDIANYDSSKSREYQRHVEEYEVSMILQLCKIPLKPE
    VLAHINAMNPAILEDWQLGFIPTPDNPIHDTYRYIDSLATRCPDKVPAKEKEDPYGKYV
    FWNVDLSERLSLDLDQYPLGRKFLFQAGLRQKSVNGSVTRTVSRGAKRKRK
    >SEQ ID NO: 9 Avi3 Europaeisk elg papillomavirus (DEloop) Protein
    MAFWQPSQRLYLPPTPVTKVLCSEQYIRRKDVFYHGETERMLTVGHPYYEIKQSGSG
    KTIPKVSPNQYRVFRILLPDPNQFALPDKAMYDPSKERLVWAVVGVQVSRGQPLGGS
    VSGHSYQNTLIDAENVSGLNDIFEAQKIEWHEQGTDDRKQGGMDVKQQQILLLGCTP
    AIGEYWTTARPCVTDRPETGSCPPIELKNKPIEDGDMMDIGFGAANFKELNATKSDLP
    LDIAKDICLYPDYLKMTEEAAGNSMFFFARKEQVYVRHIWSRGGTDKEMPPEAYFLKP
    KGGDQTQKMPSILFGVPSGSLVSTDGQLFNRPYWLFRAQGMNNGICWLNQLFVTVG
    DNTRGTTLTITVPTSGSPLTEYDTSKFNVFQRHVEEYKLAFVFQLCSVTLSPETVSHLQ
    GLMPSILEHWDINMQPPTSSILEDTYRYLESPATKCADNVTPMGPEDPYAGLKFWEV
    NLKERLSLDLDQFPLGRRFLAQQGLGCSTRKRVAPVPKVTEKRIVRKRRKGN
    >SEQ ID NO: 10 sp|P11326|VL1_PAPVE Major capsid protein L1 OS = European
    elk papillomavirus GN = L1 PE = 3 SV = 1 Protein
    MAFWQPSQRLYLPPTPVTKVLCSEQYIRRKDVFYHGETERMLTVGHPYYEIKQSGSG
    KTIPKVSPNQYRVFRILLPDPNQFALPDKAMYDPSKERLVWAVVGVQVSRGQPLGGS
    VSGHSYQNTLIDAENVSKKVNAQGTDDRKQGGMDVKQQQILLLGCTPAIGEYWTTAR
    PCVTDRPETGSCPPIELKNKPIEDGDMMDIGFGAANFKELNATKSDLPLDIAKDICLYP
    DYLKMTEEAAGNSMFFFARKEQVYVRHIWSRGGTDKEMPPEAYFLKPKGGDQTQKM
    PSILFGVPSGSLVSTDGQLFNRPYWLFRAQGMNNGICWLNQLFVTVGDNTRGTTLTIT
    VPTSGSPLTEYDTSKFNVFQRHVEEYKLAFVFQLCSVTLSPETVSHLQGLMPSILEHW
    DINMQPPTSSILEDTYRYLESPATKCADNVTPMGPEDPYAGLKFWEVNLKERLSLDLD
    QFPLGRRFLAQQGLGCSTRKRVAPVPKVTEKRIVRKRRKGN
    >SEQ ID NO: 11 [H4-loop HPV genotype 16] L1Avi1] DNA
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
    GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
    ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
    TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
    CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
    CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
    TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
    CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCTA
    CGCCGCCAACGCCGGTGTCGACAACAGGGAATGCATCTCTATGGACTACAAGCA
    GACCCAGCTGTGCCTGATCGGATGCAAGCCCCCCATCGGAGAACACTGGGGAAA
    GGGATCTCCCTGCACCAACGTCGCCGTCAACCCCGGCGACTGCCCCCCTCTGGA
    ACTGATCAACACCGTCATCCAGGACGGCGACATGGTCGACACCGGATTCGGAGC
    CATGGACTTCACCACCCTGCAGGCCAACAAGTCTGAAGTCCCCCTGGACATCTGC
    ACCTCTATCTGCAAGTACCCCGACTACATCAAGATGGTGTCTGAACCCTACGGCG
    ACTCTCTGTTCTTCTACCTGAGGCGCGAACAGATGTTCGTCAGGCACCTGTTCAA
    CCGCGCCGGTGCCGTCGGAGAAAACGTCCCCGACGACCTGTACATCAAGGGATC
    TGGATCTACCGCCAACCTGGCCTCTTCTAACTACTTCCCTACCCCTTCTGGATCTA
    TGGTCACCTCTGACGCCCAGATCTTCAACAAGCCCTACTGGCTGCAGAGGGCCC
    AGGGACACAACAACGGAATCTGCTGGGGAAACCAGCTGTTCGTCACCGTCGTCG
    ACACCACCAGGTCTACCAACATGTCCCTGTGCGCCGCCATCTCTACCTCTGAAAC
    CACCTACAAGAACACCAACTTCAAAGAATACCTGCGCCACGGCGAAGAATACGAC
    CTGCAGTTCATCTTCCAGCTGTGCAAGATCACCCTGACCGCCGACGTCATGACCT
    ACATCCACTCTATGAACTCTACCATCTTGGAGGACTGGAACTTCGGACTGCAGCC
    CCCTCCCGGTGGAACCCTCGAGGACACCTACCGCTTCGTCACCAGCCAGGCTAT
    CGCCTGCCAGAAGCACGGACTGAACGACATCTTCGAAGCCCAAAAGATCGAATG
    GCACGAAACCCCCCCTGCCCCCAAAGAGGACCCCCTGAAGAAGTACACCTTCTG
    GGAAGTCAACCTGAAAGAAAAGTTCTCTGCCGACCTGGACCAGTTCCCCCTGGGA
    CGCAAGTTCCTGCTGCAAGCCGGACTGAAGGCCAAGCCCAAGTTCACCCTGGGA
    AAGAGGAAGGCCACCCCCACCACCTCTTCTACCTCTACCACCGCCAAGAGGAAG
    AAGCGCAAGCTGGAACTGTAAAGCGGCCGC
    >SEQ ID NO: 12 L1avi2 (HI-loop, HPV16) DNA
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
    GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
    ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
    TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
    CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
    CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
    TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
    CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCTA
    CGCCGCCAACGCCGGTGTCGACAACAGGGAATGCATCTCTATGGACTACAAGCA
    GACCCAGCTGTGCCTGATCGGATGCAAGCCCCCCATCGGAGAACACTGGGGAAA
    GGGATCTCCCTGCACCAACGTCGCCGTCAACCCCGGCGACTGCCCCCCTCTGGA
    ACTGATCAACACCGTCATCCAGGACGGCGACATGGTCGACACCGGATTCGGAGC
    CATGGACTTCACCACCCTGCAGGCCAACAAGTCTGAAGTCCCCCTGGACATCTGC
    ACCTCTATCTGCAAGTACCCCGACTACATCAAGATGGTGTCTGAACCCTACGGCG
    ACTCTCTGTTCTTCTACCTGAGGCGCGAACAGATGTTCGTCAGGCACCTCTTCAA
    CAGGGCCGGTGCCGTCGGAGAAAACGTCCCCGACGACCTGTACATCAAGGGATC
    TGGATCTACCGCCAACCTGGCCTCTTCTAACTACTTCCCTACCCCTTCTGGATCTA
    TGGTCACCTCTGACGCCCAGATCTTCAACAAGCCCTACTGGCTGCAGAGGGCCC
    AGGGACACAACAACGGAATCTGCTGGGGAAACCAGCTGTTCGTCACCGTCGTCG
    ACACCACCAGGTCTACCAACATGTCCCTGTGCGCCGCCATCTCTACCTCTGGACT
    GAACGACATCTTCGAGGCCCAAAAGATCGAATGGCACGAGGAAACCACCTACAAG
    AACACCAACTTCAAAGAATACCTGCGCCACGGCGAAGAATACGACCTGCAGTTCA
    TCTTCCAGCTGTGCAAGATCACCCTGACCGCCGACGTCATGACCTACATCCACTC
    TATGAACTCTACCATCTTGGAGGATTGGAACTTCGGACTGCAGCCCCCTCCCGGT
    GGAACCCTCGAGGACACCTACCGCTTCGTCACCAGCCAGGCTATCGCCTGCCAG
    AAGCACACCCCCCCTGCCCCCAAAGAGGACCCCCTGAAGAAGTACACCTTCTGG
    GAAGTCAACCTGAAAGAAAAGTTCTCTGCCGACCTGGACCAGTTCCCCCTGGGAC
    GCAAGTTCCTGCTGCAAGCCGGACTGAAGGCCAAGCCCAAGTTCACCCTGGGAA
    AGAGGAAGGCCACCCCCACCACCTCTTCTACCTCTACCACCGCCAAGAGGAAGA
    AGCGCAAGCTGGAACTGTAAAGCGGCCGC
    >SEQ ID NO: 13 L1avi3 (DE-loop, HPV16)
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
    GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
    ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
    TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
    CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
    CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
    TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
    CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCGG
    ACTGAACGACATCTTCGAGGCCCAAAAGATCGAATGGCACGAGGCCGGTGTCGA
    CAACAGGGAATGCATCTCTATGGACTACAAGCAGACCCAGCTGTGCCTGATCGGA
    TGCAAGCCCCCCATCGGAGAACACTGGGGAAAGGGATCTCCCTGCACCAACGTC
    GCCGTCAACCCCGGCGACTGCCCCCCTCTGGAACTGATCAACACCGTCATCCAG
    GACGGCGACATGGTCGACACCGGATTCGGAGCCATGGACTTCACCACCCTGCAG
    GCCAACAAGTCTGAAGTCCCCCTGGACATCTGCACCTCTATCTGCAAGTACCCCG
    ACTACATCAAGATGGTGTCTGAACCCTACGGCGACTCTCTGTTCTTCTACCTGAG
    GCGCGAACAGATGTTCGTCAGGCACCTCTTCAACAGGGCCGGTGCCGTCGGAGA
    AAACGTCCCCGACGACCTGTACATCAAGGGATCTGGATCTACCGCCAACCTGGCC
    TCTTCTAACTACTTCCCTACCCCTTCTGGATCTATGGTCACCTCTGACGCCCAGAT
    CTTCAACAAGCCCTACTGGCTGCAGAGGGCCCAGGGACACAACAACGGAATCTG
    CTGGGGAAACCAGCTGTTCGTCACCGTCGTCGACACCACCAGGTCTACCAACATG
    TCCCTGTGCGCCGCCATCTCTACCTCTGAAACCACCTACAAGAACACCAACTTCA
    AAGAATACCTGCGCCACGGCGAAGAATACGACCTGCAGTTCATCTTCCAGCTGTG
    CAAGATCACCCTGACCGCCGACGTCATGACCTACATCCACTCTATGAACTCTACC
    ATCTTGGAGGATTGGAACTTCGGACTGCAGCCCCCTCCCGGTGGAACCCTCGAG
    GACACCTACCGCTTCGTCACCAGCCAGGCTATCGCCTGCCAGAAGCACACCCCC
    CCTGCCCCCAAAGAGGACCCCCTGAAGAAGTACACCTTCTGGGAAGTCAACCTGA
    AAGAAAAGTTCTCTGCCGACCTGGACCAGTTCCCCCTGGGACGCAAGTTCCTGCT
    GCAAGCCGGACTGAAGGCCAAGCCCAAGTTCACCCTGGGAAAGAGGAAGGCCAC
    CCCCACCACCTCTTCTACCTCTACCACCGCCAAGAGGAAGAAGCGCAAGCTGGAA
    CTGTAAAGCGGCCGC
    >SEQ ID NO: 14 L1avi4 (FG-loop, HPV16)
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGTCTCTGTGGCTGCCCTCTGAA
    GCCACCGTCTACCTGCCCCCCGTCCCTGTCTCTAAGGTCGTCAGCACCGACGAAT
    ACGTCGCCAGGACCAACATCTACTACCACGCCGGAACCTCTAGGCTGCTGGCCG
    TCGGACACCCCTACTTCCCCATCAAGAAGCCCAACAACAACAAGATCCTGGTCCC
    CAAGGTGTCCGGACTGCAGTACAGGGTGTTCAGGATCCACCTCCCCGACCCCAA
    CAAGTTCGGATTCCCCGACACCTCTTTCTACAACCCCGACACCCAGAGGCTCGTC
    TGGGCCTGCGTCGGAGTCGAAGTCGGAAGGGGACAGCCCCTGGGAGTCGGAAT
    CTCTGGACACCCCCTGCTGAACAAGCTGGACGACACCGAAAACGCCTCTGCCTA
    CGCCGCCAACGCCGGTGTCGACAACAGGGAATGCATCTCTATGGACTACAAGCA
    GACCCAGCTGTGCCTGATCGGATGCAAGCCCCCCATCGGAGAACACTGGGGAAA
    GGGATCTCCCTGCACCAACGTCGCCGTCAACCCCGGCGACTGCCCCCCTCTGGA
    ACTGATCAACACCGTCATCCAGGACGGCGACATGGTCGACACCGGATTCGGAGC
    CATGGACTTCACCACCCTGCAGGCCAACAAGTCTGAAGTCCCCCTGGACATCTGC
    ACCTCTATCTGCAAGTACCCCGACTACATCAAGATGGTGTCTGAACCCTACGGCG
    ACTCTCTGTTCTTCTACCTGAGGCGCGAACAGATGTTCGTCAGGCACCTCTTCAA
    CAGGGCCGGTGCCGTCGGAGAAAACGTCCCCGACGACCTGTACATCAAGGGACT
    GAACGACATCTTCGAGGCCCAAAAGATCGAATGGCACGAGGCCTCTTCTAACTAC
    TTCCCTACCCCTTCTGGATCTATGGTCACCTCTGACGCCCAGATCTTCAACAAGCC
    CTACTGGCTGCAGAGGGCCCAGGGACACAACAACGGAATCTGCTGGGGAAACCA
    GCTGTTCGTCACCGTCGTCGACACCACCAGGTCTACCAACATGTCCCTGTGCGCC
    GCCATCTCTACCTCTGAAACCACCTACAAGAACACCAACTTCAAAGAATACCTGCG
    CCACGGCGAAGAATACGACCTGCAGTTCATCTTCCAGCTGTGCAAGATCACCCTG
    ACCGCCGACGTCATGACCTACATCCACTCTATGAACTCTACCATCTTGGAGGATT
    GGAACTTCGGACTGCAGCCCCCTCCCGGTGGAACCCTCGAGGACACCTACCGCT
    TCGTCACCAGCCAGGCTATCGCCTGCCAGAAGCACACCCCCCCTGCCCCCAAAG
    AGGACCCCCTGAAGAAGTACACCTTCTGGGAAGTCAACCTGAAAGAAAAGTTCTC
    TGCCGACCTGGACCAGTTCCCCCTGGGACGCAAGTTCCTGCTGCAAGCCGGACT
    GAAGGCCAAGCCCAAGTTCACCCTGGGAAAGAGGAAGGCCACCCCCACCACCTC
    TTCTACCTCTACCACCGCCAAGAGGAAGAAGCGCAAGCTGGAACTGTAAAGCGG
    CCGC
    >SEQ ID NO: 15 L1avi2 (HI-loop, HPV118)
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGGCCGTCTGGCAGGCCGCCTC
    TGGAAAGGTCTACCTGCCCCCCTCTACCCCCGTCGCCAGGGTCCAGTCTACCGA
    CGAATACGTCGAAAGGACCAACATCTACTACCACGCCTTCACCGACAGGCTGCTG
    ACCGTCGGACACCCCTACTTCAACATCTTCAACAACGACGGAAACAAGCTCGAAG
    TCCCCAAGGTGTCCGGAAACCAGCACAGGGTGTTCAGGCTGAGGCTGCCCGACC
    CCAACCGCTTCGCCCTGGCCGACATGTCTGTCTACAACCCCGACAAAGAAAGGCT
    CGTCTGGGCCATCACCGGACTGGAAATCGGAAGGGGACAGCCCCTGGGAGTCG
    GAACCTCTGGACACCCCCTGTTCAACAAGTTCAACGACACCGAAAACGGCAACAA
    GTACACCAACACCTCCACCGACGACAGGCAGAACATCTCTTTCGACCCCAAGCAG
    CTGCAGATGTTCATCATCGGATGCACCCCCTGCATCGGAGAACACTGGGACAGG
    GCCCCTGCCTGCGTCGAGGACGAACAGCTGGGAAGGTGCCCCCCCATCGAACTG
    GTCAACACCTTCATCCAGGACGACGACATGGCCGACATCGGATACGGAAACCTGA
    ACTTCAAGGCCCTGCAGCAGAACCGCTCTGACGTGTCCCTGGACATCGTCGACG
    AAATCTGCAAGTACCCCGACTTCCTGAAGATGCAGAACGACGTCTACGGCGACGC
    CTGCTTCTTCTACGCTAGGCGCGAACAGTGCTACGCCAGGCGCTTCTTCGTCCGC
    GGAGGAAAGCCCGGCGACGACATCCCCGCCGAACAGATCGACGCCGGAAAGCT
    GAAGAACGAATTCTACATCCCTGCCGCCGGTGGACAGGCCCAGGGACAGCTCGG
    AAACTCTATGTACTTCCCCACCGTCAGCGGATCTCTCGTCAGCTCTGACGCCCAG
    CTGTTCAACAGGCCCTTCTGGCTGCAGCGCGCTCAGGGACACAACAACGGAATC
    CTGTGGGGAAACCAGTTGTTCGTCACCGTCCTGGACAACACCCGCAACACCAACT
    TCTCTATCGCCGTCTACTCTGAGGGACTGAACGACATCTTCGAAGCCCAAAAGAT
    CGAATGGCACGAGCAGGACATTGCCAACTACGACTCTTCTAAGTCTAGGGAATAC
    CAGCGCCACGTCGAAGAGTACGAAGTCTCTATGATCCTGCAGCTGTGCAAGATCC
    CCCTGAAGCCCGAAGTCCTGGCCCACATCAACGCCATGAACCCCGCCATCTTGG
    AGGACTGGCAGCTGGGATTCATCCCCACCCCCGACAACCCCATCCACGACACCT
    ACCGCTACATCGACTCCCTGGCCACCAGGTGCCCTGACAAGGTCCCCGCCAAAG
    AAAAAGAGGACCCCTACGGCAAATACGTGTTCTGGAACGTCGACCTGTCTGAAAG
    GCTGTCTCTGGACCTGGACCAGTACCCCCTGGGACGCAAGTTCCTGTTCCAAGC
    CGGACTGAGGCAGAAGTCTGTCAACGGATCTGTCACCAGGACCGTCAGCAGGGG
    AGCCAAGAGGAAGCGCAAGTAAAGCGGCCGC
    >SEQ ID NO: 16 L1avi3 (DE-loop, HPV118)
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGGCCGTCTGGCAGGCCGCCTC
    TGGAAAGGTCTACCTGCCCCCCTCTACCCCCGTCGCCAGGGTCCAGTCTACCGA
    CGAATACGTCGAAAGGACCAACATCTACTACCACGCCTTCACCGACAGGCTGCTG
    ACCGTCGGACACCCCTACTTCAACATCTTCAACAACGACGGAAACAAGCTCGAAG
    TCCCCAAGGTGTCCGGAAACCAGCACAGGGTGTTCAGGCTGAGGCTGCCCGACC
    CCAACCGCTTCGCCCTGGCCGACATGTCTGTCTACAACCCCGACAAAGAAAGGCT
    CGTCTGGGCCATCACCGGACTGGAAATCGGAAGGGGACAGCCCCTGGGAGTCG
    GAACCTCTGGACACCCCCTGTTCAACAAGTTCAACGACACCGAAAACGGCAACGG
    ACTGAACGACATCTTCGAAGCCCAAAAGATCGAATGGCACGAGACCTCCACCGAC
    GACAGGCAGAACATCTCTTTCGACCCCAAGCAGCTGCAGATGTTCATCATCGGAT
    GCACCCCCTGCATCGGAGAACACTGGGACAGGGCCCCTGCCTGCGTCGAGGAC
    GAACAGCTGGGAAGGTGCCCCCCCATCGAACTGGTCAACACCTTCATCCAGGAC
    GACGACATGGCCGACATCGGATACGGAAACCTGAACTTCAAGGCCCTGCAGCAG
    AACCGCTCTGACGTGTCCCTGGACATCGTCGACGAAATCTGCAAGTACCCCGACT
    TCCTGAAGATGCAGAACGACGTCTACGGCGACGCCTGCTTCTTCTACGCTAGGCG
    CGAACAGTGCTACGCCAGGCGCTTCTTCGTCCGCGGAGGAAAGCCCGGCGACGA
    CATCCCCGCCGAACAGATCGACGCCGGAAAGCTGAAGAACGAATTCTACATCCCT
    GCCGCCGGTGGACAGGCCCAGGGACAGCTCGGAAACTCTATGTACTTCCCCACC
    GTCAGCGGATCTCTCGTCAGCTCTGACGCCCAGCTGTTCAACAGGCCCTTCTGGC
    TGCAGCGCGCTCAGGGACACAACAACGGAATCCTGTGGGGAAACCAGTTGTTCG
    TCACCGTCCTGGACAACACCCGCAACACCAACTTCTCTATCGCCGTCTACTCTGA
    GGCCGGAAAGATCCAGGACATTGCCAACTACGACTCTTCTAAGTCTAGGGAATAC
    CAGCGCCACGTCGAAGAGTACGAAGTCTCTATGATCCTGCAGCTGTGCAAGATCC
    CCCTGAAGCCCGAAGTCCTGGCCCACATCAACGCCATGAACCCCGCCATCTTGG
    AGGACTGGCAGCTGGGATTCATCCCCACCCCCGACAACCCCATCCACGACACCT
    ACCGCTACATCGACTCCCTGGCCACCAGGTGCCCTGACAAGGTCCCCGCCAAAG
    AAAAAGAGGACCCCTACGGCAAATACGTGTTCTGGAACGTCGACCTGTCTGAAAG
    GCTGTCTCTGGACCTGGACCAGTACCCCCTGGGACGCAAGTTCCTGTTCCAAGC
    CGGACTGAGGCAGAAGTCTGTCAACGGATCTGTCACCAGGACCGTCAGCAGGGG
    AGCCAAGAGGAAGCGCAAGTAAAGCGGCCGC
    >SEQ ID NO: 17 PAPVE-L1 avi3
    GATATCATGGAGATAATTAAAATGATAACCATCTCGCAAATAAATAAGTATTTTACT
    GTTTTCGTAACAGTTTTGTAATAAAAAAACCTATAAATATTCCGGATTATTCATACC
    GTCCCACCATCGGGCGCGGATCTCTACTAGTATGGCCTTCTGGCAGCCCTCTCAG
    CGTCTGTACCTGCCCCCCACCCCCGTCACCAAGGTCCTGTGCTCTGAACAGTACA
    TCAGGCGCAAGGACGTGTTCTACCACGGCGAAACCGAAAGGATGCTGACCGTCG
    GACACCCCTACTACGAAATCAAGCAGTCTGGATCTGGAAAGACCATCCCCAAGGT
    GTCCCCCAACCAGTACAGGGTGTTCAGGATCCTGCTGCCCGACCCTAACCAGTTC
    GCCCTGCCCGACAAGGCTATGTACGACCCCTCTAAGGAAAGGCTCGTCTGGGCC
    GTCGTCGGAGTCCAGGTGTCCCGTGGACAGCCTCTGGGAGGATCTGTCTCTGGA
    CACTCTTACCAGAACACCCTGATCGACGCCGAAAACGTGTCCGGACTGAACGACA
    TCTTCGAAGCCCAAAAGATCGAATGGCACGAACAGGGAACCGACGACCGCAAGC
    AGGGTGGAATGGACGTCAAGCAGCAGCAGATCCTGCTCCTGGGATGCACCCCCG
    CCATCGGAGAATACTGGACCACCGCCAGGCCCTGCGTCACCGACAGGCCCGAAA
    CCGGATCTTGCCCCCCCATCGAACTGAAGAACAAGCCCATCGAGGACGGCGACA
    TGATGGACATCGGATTCGGAGCCGCCAACTTCAAGGAACTGAACGCCACCAAGTC
    TGACCTGCCCCTGGACATCGCCAAGGACATCTGCCTGTACCCCGACTACCTGAAG
    ATGACCGAAGAAGCCGCCGGAAACTCTATGTTCTTCTTCGCCCGCAAGGAACAGG
    TCTACGTCCGCCACATCTGGTCCCGCGGAGGAACCGACAAGGAAATGCCCCCCG
    AAGCCTACTTCCTGAAGCCCAAGGGTGGCGACCAGACCCAGAAGATGCCCTCTAT
    CCTGTTCGGAGTCCCCTCTGGATCTCTCGTCAGCACCGACGGACAGCTGTTCAAC
    AGGCCCTACTGGCTGTTCAGGGCCCAGGGAATGAACAACGGAATCTGCTGGCTG
    AACCAGCTGTTCGTCACCGTCGGAGACAACACCAGGGGAACCACCCTGACCATC
    ACCGTCCCCACCTCTGGATCCCCCCTGACCGAATACGACACCTCCAAGTTCAACG
    TGTTCCAGAGGCACGTCGAAGAGTACAAGCTGGCCTTCGTGTTCCAGCTGTGCTC
    TGTCACCCTGTCTCCCGAAACCGTCAGCCACCTCCAGGGACTGATGCCTTCCATC
    CTGGAACACTGGGACATCAACATGCAGCCCCCCACCTCTTCTATCCTCGAGGACA
    CCTACCGCTACCTGGAATCTCCTGCCACCAAGTGCGCCGACAACGTCACCCCCAT
    GGGACCCGAGGACCCCTACGCCGGACTGAAGTTCTGGGAAGTCAACCTGAAGGA
    ACGCCTGTCCCTGGACCTGGACCAGTTCCCCCTGGGAAGGCGCTTCCTGGCCCA
    GCAGGGACTGGGATGCTCTACCCGCAAGAGGGTCGCCCCCGTCCCTAAGGTCAC
    CGAAAAGAGGATCGTCCGCAAGAGGCGCAAGGGAAACTAAAGCGGCCGCTAA
    >SEQ ID NO: 18 A1 >mSA- Her2-ECD|23-686
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVKGGSTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLS
    FLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVT
    GASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRS
    RACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAG
    CTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
    YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAV
    TSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAW
    PDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHL
    CFVHTVPWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCV
    NCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQC
    VACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHSCVDLDDK
    GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTHHHHHH
    >SEQ ID NO: 19 A2 >mSA-IL-5(C63T/C105T)
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVKGGSIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLTTEEIFQGIGTL
    ESQTVQGGTVERLFKNLSLIKKYIDGQKKKTGEERRRVNQFLDYLQEFLGVMNTEWII
    ES*SGRK
    >SEQ ID NO: 20 A3 >PCSK9|31-692|:mSA:HIS
    QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETH
    LSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEED
    SSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTD
    FENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKG
    TVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGN
    FRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDC
    STCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQ
    RVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSF
    SRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEAS
    MGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASC
    CHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVV
    RSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQGGSAEAGITGTWYNQHGSTFT
    VTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRT
    EWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTFTKVKHHHHHH
    >SEQ ID NO: 21 A4 >mSA-ID1ID2a-HIS
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVKGGSNYIKGDPYFAEYATKLSFILNPSDANNPSGETANHNDEACNCNESGISSVG
    QAQTSGPSSNKTCITHSSIKTNKKKECKDVKLGVRENDKDLKICVIEDTSLSGVDNCC
    CQDLLGILQENCSDNKRGSSSNDSCDNKNQDECQKKLEKVFASLTNGYKCDKCKSG
    TSRSKKKWIWKKSSGNEEGLQEEYANTIGLPPRTQSLYLGNLPKLENVCEDVKDINFD
    TKEKFLAGCLIVSFHEGKNLKKRYPQNKNSGNKENLCKALEYSFADYGDLIKGTSIWD
    NEYTKDLELNLQNNFGKLFGKYIKKNNTAEQDTSYSSLDELRESWWNTNKKYIWTAM
    KHGAEMNITTCNADGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVENFCEQRQAKVKDV
    ITNCKSCKESGNKCKTECKTKCKDECEKYKKFIEACGTAGGGIGTAGSPWSKRWDQI
    YKRYSKHIEDAKRNRKAGTKNCGTSSTTNAAASTDENKCVQSDIDSFFKHLIDIGLTTP
    SSYLSNVLDDNICGADKAPWTTYTTYTTTEKCNKERDKSKSQSSDTLVVVNVPSPLG
    NTPYRYKYACQCKIPTNEETCDDRKEYMNQWSCGSARTMKRGYKNDNYELCKYNG
    VDVKPTTVRSNSSKLDHHHHHH
    >SEQ ID NO: 22 A5 >mSA-RO-HIS
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVKGGSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQS
    EKSLVSENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSD
    IISENNKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPL
    EPFPTQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLK
    LKSFDEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQN
    SQIPSLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQS
    QHNINVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHE
    TFEEETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNEN
    EFVESEKSEHEARSKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENI
    SKENDDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEEEEEEKEEENDKKKEQ
    EKEQSNENNDQKKDMEAQNLISKNQNNNEKNVKEAAESIMKTLAGLIKGNNQIDSTLK
    DLVEELSKYFKNHRSHHHHHH
    >SEQ ID NO: 23 A6 >HIS-RO-mSA
    GSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLV
    SENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISEN
    NKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFP
    TQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSF
    DEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIP
    SLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNI
    NVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEE
    ETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNENEFVE
    SEKSEHEAGGSGAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNS
    PYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGG
    SGPATEQGQDTFTKVK
    >SEQ ID NO: 24 A7 >HIS-GMZ2ggsmSA
    GSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLV
    SENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISEN
    NKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFP
    TQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSF
    DEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIP
    SLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNI
    NVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEE
    ETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNENEFVE
    SEKSEHEARSKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENISKEN
    DDVLDEKEEEAEETEEEELEEKNEEETESEISEDEEEEEEEEEKEEENDKKKEQEKEQ
    SNENNDQKKDMEAQNLISKNQNNNEKNVKEAAESIMKTLAGLIKGNNQIDSTLKDLVE
    ELSKYFKNHGGSGAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQN
    SPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEG
    GSGPATEQGQDTFTKVK
    >SEQ ID NO:25 A8 >HIS-GMZ2T:ggsmSA
    GSTSENRNKRIGGPKLRGNVTSNIKFPSDNKGKIIRGSNDKLNKNSEDVLEQSEKSLV
    SENVPSGLDIDDIPKESIFIQEDQEGQTHSELNPETSEHSKDLNNNGSKNESSDIISEN
    NKSNKVQNHFESLSDLELLENSSQDNLDKDTISTEPFPNQKHKDLQQDLNDEPLEPFP
    TQIHKDYKEKNLINEEDSEPFPRQKHKKVDNHNEEKNVFHENGSANGNQGSLKLKSF
    DEHLKDEKIENEPLVHENLSIPNDPIEQILNQPEQETNIQEQLYNEKQNVEEKQNSQIP
    SLDLKEPTNEDILPNHNPLENIKQSESEINHVQDHALPKENIIDKLDNQKEHIDQSQHNI
    NVLQENNINNHQLEPQEKPNIESFEPKNIDSEIILPENVETEEIIDDVPSPKHSNHETFEE
    ETSESEHEEAVSEKNAHETVEHEETVSQESNPEKADNDGNVSQNSNNELNENEFVE
    SEKSEHEARSKTKEYAEKAKNAYEKAKNAYQKANQAVLKAKEASSYDYILGWEFGGG
    VPEHKKEENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELEGGSGAEAGIT
    GTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVE
    WNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTFTKVK
    >SEQ ID NO: 26 A9 >mSA-PfRH5-HIS
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVKGGSLSFENAIKKTKNQENNLTLLPIKSTEEEKDDIKNGKDIKKEIDNDKENIKTNN
    AKDHSTYIKSYLNTNVNDGLKYLFIPSHNSFIKKYSVFNQINDGMLLNEKNDVKNNEDY
    KNVDYKNVNFLQYHFKELSNYNIANSIDILQEKEGHLDFVIIPHYTFLDYYKHLSYNSIYH
    KYSTYGKYIAVDAFIKKINETYDKVKSKCNDIKNDLIATIKKLEHPYDINNKNDDSYRYDI
    SEEIDDKSEETDDETEEVEDSIQDTDSNHTPSNKKKNDLMNRTFKKMMDEYNTKKKK
    LIKCIKNHENDFNKICMDMKNYGTNLFEQLSCYNNNFCNTNGIRFHYDEYIHKLILSVKS
    KNLNKDLSDMTNILQQSELLLTNLNKKMGSYIYIDTIKFIHKEMKHIFNRIEYHTKIINDKT
    KIIQDKIKLNIWRTFQKDELLKRILDMSNEYSLFITSDHLRQMLYNTFYSKEKHLNNIFHH
    LIYVLQMKFNDVPIKMEYFQTYKKNKPLTQHHHHHH
    >SEQ ID NO: 27 A10 >mSA-Pfs25-HIS
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVKGGSNKLYSLFLFLFIQLSIKYNNAKVTVDTVCKRGFLIQMSGHLECKCENDLVLV
    NEETCEEKVLKCDEKTVNKPCGDFSKCIKIDGNPVSYACKCNLGYDMVNNVCIPNEC
    KNVTCGNGKCILDTSNPVKTGVCSCNIGKVPNVQDQNKCSKDGETKCSLKCLKENET
    CKAVDGIYKCDCKDGFIIDNESSICTAFSAYNILNLSIMFILFSVCFFIM
    >SEQ ID NO: 28 A11 >HIS-PfCSP(aa92-397)-mSA
    KLKQPADGNPDPNANPNVDPNANPNVDPNANPNVDPNANPNANPNANPNANPNAN
    PNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNVDPNA
    NPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPNANPN
    ANPNANPNANPNANPNKNNQGNGQGHNMPNDPNRNVDENANANSAVKNNNNEEP
    SDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICK
    MEKCSSVFNVVNSSIGLIMVLSFLFLNGGSAEAGITGTVVYNQHGSTFTVTAGADGNLT
    GQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGG
    AEARINTQWNLTYEGGSGPATEQGQDTFTKVK
    >SEQ ID NO: 29 A3 >PCSK9|31-692|:mSA:HIS DNA
    TTTCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCT
    GGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTAC
    GTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGC
    GTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAA
    TGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACT
    CCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAA
    GCAGAGCTCTCTGGCTAACTAGAGAACCCACTGCTTACTGGCTTATCGAAATTAAT
    ACGACTCACTATAGGGAGACCCAAGCTGGCTAGCGTTTAAACTTAAGCTTAGCGC
    AGAGGCTTGGGGCAGCCGAGCGGCAGCCAGGCCCCGGCCCGGGCCTCGGTTCC
    AGAAGGGAGAGGAGCCCGCCAAGGCGCGCAAGAGAGCGGGCTGCCTCGCAGTC
    CGAGCCGGAGAGGGAGCGCGAGCCGCGCCGGCCCCGGACGGCCTCCGAAACC
    ATGCAGGAAGATGAGGACGGCGACTACGAGGAACTGGTGCTGGCCCTGCGGAG
    CGAAGAGGATGGACTGGCCGAGGCCCCTGAGCACGGCACCACCGCCACCTTCC
    ACAGATGCGCCAAGGACCCTTGGCGGCTGCCCGGCACATACGTGGTGGTGCTGA
    AAGAGGAAACCCACCTGAGCCAGAGCGAGCGGACCGCCAGAAGGCTGCAGGCC
    CAGGCCGCCAGAAGAGGCTACCTGACCAAGATCCTGCACGTGTTCCACGGCCTG
    CTGCCCGGCTTCCTGGTGAAAATGAGCGGCGACCTGCTGGAACTGGCCCTGAAG
    CTGCCCCACGTGGACTACATCGAAGAGGACAGCAGCGTGTTCGCCCAGAGCATC
    CCCTGGAACCTGGAACGGATCACCCCCCCCAGATACCGGGCCGACGAGTACCAG
    CCTCCTGACGGCGGCAGCCTGGTGGAAGTGTACCTGCTGGACACCAGCATCCAG
    AGCGACCACCGCGAGATCGAGGGCAGAGTGATGGTGACAGACTTCGAGAACGTG
    CCCGAAGAGGACGGCACCCGGTTCCACAGACAGGCCAGCAAGTGCGACAGCCA
    CGGCACACATCTGGCCGGCGTGGTGTCTGGCAGAGATGCCGGCGTGGCCAAGG
    GCGCCAGCATGAGAAGCCTGCGGGTGCTGAACTGCCAGGGCAAGGGCACCGTG
    TCCGGCACCCTGATCGGCCTGGAATTCATCCGGAAGTCCCAGCTGGTGCAGCCC
    GTGGGCCCTCTGGTGGTGCTGCTGCCTCTGGCTGGCGGCTACAGCAGAGTGCTG
    AACGCCGCCTGCCAGAGACTGGCCAGAGCTGGCGTGGTGCTGGTGACAGCCGC
    CGGAAACTTCCGGGACGACGCCTGCCTGTACAGCCCCGCCTCTGCCCCCGAAGT
    GATCACCGTGGGCGCCACCAACGCCCAGGACCAGCCTGTGACACTGGGCACCCT
    GGGCACAAACTTCGGCAGATGCGTGGACCTGTTCGCCCCTGGCGAGGACATCAT
    CGGCGCCAGCAGCGACTGCAGCACCTGTTTCGTGTCCCAGAGCGGCACCAGCCA
    GGCCGCTGCCCATGTGGCCGGAATCGCCGCCATGATGCTGAGCGCCGAGCCTG
    AGCTGACCCTGGCCGAGCTGCGGCAGCGGCTGATCCACTTCTCCGCCAAGGACG
    TGATCAACGAGGCCTGGTTCCCCGAGGACCAGAGAGTGCTGACCCCCAACCTGG
    TGGCCGCCCTGCCTCCTTCTACACACGGCGCTGGCTGGCAGCTGTTCTGCAGGA
    CAGTGTGGTCCGCCCACAGCGGCCCCACCAGAATGGCCACAGCCGTGGCCAGAT
    GCGCCCCTGATGAGGAACTGCTGAGCTGCAGCAGCTTCTCCAGAAGCGGCAAGC
    GGAGAGGCGAGCGGATGGAAGCCCAGGGCGGCAAGCTCGTGTGCAGAGCCCAC
    AATGCCTTCGGCGGCGAGGGCGTGTACGCCATTGCCAGATGCTGCCTGCTGCCT
    CAGGCCAACTGCAGCGTGCACACAGCCCCTCCAGCCGAGGCCAGCATGGGCAC
    CAGAGTGCACTGCCACCAGCAGGGCCACGTGCTGACCGGCTGTAGCAGCCACTG
    GGAGGTGGAAGATCTGGGCACCCACAAGCCCCCCGTGCTGAGGCCCAGAGGCC
    AGCCTAATCAGTGCGTGGGCCACAGAGAGGCCTCCATCCACGCCAGCTGTTGCC
    ACGCCCCTGGCCTGGAATGCAAAGTGAAAGAGCACGGCATCCCTGCCCCCCAGG
    AACAGGTCACAGTGGCCTGCGAGGAAGGCTGGACCCTGACAGGCTGTTCCGCCC
    TGCCAGGCACCTCTCACGTGCTGGGCGCCTACGCCGTGGACAATACCTGCGTCG
    TGCGCAGCCGGGACGTGTCCACAACCGGCTCTACAAGCGAGGGCGCCGTGACC
    GCCGTGGCCATCTGCTGCAGAAGCAGACACCTGGCCCAGGCCTCCCAGGAACTG
    CAGGGCGGATCTGCCGAGGCCGGCATCACCGGCACCTGGTACAATCAGCACGG
    CAGCACCTTCACCGTGACCGCTGGCGCCGACGGCAACCTGACCGGCCAGTACGA
    GAACAGAGCCCAGGGCACCGGCTGCCAGAACAGCCCTTACACCCTGACCGGCAG
    ATACAACGGCACCAAGCTGGAATGGCGGGTGGAATGGAACAACAGCACCGAGAA
    CTGCCACAGCCGGACCGAGTGGCGGGGACAGTATCAGGGCGGAGCCGAGGCCC
    GGATCAACACCCAGTGGAACCTGACCTACGAGGGCGGCTCTGGCCCTGCCACAG
    AGCAGGGACAGGACACCTTCACCAAAGTGAAGCACCACCACCATCACCACTAAGC
    GGCCGCTTTT
    >SEQ ID NO: 30 A4 >mSA-ID1ID2a-HIS DNA
    CCATGGGCGGTGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTA
    GCACCTTTACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAA
    TCGTGCACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTAT
    AATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTC
    ATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAA
    TACCCAGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGG
    TCAGGATACCTTTACCAAAGTTAAAGGTGGCAGCAACTATATCAAAGGCGATCCGT
    ATTTTGCAGAGTATGCAACCAAACTGAGCTTTATTCTGAATCCGAGTGATGCAAAT
    AATCCGAGCGGTGAAACCGCAAATCACAATGATGAAGCCTGTAATTGTAACGAAA
    GCGGTATTAGCAGCGTTGGTCAGGCACAGACCAGCGGTCCGAGCAGCAATAAAA
    CCTGTATTACCCATAGCAGCATTAAAACCAATAAAAAGAAAGAATGCAAAGATGTG
    AAACTGGGCGTGCGCGAAAATGATAAAGATCTGAAAATTTGCGTGATCGAGGATA
    CCAGCCTGAGCGGTGTTGATAATTGTTGTTGTCAGGATCTGCTGGGTATTCTGCA
    AGAAAATTGCAGCGATAATAAACGTGGTAGCAGCAGCAATGATAGCTGCGATAAC
    AAAAATCAGGATGAATGCCAGAAAAAACTGGAAAAAGTTTTTGCCAGCCTGACGAA
    TGGTTACAAATGCGATAAATGTAAAAGCGGCACCAGCCGCAGCAAAAAGAAATGG
    ATTTGGAAAAAAAGCAGCGGCAATGAAGAAGGTCTGCAAGAGGAATATGCAAATA
    CCATTGGTCTGCCTCCGCGTACCCAGAGCCTGTATCTGGGTAATCTGCCGAAACT
    GGAAAATGTGTGTGAAGATGTGAAAGATATCAATTTTGATACCAAAGAAAAATTTCT
    GGCAGGCTGCCTGATTGTGAGCTTTCATGAAGGTAAAAACCTGAAAAAACGCTAT
    CCGCAGAATAAAAACAGCGGTAACAAAGAAAATCTGTGCAAAGCACTGGAATACA
    GCTTTGCAGATTATGGCGATCTGATTAAAGGCACCAGCATTTGGGATAACGAGTAT
    ACCAAAGATCTGGAACTGAATCTGCAGAACAATTTCGGTAAACTGTTCGGCAAATA
    TATCAAAAAAAACAATACCGCAGAGCAGGATACCAGCTATAGCAGCCTGGATGAA
    CTGCGTGAAAGTTGGTGGAATACCAACAAAAAATACATTTGGACCGCCATGAAAC
    ATGGTGCCGAAATGAATATTACCACCTGTAATGCAGATGGTAGCGTTACCGGTAG
    CGGTAGCAGCTGTGATGATATTCCGACCATTGATCTGATTCCGCAGTATCTGCGTT
    TTCTGCAAGAATGGGTTGAAAACTTTTGTGAACAGCGTCAGGCGAAAGTGAAAGA
    TGTTATTACCAATTGCAAAAGCTGCAAAGAAAGCGGCAATAAATGCAAAACCGAGT
    GCAAAACCAAATGCAAAGACGAGTGCGAGAAATACAAAAAATTCATTGAAGCATGT
    GGTACAGCCGGTGGTGGTATTGGCACCGCAGGTAGCCCGTGGTCAAAACGTTGG
    GATCAGATCTATAAACGCTACAGCAAACACATCGAAGATGCCAAACGTAATCGTAA
    AGCAGGCACCAAAAATTGTGGCACCAGCAGCACCACCAATGCAGCAGCAAGCAC
    CGATGAAAACAAATGTGTTCAGAGCGATATCGATAGCTTCTTCAAACATCTGATTG
    ATATTGGTCTGACCACCCCGAGCAGCTATCTGAGCAATGTTCTGGATGATAACATT
    TGCGGTGCAGATAAAGCACCGTGGACCACCTATACCACATATACCACCACAGAAA
    AATGCAACAAAGAGCGCGATAAAAGCAAAAGCCAGAGCAGCGATACCCTGGTTGT
    TGTTAATGTTCCGAGTCCGCTGGGTAATACCCCGTATCGTTATAAGTATGCCTGCC
    AGTGTAAAATCCCGACCAATGAAGAAACCTGTGATGATCGCAAAGAATACATGAAT
    CAGTGGTCATGTGGTAGCGCACGTACCATGAAACGTGGCTATAAAAACGATAATT
    ATGAACTGTGCAAATATAACGGCGTGGATGTTAAACCGACCACCGTTCGTAGCAA
    TAGCAGCAAACTGGATCATCATCATCACCATCATTAAGGATCC
    >SEQ ID NO: 31 A5 >mSA-RO-HIS DNA
    CCATGGGCGGTGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTA
    GCACCTTTACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAA
    TCGTGCACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTAT
    AATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTC
    ATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAA
    TACCCAGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGG
    TCAGGATACCTTTACCAAAGTTAAAGGTGGCAGCACAAGTGAGAATAGAAATAAAC
    GAATCGGGGGTCCTAAATTAAGGGGTAATGTTACAAGTAATATAAAGTTCCCATCA
    GATAACAAAGGTAAAATTATAAGAGGTTCGAATGATAAACTTAATAAAAACTCTGAA
    GATGTTTTAGAACAAAGCGAAAAATCGCTTGTTTCAGAAAATGTTCCTAGTGGATT
    AGATATAGATGATATCCCTAAAGAATCTATTTTTATTCAAGAAGATCAAGAAGGTCA
    AACTCATTCTGAATTAAATCCTGAAACATCAGAACATAGTAAAGATTTAAATAATAA
    TGGTTCAAAAAATGAATCTAGTGATATTATTTCAGAAAATAATAAATCAAATAAAGT
    ACAAAATCATTTTGAATCATTATCAGATTTAGAATTACTTGAAAATTCCTCACAAGAT
    AATTTAGACAAAGATACAATTTCAACAGAACCTTTTCCTAATCAAAAACATAAAGAC
    TTACAACAAGATTTAAATGATGAACCTTTAGAACCCTTTCCTACACAAATACATAAA
    GATTATAAAGAAAAAAATTTAATAAATGAAGAAGATTCAGAACCATTTCCCAGACAA
    AAGCATAAAAAGGTAGACAATCATAATGAAGAAAAAAACGTATTTCATGAAAATGG
    TTCTGCAAATGGTAATCAAGGAAGTTTGAAACTTAAATCATTCGATGAACATTTAAA
    AGATGAAAAAATAGAAAATGAACCACTTGTTCATGAAAATTTATCCATACCAAATGA
    TCCAATAGAACAAATATTAAATCAACCTGAACAAGAAACAAATATCCAGGAACAATT
    GTATAATGAAAAACAAAATGTTGAAGAAAAACAAAATTCTCAAATACCTTCGTTAGA
    TTTAAAAGAACCAACAAATGAAGATATTTTACCAAATCATAATCCATTAGAAAATAT
    AAAACAAAGTGAATCAGAAATAAATCATGTACAAGATCATGCGCTACCAAAAGAGA
    ATATAATAGACAAACTTGATAATCAAAAAGAACACATCGATCAATCACAACATAATA
    TAAATGTATTACAAGAAAATAACATAAACAATCACCAATTAGAACCTCAAGAGAAAC
    CTAATATTGAATCGTTTGAACCTAAAAATATAGATTCAGAAATTATTCTTCCTGAAA
    ATGTTGAAACAGAAGAAATAATAGATGATGTGCCTTCCCCTAAACATTCTAACCAT
    GAAACATTTGAAGAAGAAACAAGTGAATCTGAACATGAAGAAGCCGTATCTGAAAA
    AAATGCCCACGAAACTGTCGAACATGAAGAAACTGTGTCTCAAGAAAGCAATCCT
    GAAAAAGCTGATAATGATGGAAATGTATCTCAAAACAGCAACAACGAATTAAATGA
    AAATGAATTCGTTGAATCGGAAAAAAGCGAGCATGAAGCAAGATCCAAAGCAAAA
    GAAGCTTCTAGTTATGATTATATTTTAGGTTGGGAATTTGGAGGAGGCGTTCCAGA
    ACACAAAAAAGAAGAAAATATGTTATCACATTTATATGTTTCTTCAAAGGATAAGGA
    AAATATATCTAAGGAAAATGATGATGTATTAGATGAGAAGGAAGAAGAGGCAGAAG
    AAACAGAAGAAGAAGAACTTGAAGAAAAAAATGAAGAAGAAACAGAATCAGAAATA
    AGTGAAGATGAAGAAGAAGAAGAAGAAGAAGAAGAAAAGGAAGAAGAAAATGACA
    AAAAAAAAGAACAAGAAAAAGAACAAAGTAATGAAAATAATGATCAAAAAAAAGATA
    TGGAAGCACAGAATTTAATTTCTAAAAACCAGAATAATAATGAGAAAAACGTAAAA
    GAAGCTGCTGAAAGCATCATGAAAACTTTAGCTGGTTTAATCAAGGGAAATAATCA
    AATAGATTCTACCTTAAAAGATTTAGTAGAAGAATTATCCAAATATTTTAAAAATCAT
    AGATCTCATCACCATCATCACCATTAGggatccttt
    >SEQ ID NO:32 A6 >HIS-RO-mSA DNA
    GGATCCACAAGTGAGAATAGAAATAAACGAATCGGGGGTCCTAAATTAAGGGGTA
    ATGTTACAAGTAATATAAAGTTCCCATCAGATAACAAAGGTAAAATTATAAGAGGTT
    CGAATGATAAACTTAATAAAAACTCTGAAGATGTTTTAGAACAAAGCGAAAAATCG
    CTTGTTTCAGAAAATGTTCCTAGTGGATTAGATATAGATGATATCCCTAAAGAATCT
    ATTTTTATTCAAGAAGATCAAGAAGGTCAAACTCATTCTGAATTAAATCCTGAAACA
    TCAGAACATAGTAAAGATTTAAATAATAATGGTTCAAAAAATGAATCTAGTGATATT
    ATTTCAGAAAATAATAAATCAAATAAAGTACAAAATCATTTTGAATCATTATCAGATT
    TAGAATTACTTGAAAATTCCTCACAAGATAATTTAGACAAAGATACAATTTCAACAG
    AACCTTTTCCTAATCAAAAACATAAAGACTTACAACAAGATTTAAATGATGAACCTT
    TAGAACCCTTTCCTACACAAATACATAAAGATTATAAAGAAAAAAATTTAATAAATG
    AAGAAGATTCAGAACCATTTCCCAGACAAAAGCATAAAAAGGTAGACAATCATAAT
    GAAGAAAAAAACGTATTTCATGAAAATGGTTCTGCAAATGGTAATCAAGGAAGTTT
    GAAACTTAAATCATTCGATGAACATTTAAAAGATGAAAAAATAGAAAATGAACCACT
    TGTTCATGAAAATTTATCCATACCAAATGATCCAATAGAACAAATATTAAATCAACC
    TGAACAAGAAACAAATATCCAGGAACAATTGTATAATGAAAAACAAAATGTTGAAG
    AAAAACAAAATTCTCAAATACCTTCGTTAGATTTAAAAGAACCAACAAATGAAGATA
    TTTTACCAAATCATAATCCATTAGAAAATATAAAACAAAGTGAATCAGAAATAAATC
    ATGTACAAGATCATGCGCTACCAAAAGAGAATATAATAGACAAACTTGATAATCAA
    AAAGAACACATCGATCAATCACAACATAATATAAATGTATTACAAGAAAATAACATA
    AACAATCACCAATTAGAACCTCAAGAGAAACCTAATATTGAATCGTTTGAACCTAAA
    AATATAGATTCAGAAATTATTCTTCCTGAAAATGTTGAAACAGAAGAAATAATAGAT
    GATGTGCCTTCCCCTAAACATTCTAACCATGAAACATTTGAAGAAGAAACAAGTGA
    ATCTGAACATGAAGAAGCCGTATCTGAAAAAAATGCCCACGAAACTGTCGAACAT
    GAAGAAACTGTGTCTCAAGAAAGCAATCCTGAAAAAGCTGATAATGATGGAAATGT
    ATCTCAAAACAGCAACAACGAATTAAATGAAAATGAATTCGTTGAATCGGAAAAAA
    GCGAGCATGAAGCAGGTGGTAGCGGTGCAGAAGCAGGTATTACCGGCACCTGGT
    ATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGATGGTAATCTGAC
    AGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAATAGCCCGTATACC
    CTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATA
    GCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTG
    CAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGTGGTAGTGGTCC
    GGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTGAAATAAcatatg
    >SEQ ID NO: 33 A7 >HIS-GMZ2ggsmSA3
    GGATCCACAAGTGAGAATAGAAATAAACGAATCGGGGGTCCTAAATTAAGGGGTA
    ATGTTACAAGTAATATAAAGTTCCCATCAGATAACAAAGGTAAAATTATAAGAGGTT
    CGAATGATAAACTTAATAAAAACTCTGAAGATGTTTTAGAACAAAGCGAAAAATCG
    CTTGTTTCAGAAAATGTTCCTAGTGGATTAGATATAGATGATATCCCTAAAGAATCT
    ATTTTTATTCAAGAAGATCAAGAAGGTCAAACTCATTCTGAATTAAATCCTGAAACA
    TCAGAACATAGTAAAGATTTAAATAATAATGGTTCAAAAAATGAATCTAGTGATATT
    ATTTCAGAAAATAATAAATCAAATAAAGTACAAAATCATTTTGAATCATTATCAGATT
    TAGAATTACTTGAAAATTCCTCACAAGATAATTTAGACAAAGATACAATTTCAACAG
    AACCTTTTCCTAATCAAAAACATAAAGACTTACAACAAGATTTAAATGATGAACCTT
    TAGAACCCTTTCCTACACAAATACATAAAGATTATAAAGAAAAAAATTTAATAAATG
    AAGAAGATTCAGAACCATTTCCCAGACAAAAGCATAAAAAGGTAGACAATCATAAT
    GAAGAAAAAAACGTATTTCATGAAAATGGTTCTGCAAATGGTAATCAAGGAAGTTT
    GAAACTTAAATCATTCGATGAACATTTAAAAGATGAAAAAATAGAAAATGAACCACT
    TGTTCATGAAAATTTATCCATACCAAATGATCCAATAGAACAAATATTAAATCAACC
    TGAACAAGAAACAAATATCCAGGAACAATTGTATAATGAAAAACAAAATGTTGAAG
    AAAAACAAAATTCTCAAATACCTTCGTTAGATTTAAAAGAACCAACAAATGAAGATA
    TTTTACCAAATCATAATCCATTAGAAAATATAAAACAAAGTGAATCAGAAATAAATC
    ATGTACAAGATCATGCGCTACCAAAAGAGAATATAATAGACAAACTTGATAATCAA
    AAAGAACACATCGATCAATCACAACATAATATAAATGTATTACAAGAAAATAACATA
    AACAATCACCAATTAGAACCTCAAGAGAAACCTAATATTGAATCGTTTGAACCTAAA
    AATATAGATTCAGAAATTATTCTTCCTGAAAATGTTGAAACAGAAGAAATAATAGAT
    GATGTGCCTTCCCCTAAACATTCTAACCATGAAACATTTGAAGAAGAAACAAGTGA
    ATCTGAACATGAAGAAGCCGTATCTGAAAAAAATGCCCACGAAACTGTCGAACAT
    GAAGAAACTGTGTCTCAAGAAAGCAATCCTGAAAAAGCTGATAATGATGGAAATGT
    ATCTCAAAACAGCAACAACGAATTAAATGAAAATGAATTCGTTGAATCGGAAAAAA
    GCGAGCATGAAGCAAGATCCAAAGCAAAAGAAGCTTCTAGTTATGATTATATTTTA
    GGTTGGGAATTTGGAGGAGGCGTTCCAGAACACAAAAAAGAAGAAAATATGTTAT
    CACATTTATATGTTTCTTCAAAGGATAAGGAAAATATATCTAAGGAAAATGATGATG
    TATTAGATGAGAAGGAAGAAGAGGCAGAAGAAACAGAAGAAGAAGAACTTGAAGA
    AAAAAATGAAGAAGAAACAGAATCAGAAATAAGTGAAGATGAAGAAGAAGAAGAA
    GAAGAAGAAGAAAAGGAAGAAGAAAATGACAAAAAAAAAGAACAAGAAAAAGAAC
    AAAGTAATGAAAATAATGATCAAAAAAAAGATATGGAAGCACAGAATTTAATTTCTA
    AAAACCAGAATAATAATGAGAAAAACGTAAAAGAAGCTGCTGAAAGCATCATGAAA
    ACTTTAGCTGGTTTAATCAAGGGAAATAATCAAATAGATTCTACCTTAAAAGATTTA
    GTAGAAGAATTATCCAAATATTTTAAAAATCATGGTGGTAGCGGTGCAGAAGCAGG
    TATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGC
    GCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTC
    AGAATAGCCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCG
    TGTTGAATGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGT
    CAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATG
    AAGGTGGTAGTGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTGAA
    ATAAcatatg
    >SEQ ID NO: 34 A8 >HIS-GMZ2T:ggsmSA DNA
    GGATCCACAAGTGAGAATAGAAATAAACGAATCGGGGGTCCTAAATTAAGGGGTA
    ATGTTACAAGTAATATAAAGTTCCCATCAGATAACAAAGGTAAAATTATAAGAGGTT
    CGAATGATAAACTTAATAAAAACTCTGAAGATGTTTTAGAACAAAGCGAAAAATCG
    CTTGTTTCAGAAAATGTTCCTAGTGGATTAGATATAGATGATATCCCTAAAGAATCT
    ATTTTTATTCAAGAAGATCAAGAAGGTCAAACTCATTCTGAATTAAATCCTGAAACA
    TCAGAACATAGTAAAGATTTAAATAATAATGGTTCAAAAAATGAATCTAGTGATATT
    ATTTCAGAAAATAATAAATCAAATAAAGTACAAAATCATTTTGAATCATTATCAGATT
    TAGAATTACTTGAAAATTCCTCACAAGATAATTTAGACAAAGATACAATTTCAACAG
    AACCTTTTCCTAATCAAAAACATAAAGACTTACAACAAGATTTAAATGATGAACCTT
    TAGAACCCTTTCCTACACAAATACATAAAGATTATAAAGAAAAAAATTTAATAAATG
    AAGAAGATTCAGAACCATTTCCCAGACAAAAGCATAAAAAGGTAGACAATCATAAT
    GAAGAAAAAAACGTATTTCATGAAAATGGTTCTGCAAATGGTAATCAAGGAAGTTT
    GAAACTTAAATCATTCGATGAACATTTAAAAGATGAAAAAATAGAAAATGAACCACT
    TGTTCATGAAAATTTATCCATACCAAATGATCCAATAGAACAAATATTAAATCAACC
    TGAACAAGAAACAAATATCCAGGAACAATTGTATAATGAAAAACAAAATGTTGAAG
    AAAAACAAAATTCTCAAATACCTTCGTTAGATTTAAAAGAACCAACAAATGAAGATA
    TTTTACCAAATCATAATCCATTAGAAAATATAAAACAAAGTGAATCAGAAATAAATC
    ATGTACAAGATCATGCGCTACCAAAAGAGAATATAATAGACAAACTTGATAATCAA
    AAAGAACACATCGATCAATCACAACATAATATAAATGTATTACAAGAAAATAACATA
    AACAATCACCAATTAGAACCTCAAGAGAAACCTAATATTGAATCGTTTGAACCTAAA
    AATATAGATTCAGAAATTATTCTTCCTGAAAATGTTGAAACAGAAGAAATAATAGAT
    GATGTGCCTTCCCCTAAACATTCTAACCATGAAACATTTGAAGAAGAAACAAGTGA
    ATCTGAACATGAAGAAGCCGTATCTGAAAAAAATGCCCACGAAACTGTCGAACAT
    GAAGAAACTGTGTCTCAAGAAAGCAATCCTGAAAAAGCTGATAATGATGGAAATGT
    ATCTCAAAACAGCAACAACGAATTAAATGAAAATGAATTCGTTGAATCGGAAAAAA
    GCGAGCATGAAGCAAGATCCAAAACAAAAGAATATGCTGAAAAAGCAAAAAATGC
    TTATGAAAAGGCAAAAAATGCTTATCAAAAAGCAAACCAAGCTGTTTTAAAAGCAA
    AAGAAGCTTCTAGTTATGATTATATTTTAGGTTGGGAATTTGGAGGAGGCGTTCCA
    GAACACAAAAAAGAAGAAAATATGTTATCACATTTATATGTTTCTTCAAAGGATAAG
    GAAAATATATCTAAGGAAAATGATGATGTATTAGATGAGAAGGAAGAAGAGGCAGA
    AGAAACAGAAGAAGAAGAACTTGAAGGTGGTAGCGGTGCAGAAGCAGGTATTACC
    GGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGATG
    GTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAATAG
    CCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTGAA
    TGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTATC
    AGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGTGG
    TAGTGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTGAAATAAcatat
    g
    >SEQ ID NO: 35 A9 >mSA-PfRH5-HIS DNA
    gaattcGGTGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACC
    TTTACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTG
    CACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTATAATGG
    CACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTCATAGC
    CGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCC
    AGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGGTCAGG
    ATACCTTTACCAAAGTTAAAGGTGGCAGCCTGTCCTTCGAGAACGCCATCAAGAA
    GACCAAGAACCAGGAAAACAACCTGACCCTGCTGCCCATCAAGTCCACCGAGGA
    AGAGAAGGACGACATCAAGAACGGCAAGGATATCAAGAAGGAAATCGACAACGA
    CAAGGAAAACATCAAGACCAACAACGCCAAGGACCACTCCACCTACATCAAGTCT
    TACCTGAACACCAACGTGAACGACGGCCTGAAGTACCTGTTCATCCCATCCCACA
    ACAGCTTCATCAAGAAGTACTCCGTTTTCAACCAGATCAACGACGGCATGCTGCT
    GAACGAGAAGAACGACGTGAAGAACAACGAGGACTACAAGAACGTCGACTACAA
    GAACGTGAACTTCCTGCAGTACCACTTCAAGGAACTGTCCAACTACAACATCGCC
    AACTCCATCGACATCCTGCAAGAAAAGGAAGGCCACCTGGACTTCGTGATCATCC
    CCCACTACACTTTCTTGGACTACTACAAGCACCTGTCCTACAACAGCATCTACCAC
    AAGTACAGCACCTACGGCAAGTACATCGCTGTGGACGCTTTCATCAAGAAGATCA
    ACGAGACTTACGACAAAGTGAAGTCCAAGTGTAACGATATCAAGAACGACCTGAT
    CGCCACCATCAAGAAGCTCGAGCACCCCTACGACATCAACAACAAGAACGACGAC
    AGCTACCGCTACGACATCTCCGAAGAGATCGACGACAAGTCCGAGGAAACCGAC
    GACGAGACTGAGGAAGTCGAGGACTCCATCCAGGACACCGACTCCAACCACACC
    CCCTCCAACAAGAAGAAGAACGATCTGATGAACCGCACCTTCAAGAAGATGATGG
    ACGAGTACAACACTAAGAAGAAGAAGCTGATCAAGTGCATCAAGAACCACGAGAA
    CGACTTCAACAAGATCTGCATGGACATGAAGAACTACGGCACCAACCTGTTCGAG
    CAGCTGTCCTGCTACAACAACAACTTCTGCAACACTAACGGCATCCGCTTCCACTA
    CGATGAGTACATCCACAAGCTGATCCTGTCCGTCAAGAGCAAGAACCTGAACAAG
    GACCTGAGCGACATGACCAACATCCTCCAGCAGTCCGAGCTGCTGCTGACCAACT
    TGAACAAGAAGATGGGCTCCTACATCTACATCGACACTATCAAGTTCATCCACAAG
    GAAATGAAGCACATCTTCAACCGCATCGAGTACCACACCAAGATCATCAACGATAA
    GACTAAGATCATCCAAGACAAGATCAAGCTGAACATCTGGCGCACTTTCCAAAAG
    GACGAACTGCTGAAGCGTATCCTGGACATGTCTAACGAGTACTCCCTCTTCATCA
    CCTCCGACCACCTGAGGCAGATGCTGTACAACACCTTCTACTCCAAGGAAAAGCA
    CCTCAACAACATCTTCCACCACCTGATCTACGTGCTGCAGATGAAGTTCAACGAC
    GTCCCCATCAAGATGGAATACTTCCAGACCTACAAGAAGAACAAGCCCCTGACCC
    AGCATCATCACCACCACCAC
    >SEQ ID NO: 36 (biotin acceptor site)
    GLNDIFEAQKIEWHE
    >SEQ ID NO: 37 monovalent streptavidin
    AEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTKL
    EWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDTF
    TKVK
    >SEQ ID NO: 38 BirA OS = Escherichia coli (strain K12) GN = birA PE = 1
    SV = 1
    MKDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGY
    SLPEPIQLLNAKQILGQLDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRG
    RRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWP
    NDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINL
    DRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDK
    QGALLLEQDGIIKPWMGGEISLRSAEK
    >SEQ ID NO: 39 DNA sequence of the biotin binding site
    GGTCTGAACGACATCTTCGAGGCTCAGAAAATCGAATGGCACGAA
    >SEQ ID NO: 40 >Survivin:mSA (Homo Sapiens)
    MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQC
    FFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAK
    ETNNKKKEFEETAKKVRRAIEQLAAMDggsGAEAGITGTWYNQHGSTFTVTAGADGNL
    TGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQG
    GAEARINTQWNLTYEGGSGPATEQGQDTFTKVK
    >SEQ ID NO: 41 >mSA:Survivin (Homo Sapiens)
    MAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGT
    KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQD
    TFTKVKggsGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTEN
    EPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRER
    AKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
    >SEQ ID NO: 42 >Survivin(F101A/L102A):mSA (Homo Sapiens)
    MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQC
    FFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEAAKLDRERAKNKIAK
    ETNNKKKEFEETAKKVRRAIEQLAAMDggsGAEAGITGTWYNQHGSTFTVTAGADGNL
    TGQYENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQG
    GAEARINTQWNLTYEGGSGPATEQGQDTFTKVK
    >SEQ ID NO: 43 >mSA:Survivin(F101A/L102A) (Homo Sapiens)
    MAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGT
    KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQD
    TFTKVKggsGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTEN
    EPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEAAKLDRE
    RAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMD
    >SEQ ID NO: 44>mSA:Survivin(F101A/L102A) (Mus Musculus)
    MAEAGITGTVVYNQHGSTFTVTAGADGN LTGQYEN RAQGTGCQNSPYTLTG RYN GT
    KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARI NTQWN LTYEGGSGPATEQGQD
    TFTKVKGGSGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFI HCPTEN
    EPD LAQCFFCFKELEGWEPDD N PI EEH RKHSPGCAFLTVKKQM EELTVSEAAKLDRQ
    RAKNKIAKETN NKQKEFEETAKTTRQSI EQLAASGRF
    >SEQ ID NO: 45 >Survivin (F101A/L102A):mSA (Mus Musculus)
    GAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFF
    CFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSE AA KLDRQRAKNKIAKE
    TNNKQKEFEETAKTTRQSIEQLAAggsAEAGITGTWYNQHGSTFTVTAGADGNLTGQY
    ENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEA
    RINTQWNLTYEGGSGPATEQGQDTFTKVK
    >SEQ ID NO: 46 >mSA:Survivin (Mus Musculus)
    MAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGT
    KLEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQD
    TFTKVKGGSGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTEN
    EPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQ
    RAKNKIAKETNNKQKEFEETAKTTRQSIEQLAASGRF
    >SEQ ID NO: 47 >Survivin:mSA (Mus Musculus)
    GAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFF
    CFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKET
    NNKQKEFEETAKTTRQSIEQLAAGGSAEAGITGTWYNQHGSTFTVTAGADGNLTGQY
    ENRAQGTGCQNSPYTLTGRYNGTKLEWRVEWNNSTENCHSRTEWRGQYQGGAEA
    RINTQWNLTYEGGSGPATEQGQDTFTKVK
    >SEQ ID NO: 48 >mSA:Survivin(F101A/L102A) (Mus Musculus) DNA
    ATGGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTTA
    CCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTGCACA
    GGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTATAATGGCACC
    AAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTCATAGCCGTA
    CCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGT
    GGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGGTCAGGATA
    CCTTTACCAAAGTTAAAGGTGGCAGCGGTGCACCGGCACTGCCGCAGATTTGGC
    AGCTGTATCTGAAAAACTATCGTATCGCCACCTTTAAAAACTGGCCGTTTCTGGAA
    GATTGTGCATGTACACCGGAACGTATGGCAGAAGCAGGTTTTATTCATTGTCCGA
    CCGAAAATGAACCGGATCTGGCACAGTGTTTTTTTTGCTTTAAAGAACTGGAAGGT
    TGGGAGCCGGATGATAATCCGATTGAAGAACATCGTAAACATAGTCCGGGTTGTG
    CATTTCTGACCGTGAAAAAACAAATGGAAGAACTGACCGTTAGCGAGGCAGCAAA
    ACTGGATCGTCAGCGTGCCAAAAACAAAATTGCAAAAGAAACCAATAACAAACAGA
    AAGAATTCGAAGAAACCGCCAAAACCACCCGTCAGAGCATTGAACAGCTGGCAGC
    Aagcggccgcttt
    >SEQ ID NO: 49 >Survivin (F101A/L102A):mSA (Mus Musculus) DNA
    GGTGCACCGGCACTGCCGCAGATTTGGCAGCTGTATCTGAAAAACTATCGTATCG
    CCACCTTTAAAAACTGGCCGTTTCTGGAAGATTGTGCATGTACACCGGAACGTAT
    GGCAGAAGCAGGTTTTATTCATTGTCCGACCGAAAATGAACCGGATCTGGCACAG
    TGTTTTTTTTGCTTTAAAGAACTGGAAGGTTGGGAGCCGGATGATAATCCGATTGA
    AGAACATCGTAAACATAGTCCGGGTTGTGCATTTCTGACCGTGAAAAAACAAATGG
    AAGAACTGACCGTTAGCGAGGCAGCAAAACTGGATCGTCAGCGTGCCAAAAACAA
    AATTGCAAAAGAAACCAATAACAAACAGAAAGAATTCGAAGAAACCGCCAAAACCA
    CCCGTCAGAGCATTGAACAGCTGGCAGCAGGTGGCAGCGCAGAAGCAGGTATTA
    CCGGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGA
    TGGTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAAT
    AGCCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTG
    AATGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTA
    TCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGT
    GGTAGCGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTTAAA
    >SEQ ID NO: 50 >mSA:Survivin (Mus Musculus) DNA
    ATGGCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTTA
    CCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGTGCACA
    GGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTATAATGGCACC
    AAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAATTGTCATAGCCGTA
    CCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGT
    GGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCAACCGAACAGGGTCAGGATA
    CCTTTACCAAAGTTAAAGGTGGCAGCGGTGCACCGGCACTGCCGCAGATTTGGC
    AGCTGTATCTGAAAAACTATCGTATCGCCACCTTTAAAAACTGGCCGTTTCTGGAA
    GATTGTGCATGTACACCGGAACGTATGGCAGAAGCAGGTTTTATTCATTGTCCGA
    CCGAAAATGAACCGGATCTGGCACAGTGTTTTTTTTGCTTTAAAGAACTGGAAGGT
    TGGGAGCCGGATGATAATCCGATTGAAGAACATCGTAAACATAGTCCGGGTTGTG
    CATTTCTGACCGTGAAAAAACAAATGGAAGAACTGACCGTTAGCGAGTTTCTGAAA
    CTGGATCGTCAGCGTGCCAAAAACAAAATTGCAAAAGAAACCAATAACAAACAGAA
    AGAATTCGAAGAAACCGCCAAAACCACCCGTCAGAGCATTGAACAGCTGGCAGCA
    agcggccgcttt
    >SEQ ID NO: 51 >Survivin: mSA (Mus Musculus) DNA
    GGTGCACCGGCACTGCCGCAGATTTGGCAGCTGTATCTGAAAAACTATCGTATCG
    CCACCTTTAAAAACTGGCCGTTTCTGGAAGATTGTGCATGTACACCGGAACGTAT
    GGCAGAAGCAGGTTTTATTCATTGTCCGACCGAAAATGAACCGGATCTGGCACAG
    TGTTTTTTTTGCTTTAAAGAACTGGAAGGTTGGGAGCCGGATGATAATCCGATTGA
    AGAACATCGTAAACATAGTCCGGGTTGTGCATTTCTGACCGTGAAAAAACAAATGG
    AAGAACTGACCGTTAGCGAGTTTCTGAAACTGGATCGTCAGCGTGCCAAAAACAA
    AATTGCAAAAGAAACCAATAACAAACAGAAAGAATTCGAAGAAACCGCCAAAACCA
    CCCGTCAGAGCATTGAACAGCTGGCAGCAGGTGGCAGCGCAGAAGCAGGTATTA
    CCGGCACCTGGTATAATCAGCATGGTAGCACCTTTACCGTTACCGCAGGCGCAGA
    TGGTAATCTGACAGGTCAGTATGAAAATCGTGCACAGGGCACCGGTTGTCAGAAT
    AGCCCGTATACCCTGACCGGTCGTTATAATGGCACCAAACTGGAATGGCGTGTTG
    AATGGAATAATAGCACCGAAAATTGTCATAGCCGTACCGAATGGCGTGGTCAGTA
    TCAGGGTGGTGCAGAAGCCCGTATTAATACCCAGTGGAATCTGACCTATGAAGGT
    GGTAGCGGTCCGGCAACCGAACAGGGTCAGGATACCTTTACCAAAGTTAAA
    >SEQ ID NO: 52 >mSA:CIDR1a-HIS
    GAEAGITGTWYNQHGSTFTVTAGADGNLTGQYENRAQGTGCQNSPYTLTGRYNGTK
    LEWRVEWNNSTENCHSRTEWRGQYQGGAEARINTQWNLTYEGGSGPATEQGQDT
    FTKVKGGSKITSFDEFFDFWVRKLLIDTIKWETELTYCINNTDVTDCNKCNKNCVCFDK
    WVKQKEDEWTNIMKLFTNKHDIPKKYYLNINDLFDSFFFQVIYKFNEGEAKWNELKEN
    LKKQIASSKANNGTKDSEAAIKVLFNHIKEIATICKDNNTN
    >SEQ ID NO: 53 >mSA:CIDR1a-HIS DNA
    GCAGAAGCAGGTATTACCGGCACCTGGTATAATCAGCATGGTAGCACCTTT
    ACCGTTACCGCAGGCGCAGATGGTAATCTGACAGGTCAGTATGAAAATCGT
    GCACAGGGCACCGGTTGTCAGAATAGCCCGTATACCCTGACCGGTCGTTAT
    AATGGCACCAAACTGGAATGGCGTGTTGAATGGAATAATAGCACCGAAAAT
    TGTCATAGCCGTACCGAATGGCGTGGTCAGTATCAGGGTGGTGCAGAAGCC
    CGTATTAATACCCAGTGGAATCTGACCTATGAAGGTGGTAGCGGTCCGGCA
    ACCGAACAGGGTCAGGATACCTTTACCAAAGTTAAAGGTGGCAGCAAAATAAC
    GTCATTTGATGAATTTTTTGATTTTTGGGTTAGAAAATTATTAATAGACACTATAAAGTGGGAAACCGAA
    CTTACGTATTGTATAAATAATACTGATGTCACGGATTGTAATAAATGTAACAAAAATTGCGTATGTTTTG
    ACAAATGGGTTAAACAAAAAGAAGACGAATGGACAAATATAATGAAACTATTCACAAACAAACACGAT
    ATACCGAAAAAATATTATCTTAATATTAATGATCTTTTTGATAGTTTTTTTTTCCAAGTTATATATAAGTTT
    AACGAAGGAGAAGCAAAATGGAATGAACTTAAAGAAAATTTAAAAAAGCAAATTGCGTCTTCCAAAGC
    AAATAACGGAACCAAAGATTCAGAAGCTGCAATAAAAGTGTTGTTTAATCACATAAAAGAAATTGCAA
    CAATATGCAAAGATAATAATACAAAC
    • REFERENCES
    • Bachmann, M F. and Jennings, Gary T. Vaccine delivery: a matter of size, geometry, kinetics and molecular patterns. Nat Rev Immunol 10(11), 787-796. 2010.
    • Bachmann M F, Zinkernagel, R M. Neutralizing antiviral B cell responses. Annual review of immunology 15: 235-270. 1997.
    • Bachmann, M F. et al. The influence of antigen organization on B cell responsiveness. Science. 262(5138), 1448-1451. 1993.
    • Bachmann, M. F., Jennings, G. T., 2004a. Virus-like particles: combining innate and adaptive immunity for effective vaccination. In: Kaufmann, P.D.S.H.E. (Ed.), Novel Vaccination Strategies. Wiley-VCH Verlag GmbH & Co, pp. 415-432.
    • Buck, Christopher B. and Thompson, Cynthia D. Production of Papillomavirus-Based Gene Transfer Vectors. Current Protocols in Cell Biology. 2001.
    • Buck C B, Pastrana D V, Lowy D R, Schiller J T. Efficient intracellular assembly of papillomaviral vectors. J Virol. 2004; 78(2):751-7.
    • Buck C B, Thompson C D, Pang Y-YS, Lowy D R, Schiller J T. Maturation of papillomavirus capsids. J Virol. 2005; 79(5):2839-46.
    • Buck C B, Thompson C D. Production of papillomavirus-based gene transfer vectors. Curr Protoc Cell Biol. 2007; Chapter 26:Unit 26.1.
    • Chackerian, B. et al. Induction of autoantibodies to mouse CCR5 with recombinant papillomavirus particles. PNAS. (5) 2373-2378. 1999.
    • Chackerian, B. Virus-like particles: flexible platforms for vaccine development. Expert Review of Vaccines. 6(3), 381-390. 2007.
    • Grgacic, Elizabeth V. L. and Anderson, David A. Virus-like particles: Passport to immune recognition. Particle-based Vaccines. Methods 40(1), 60-65. 2006.
    • Kouskoff, V. et al. T Cell-Independent Rescue of B Lymphocytes from Peripheral Immune Tolerance. Science 287 (5462). 2501-2503. 2000.
    • Lim K H, Huang H, Pralle A, Park S. Engineered streptavidin monomer and dimer with improved stability and function. Biochemistry. 2011; 50(40):8682-91.
    • Murray K. Application of recombinant DNA techniques in the development of viral vaccines. Vaccine. 6:164-74.1988.
    • Nielsen M A, Pinto V V., Resende M, Dahlbäck M, Ditlev S B, Theander T G, et al. Induction of adhesion-inhibitory antibodies against placental Plasmodium falciparum parasites by using single domains of VAR2CSA. Infect Immun. 2009; 77(6):2482-7.
    • Haase R N, Megnekou R, Lundquist M, Ofori M F, Hviid L, Staalsoe T. Plasmodium falciparum parasites expressing pregnancy-specific variant surface antigens adhere strongly to the choriocarcinoma cell line BeWo. Infect Immun. 2006; 74(5):3035-8.
    • Snounou G, Zhu X, Siripoon N, Jarra W, Thaithong S, Brown K N, et al. Biased distribution of msp1 and msp2 allelic variants in Plasmodium falciparum populations in Thailand. Trans R Soc Trop Med Hyg. 1999; 93(4):369-74.
    • Plotkin, S A. Vaccines: past, present and future. Nat Med. 5-4-2005.
    • Pumpens, P. and Grens, E. HBV Core Particles as a Carrier for B Cell/T Cell Epitopes. Intervirology 44(2-3), 98-114. 2001.
    • Raja, Krishnaswami S. et al. Icosahedral Virus Particles as Polyvalent Carbohydrate Display Platforms. ChemBioChem 4(12), 1348-1351. 2003.

Claims (25)

1. A vaccine comprising:
i. a papilloma virus (PV) L1 protein containing a biotin acceptor site, and
ii. a biotin molecule enzymatically conjugated to said biotin acceptor site, and
iii. an antigen fused to a monovalent streptavidin,
wherein the antigen and PV L1 protein are linked via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of the PV L1 protein, and wherein i-iii form a virus like particle displaying said antigen.
2.-7. (canceled)
8. The vaccine according to claim 1, wherein the PV L1 protein is from a virus infecting mammals.
9. The vaccine according to claim 1, wherein the PV L1 protein is from the human PV genotype 16 and/or 118.
10. The vaccine according to claim 1, wherein the biotin acceptor site comprises amino acid sequence SEQ ID NO: 36.
11. The vaccine according to claim 1, wherein the biotin acceptor site is fused into a loop of the PV L1 protein, the loop selected from the group consisting of: a DE-loop and an HI-loop of the PV L1 protein.
12. The vaccine according to claim 1, wherein the PV L1 protein containing the biotin acceptor site is a PV L1 protein derived from the human PV genotype 16, the PV 1 protein containing the biotin acceptor site having a PV L1 amino acid sequence wherein residues 134-137 (YAAN) are deleted compared to a wild-type PV L1 amino acid sequence, and wherein the PV L1 protein contains the biotin acceptor site in a DE-loop at position 133/138 in the amino acid sequence of said PV L1 protein.
13. The vaccine according to claim 1, wherein the PV L1 protein containing the biotin acceptor site is a PV L1 protein derived from the human PV genotype 16 and contains the biotin acceptor site in an HI-loop at position 351/352 in the amino acid sequence of said PV L1 protein.
14. The vaccine according to claim 1, wherein the PV L1 protein containing the biotin acceptor site is a PV L1 protein derived from the human PV genotype 118, wherein residues 361-364 (AGKI) are deleted, and contains the biotin acceptor site in an HI-loop at position 360/365 of said PV L1 protein.
15. The vaccine according to claim 1, wherein several PV L1 proteins containing the biotin acceptor site are able to form a virus like particle.
16. The vaccine according to claim 1, wherein the PV L1 protein containing the biotin acceptor site comprises
i. a polypeptide having an amino acid sequence selected from the group comprising SEQ ID NO: 3 [DE-loop, HPV genotype 16], SEQ ID NO: 2 [HI-loop, HPV genotype 16], and SEQ ID NO: 6 [HI-loop, HPV118], or
ii. a biologically active sequence variant of said polypeptide, wherein the biologically active sequence variant has at least 95% sequence identity to the sequences comprising SEQ ID NO: 3 [DE-loop, HPV genotype 16], SEQ ID NO: 2 [HI-loop, HPV genotype 16], SEQ ID NO: 6 [HI-loop, HPV118],
wherein the biological activity is an ability to form a virus like particle.
17. The vaccine according to claim 1, wherein the biotin molecule is enzymatically conjugated to the biotin acceptor site by a biotin ligase.
18.-19. (canceled)
20. The vaccine according to claim 1, wherein said antigen is a protein, peptide and/or an antigenic fragment from the group comprising cancer-specific polypeptides, polypeptides associated with cardiovascular diseases, polypeptides associated with asthma, polypeptides associated with nasal polyposis, polypeptides associated with atopic dermatitis, polypeptides associated with eosinophilic esophagitis, polypeptides associated with hypereosinophilic syndrome, polypeptides associated with Churg-Strauss syndrome and/or polypeptides associated with pathogenic organisms.
21.-28. (canceled)
29. The vaccine according to claim 1, wherein the ratio of PV L1 proteins, biotin molecules, and antigens is 1:1:1.
30. The vaccine according to claim 1, wherein the antigen fused to the monovalent streptavidin further comprises a polyhistidine tag.
31. The vaccine according to claim 1, wherein the monovalent streptavidin comprises amino acid sequence SEQ ID NO 37.
32. The vaccine according to claim 1, wherein the monovalent streptavidin is fused to the antigen in a position selected from the group comprising an N-terminal end of the antigen, a C-terminal end of the antigen and/or inserted in-frame into a coding sequence of the antigen.
33. The vaccine according to claim 1, wherein the monovalent streptavidin fused to the antigen comprises:
i. a polypeptide having a sequence selected from the group consisting of SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28, or
ii. a sequence variant of said polypeptide sequence, wherein the sequence variant has at least 95% sequence identity to the sequences comprising SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, and SEQ ID NO: 28.
34.-42. (canceled)
43. A method of manufacturing a pharmaceutical composition comprising a vaccine according to claim 1, wherein the method comprises the steps of:
i. obtaining a first polypeptide; a PV L1 protein containing a biotin acceptor site according to any one of the preceding claims, and
ii. obtaining a second polypeptide; a biotin ligase, according to any one of the preceding claims, capable of biotinylating the biotin acceptor site, and
iii. obtaining a third polypeptide; an antigen fused to a monovalent streptavidin according to any one of the preceding claims, and
iv. subjecting the first polypeptide to conditions which enable formation of virus like particles, and
v. enabling enzymatic biotinylation of the biotin acceptor site of said virus like particles using said second polypeptide, and
vi. obtaining a vaccine by linkage of the third polypeptide and said virus like particles via the interaction between the monovalent streptavidin and the biotin molecule enzymatically conjugated to the biotin acceptor site of said virus like particles, and
vii. generating a composition comprising said vaccine according to any one of the preceding claims,
thereby obtaining a pharmaceutical composition.
44. A method for treating and/or preventing a clinical condition in a subject in need thereof comprising the steps of:
i. obtaining at least one vaccine according to claim 1, and
ii. administering said vaccine to a subject at least once for prophylaxis and/or treatment of a disease.
45.-52. (canceled)
53. The method of claim 44, wherein the disease is cancer, a cardiovascular disease, asthma or allergy disease, or an infectious disease.
US15/772,186 2015-10-30 2016-10-28 Virus like particle with efficient epitope display Active 2037-10-03 US11129882B2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
DKPA201570699 2015-10-30
DKPA201570699 2015-10-30
PCT/DK2016/050342 WO2017071713A1 (en) 2015-10-30 2016-10-28 Virus like particle with efficient epitope display

Publications (3)

Publication Number Publication Date
US20190022206A1 US20190022206A1 (en) 2019-01-24
US20200171138A9 true US20200171138A9 (en) 2020-06-04
US11129882B2 US11129882B2 (en) 2021-09-28

Family

ID=57421596

Family Applications (1)

Application Number Title Priority Date Filing Date
US15/772,186 Active 2037-10-03 US11129882B2 (en) 2015-10-30 2016-10-28 Virus like particle with efficient epitope display

Country Status (5)

Country Link
US (1) US11129882B2 (en)
EP (1) EP3368068B1 (en)
DK (1) DK3368068T3 (en)
ES (1) ES2854726T3 (en)
WO (1) WO2017071713A1 (en)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IL271461B2 (en) 2017-06-23 2023-09-01 Pathovax Llc Chimeric virus-like particles and uses thereof as antigen-specific redirectors of immune responses
CN109251236B (en) * 2017-07-14 2021-09-28 厦门大学 Mutant of human papilloma virus 35 type L1 protein
WO2020139978A1 (en) 2018-12-27 2020-07-02 Verimmune Llc Conjugated virus-like particles and uses thereof as anti-tumor immune redirectors
WO2022087013A1 (en) 2020-10-19 2022-04-28 Verimmune Inc. Virus-inspired compositions and methods of redirecting preexisting immune responses using the same for treatment of cancer

Family Cites Families (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1637166A3 (en) * 1998-10-21 2006-04-12 THE UNITED STATES GOVERNMENT as represented by THE DEPARTMENT OF HEALTH AND HUMAN SERVICES Virus-like particles for the induction of autoantibodies
ES2258869T3 (en) 1998-10-21 2006-09-01 The United States Government As Represented By The Department Of Health And Human Services VIRUS SIMILAR PARTICLES FOR THE INDUCTION OF AUTO ANTIBODIES.
US20020052311A1 (en) 1999-09-03 2002-05-02 Beka Solomon Methods and compostions for the treatment and/or diagnosis of neurological diseases and disorders
US7094409B2 (en) 2001-01-19 2006-08-22 Cytos Biotechnology Ag Antigen arrays for treatment of allergic eosinophilic diseases
US7128911B2 (en) 2001-01-19 2006-10-31 Cytos Biotechnology Ag Antigen arrays for treatment of bone disease
EP1425040A2 (en) 2001-09-14 2004-06-09 Cytos Biotechnology AG In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles
ATE447967T1 (en) 2001-09-14 2009-11-15 Cytos Biotechnology Ag PACKAGING OF IMMUNO-STIMULATIVE CPG IN VIRUS-LIKE PARTICLES: PRODUCTION METHOD AND USE
EP1432443B1 (en) 2001-10-05 2009-01-21 Cytos Biotechnology AG Angiotensin peptide-carrier conjugates and uses thereof
US7115266B2 (en) 2001-10-05 2006-10-03 Cytos Biotechnology Ag Angiotensin peptide-carrier conjugates and uses thereof
BR0213117A (en) 2001-10-05 2004-09-21 Cytos Biotechnology Ag Angiotensin-vehicle peptide conjugates and their uses
BR0213950A (en) 2001-11-07 2004-08-24 Cytos Biotechnology Ag Antigen Arrangements for the Treatment of Allergic Eosinofolic Diseases
CN100509057C (en) 2001-11-07 2009-07-08 赛托斯生物技术公司 Antigen arrays for treatment of bone disease
WO2003059386A2 (en) 2002-01-18 2003-07-24 Cytos Biotechnology Ag Prion protein carrier-conjugates
FR2840326B1 (en) 2002-05-28 2004-07-30 Asselin MOBILE TROLLEY OF SPIDER-STEAMER AND SPREADER-STEAMER EQUIPPED WITH SAID TROLLEY
CN1668637B (en) 2002-07-17 2010-05-26 希托斯生物技术股份公司 Molecular antigen arrays using a virus like particle derived from the AP205 coat protein
PL375522A1 (en) 2002-07-19 2005-11-28 Cytos Biotechnology Ag Ghrelin-carrier conjugates
DE60336902D1 (en) 2002-07-19 2011-06-09 Cytos Biotechnology Ag VACCINE COMPOSITIONS CONTAINING AMYLOID BETA 1-6 ANTIGENARRAYS
WO2004085635A1 (en) 2003-03-26 2004-10-07 Cytos Biotechnology Ag Melan-a peptide analogue-virus-like-particle conjugates
RU2375076C2 (en) 2003-07-10 2009-12-10 Цитос Биотехнологи Аг Completed virus-like particles
US8574590B2 (en) 2003-07-30 2013-11-05 Integral Molecular, Inc. Lipoparticles comprising proteins, methods of making, and using the same
WO2005068639A2 (en) 2004-01-20 2005-07-28 Cytos Biotechnology Ag Particle-induced ghrelin immune response
WO2005108425A1 (en) 2004-05-10 2005-11-17 Cytos Biotechnology Ag Il-23 p19 antigen array and uses thereof
EP1750761A1 (en) 2004-06-02 2007-02-14 Cytos Biotechnology AG Medical uses of carrier conjugates of non-human tnf-peptides
WO2005117983A2 (en) 2004-06-02 2005-12-15 Cytos Biotechnology Ag Carrier conjugates of tnf-peptides
WO2006027300A2 (en) 2004-08-04 2006-03-16 Cytos Biotechnology Ag Carrier conjugates of gnrh-peptides
NZ554387A (en) 2004-09-21 2009-09-25 Cytos Biotechnology Ag Virus-like particles comprising a fusion protein of the coat protein of AP205 and an antigenic polypeptide
EP1812051A2 (en) 2004-10-05 2007-08-01 Cytos Biotechnology AG Vlp-antigen conjugates and their uses as vaccines
NZ554386A (en) 2004-10-25 2009-12-24 Cytos Biotechnology Ag Gastric inhibtory polypeptide (GIP) antigen arrays with VLPs and uses thereof
EP1804829A1 (en) 2004-10-29 2007-07-11 Cytos Biotechnology AG T-cadherin antigen arrays and uses thereof
MX2007006832A (en) 2004-12-13 2007-08-07 Cytos Biotechnology Ag Il-15 antigen arrays and uses thereof.
CN101141979B (en) 2005-03-18 2013-05-08 赛托斯生物技术公司 Cat allergen conjugates and uses thereof
WO2006134125A1 (en) 2005-06-14 2006-12-21 Cytos Biotechnology Ag Antigen conjugates and uses thereof
CA2621466A1 (en) 2005-09-08 2007-04-05 Kentucky Bioprocessing, Llc Modified tobacco mosaic virus particles as scaffolds for display of protein antigens for vaccine applications
WO2007039552A1 (en) 2005-09-28 2007-04-12 Cytos Biotechnology Ag Interleukin-1 conjugates and uses thereof
US8586708B2 (en) * 2005-10-28 2013-11-19 Massachusetts Institute Of Technology Monovalent streptavidin compositions
MX2008007292A (en) 2005-12-08 2008-10-17 Univ Louisville Res Found Immunostimulatory compositions and methods.
US7745215B2 (en) 2005-12-08 2010-06-29 University Of Louisville Research Foundation, Inc. Methods and compositions for expanding T regulatory cells
US9803189B2 (en) 2006-08-23 2017-10-31 Stc.Unm Virus-like platform for rapid vaccine discovery
WO2012048430A1 (en) 2010-10-14 2012-04-19 Folia Biotech Inc. Affinity-conjugated nucleoprotein-papaya mosaic virus-like particles and uses thereof
CA2672826A1 (en) 2006-12-21 2008-06-26 Cytos Biotechnology Ag Circular ccr5 peptide conjugates and uses thereof
WO2008115631A2 (en) 2007-02-08 2008-09-25 University Of Louisville Research Foundation, Inc. Plant-produced compositions for treating papillomavirus infection and related methods
AU2008339904A1 (en) 2007-12-20 2009-07-02 Cytos Biotechnology Ag Nerve growth factor conjugates and uses thereof
KR20100135767A (en) 2008-03-05 2010-12-27 사이토스 바이오테크놀로지 아게 Use of interleukin-1 conjugates in the treatment of diabetes
MX2010011373A (en) 2008-04-22 2010-11-12 Cytos Biotechnology Ag Vaccine compositions for the treatment of dengue fever and uses thereof.
US20110206727A1 (en) 2008-07-30 2011-08-25 Denis Leclerc Multivalent Vaccines Based on Papaya Mosaic Virus and Uses Thereof
US9724404B2 (en) 2009-04-13 2017-08-08 INSERM (Institut National de la Santé et de la Recherche Médicale) HPV particles and uses thereof
CN102497880A (en) 2009-06-25 2012-06-13 葛兰素史密丝克莱恩生物有限公司 Novel human papillomavirus (HPV) protein constructs and their use in the prevention of HPV disease
CN102858960B (en) 2009-12-31 2014-11-26 Stc.Unm公司 Plasmids and methods for peptide display and affinity-selection on virus-like particles of RNA bacteriophages
WO2013003353A2 (en) 2011-06-30 2013-01-03 Stc.Unm Plasmids and methods for peptide display and affinity-selection on virus-like particles of rna bacteriophages
GB201002362D0 (en) 2010-02-11 2010-03-31 Isis Innovation Peptide tag systems that spontaneously form an irreversible link to protein partners via isopeptide bonds
WO2011116226A2 (en) 2010-03-17 2011-09-22 Stc.Unm Display of antibody fragments on virus-like particles of rna bacteriophages
US9580474B2 (en) 2010-09-08 2017-02-28 The Johns Hopkins University Polyionic papilloma virus-like particle (VLP) vaccines
FR2973032A1 (en) 2011-03-24 2012-09-28 Commissariat Energie Atomique PEPTIDES CAPABLE OF FORMING A COVALENT COMPLEX AND THEIR USES
US20120259101A1 (en) 2011-04-11 2012-10-11 Li Tan Isopeptide Bond Formation in Bacillus Species and Uses Thereof
GB201214029D0 (en) 2012-08-07 2012-09-19 Queen Mary & Westfield College method
WO2014088928A1 (en) 2012-12-03 2014-06-12 President And Fellows Of Harvard College Methods for making targeted protein toxins by sortase-mediated protein ligation
LT2943579T (en) 2013-01-10 2018-11-12 Dharmacon, Inc. Libraries and methods for generating molecules
EP2948469A4 (en) 2013-01-23 2016-11-02 Univ Leland Stanford Junior Stabilized hepatitis b core polypeptide
MX367150B (en) 2013-07-08 2019-08-07 Novartis Ag Rotavirus particles with chimeric surface proteins.
US10526376B2 (en) 2015-01-15 2020-01-07 University Of Copenhagen Virus-like particle with efficient epitope display
GB2535753A (en) 2015-02-26 2016-08-31 The Native Antigen Company Particles comprising fusion proteins
US20180298098A1 (en) 2015-02-26 2018-10-18 Var2 Pharmaceutical Aps Immunotherapeutic targeting of placental-like chondroitin sulfate using chimeric antigen receptors (cars) and immunotherapeutic targeting of cancer using cars with split-protein binding systems
GB201509782D0 (en) 2015-06-05 2015-07-22 Isis Innovation Methods and products for fusion protein synthesis

Also Published As

Publication number Publication date
WO2017071713A1 (en) 2017-05-04
EP3368068A1 (en) 2018-09-05
DK3368068T3 (en) 2021-02-22
US20190022206A1 (en) 2019-01-24
US11129882B2 (en) 2021-09-28
ES2854726T3 (en) 2021-09-22
EP3368068B1 (en) 2020-11-18

Similar Documents

Publication Publication Date Title
US11497800B2 (en) Virus-like particle with efficient epitope display
US11129882B2 (en) Virus like particle with efficient epitope display
US8470560B2 (en) CR-2 binding peptide P28 as molecular adjuvant for DNA vaccines
RU2585228C2 (en) Modification of recombinant adenovirus with immunogenic epitopes of circumsporozoite protein plasmodium
EP3156068B1 (en) Pharmaceutical compositions comprising a polypeptide comprising at least one cxxc motif and heterologous antigens and uses thereof
US11096999B2 (en) Treatment and prevention of malaria
JP2021529538A (en) Vaccine composition for the prevention or treatment of severe febrile thrombocytopenia syndrome (SFTS) viral infection disease
McGuire et al. New adenovirus-based vaccine vectors targeting Pfs25 elicit antibodies that inhibit Plasmodium falciparum transmission
Karen et al. A replicating adenovirus capsid display recombinant elicits antibodies against Plasmodium falciparum sporozoites in Aotus nancymaae monkeys
JP2017527293A (en) Three component multi-stage malaria vaccine
US10994007B2 (en) Immunity inducer
US10183067B1 (en) TAA/CD4OL composition/vaccine for malaria
Xing et al. The ability of Hepatitis B surface antigen DNA vaccine to elicit cell-mediated immune responses, but not antibody responses, was affected by the deglysosylation of S antigen
JP2011502521A (en) HIV-1 coat glycoprotein oligomer and method of use
US11452769B2 (en) Mosquito saliva protein malaria vaccine
US20220016231A1 (en) Hepatitis b virus vaccine and uses thereof

Legal Events

Date Code Title Description
FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO UNDISCOUNTED (ORIGINAL EVENT CODE: BIG.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

AS Assignment

Owner name: UNIVERSITY OF COPENHAGEN, DENMARK

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:PEDERSEN, ADAM FREDERIK SANDER;SALANTI, ALI;THEANDER, THOR;AND OTHERS;SIGNING DATES FROM 20180413 TO 20180420;REEL/FRAME:045681/0774

FEPP Fee payment procedure

Free format text: ENTITY STATUS SET TO SMALL (ORIGINAL EVENT CODE: SMAL); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

FEPP Fee payment procedure

Free format text: PETITION RELATED TO MAINTENANCE FEES GRANTED (ORIGINAL EVENT CODE: PTGR); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS

STPP Information on status: patent application and granting procedure in general

Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED

STCF Information on status: patent grant

Free format text: PATENTED CASE