US20200016262A1 - Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes - Google Patents

Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes Download PDF

Info

Publication number
US20200016262A1
US20200016262A1 US16/558,467 US201916558467A US2020016262A1 US 20200016262 A1 US20200016262 A1 US 20200016262A1 US 201916558467 A US201916558467 A US 201916558467A US 2020016262 A1 US2020016262 A1 US 2020016262A1
Authority
US
United States
Prior art keywords
hla
seq
cell
cells
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US16/558,467
Inventor
Mark Cobbold
David Millar
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Birmingham
Original Assignee
University of Birmingham
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Birmingham filed Critical University of Birmingham
Priority to US16/558,467 priority Critical patent/US20200016262A1/en
Assigned to THE UNIVERSITY OF BIRMINGHAM reassignment THE UNIVERSITY OF BIRMINGHAM ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: COBBOLD, MARK, MILLAR, DAVID
Publication of US20200016262A1 publication Critical patent/US20200016262A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/245Herpetoviridae, e.g. herpes simplex virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/646Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6881Cluster-antibody conjugates, i.e. the modifying agent consists of a plurality of antibodies covalently linked to each other or of different antigen-binding fragments covalently linked to each other
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • A61P31/22Antivirals for DNA viruses for herpes viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6056Antibodies
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16111Cytomegalovirus, e.g. human herpesvirus 5
    • C12N2710/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • This application relates to immunotherapeutic agents employing a plurality of T-cell epitopes.
  • it relates to agents that can be used to treat a condition characterized by the presence of unwanted cells, such as cancer or other disease-causing cells.
  • an agent for preventing or treating a condition characterized by the presence of unwanted cells includes a targeting moiety that is capable of targeting to the unwanted cells and a T-cell epitope that can be released from the targeting moiety by selective cleavage of a cleavage site in the agent in the vicinity of the unwanted cells.
  • WO 2014/043523 teaches an agent based on an ScFV directed to cancer cells including from 1-10 immunogenic CD8 T-cell epitopes in one of the following two arrangements: T-c-En-c-Fcn or T-c-Fcn-c-En, where T is the ScFv, En is from 1-10 CD8 T-cell epitopes, c: is a protease cleavage site, and Fcn is from 1-10 Fc portions of an IgG antibody.
  • the 1-10 immunogenic CD8 T-cells are released from the ScFv and Fc portions of the agent in a single polypeptide chain, still conjugated to each other.
  • TPECs targeting moiety peptide epitope complexes
  • a targeting moiety may be used to deliver the TPEC to an area of unwanted cells, allowing for a therapeutic effect to be delivered locally.
  • the TPEC also contains a plurality of T-cell epitopes.
  • the TPEC further comprises cleavage sites that release the T-cell epitopes from the targeting agent, and in some embodiments from each other, when they are in the microenvironment of the unwanted cells.
  • the T-cell epitopes function by stimulating an immune response against the unwanted cells.
  • maximal benefits may be achieved by releasing all of the T-cell epitopes from both the targeting agent and from each other in the cleavage process, allowing each T-cell epitope the structural freedom to attract an immune response to the unwanted cell.
  • T-cell epitopes enhances the immune response against the unwanted cells, either by stimulating a stronger immune response in a given patient or by allowing the TPEC to stimulate an immune response across a wide variety of patients in different ethnic and racial groups.
  • composition for retargeting an immune response to unwanted cells comprises a TPEC wherein:
  • T is a targeting moiety that is capable of targeting unwanted cells
  • L is at least one linker capable of chemical linkage to T where L may be a peptide bond, at least one peptide, or a chemical linker;
  • c. C is at least one cleavage site
  • E is at least one T-cell epitope, wherein the L, C, and E moieties are arranged in at least one of the following patterns:
  • a composition for retargeting an immune response to unwanted cells comprises a TPEC having a plurality of T-cell epitopes separately conjugated to a targeting moiety comprising the formula T-(L-C-E) n or T-(L-C i -E j ) n , wherein:
  • T is a targeting moiety that is capable of targeting unwanted cells
  • L is a linker capable of chemical linkage to T
  • c. C is a cleavage site
  • E is a T-cell epitope
  • n is an integer of at least 2 (optionally from about 2 to 50), i is an integer of at least 2 (optionally from about 1 to 50), and j is an integer of at least 2 (optionally from about 1 to 50).
  • n refers to the number of L-C-E moieties on the targeting moiety and the “i” and “j” integers refer to how many different types of cleavage sites and epitopes are within the construct.
  • a composition for retargeting an immune response to unwanted cells comprises a TPEC with either a (i) linear and/or bundled polytope or a (ii) branched polytope.
  • a TPEC may comprise the formula T-L-(C i -E j ) n , wherein:
  • T is a targeting moiety that is capable of targeting unwanted cells
  • L is an optional linker capable of chemical or peptide linkage to T;
  • c. C is a cleavage site
  • E is a T-cell epitope
  • n is an integer of at least 2 (optionally from about 2 to 50), i is an integer of at least 2 (optionally from about 1 to 50), and j is an integer of at least 2 (optionally from about 1 to 50).
  • n refers to the number of C-E moieties on the targeting moiety and the “i” and “j” integers refer to how many different types of cleavage sites and epitopes are within the construct.
  • composition for retargeting an immune response to unwanted cells comprises a TPEC having:
  • a targeting moiety that is capable of targeting unwanted cells
  • FIGS. 1A-B show certain embodiments of TPECs.
  • a targeting moiety optionally an antibody
  • a targeting moiety has a plurality of copies of the same T-cell epitope affixed to it using a chemical linker and a cleavage site.
  • a targeting moiety optionally an antibody
  • the linker-cleavage site-T-cell-epitopes may be affixed to the targeting moiety in random locations and in random amounts, creating a heterogeneous population of TPECs.
  • the TPEC comprises a plurality of L-C-E, each attached separately to T, where L is linker, C is cleavage site, E is epitope, and T is targeting moiety.
  • FIGS. 2A-C show certain embodiments of TPECs.
  • a targeting moiety optionally an antibody, has a plurality of different T-cell epitopes affixed to it using a chemical or peptide linker, wherein the plurality of T-cell epitopes is separated by cleavage sites and affixed to the targeting moiety in a bundle.
  • FIG. 2B shows the bundle of T-cell epitopes having immunoglobulin framework regions flanking certain domains. Both FIGS. 2A and 2B include polytopes with a linear configuration. In the embodiments of FIGS.
  • the TPEC comprises at least one of L-(C-E)n, with each C-E attached to the L in series (in a bundled and/or linear configuration), and wherein n is an integer of at least 2 (optionally from about 2 to 50) and where L is linker, C is cleavage site, E is epitope, and T is targeting moiety.
  • FIG. 2C shows one embodiment of a TPEC comprising a polytope with a branched configuration. In another embodiment, not shown, the polytope with a branched configuration may have identical T-cell epitopes. In the embodiments of FIG.
  • the TPEC comprises at least one of L-(C-E)n, with each C-E attached to the L in parallel (in a branched configuration), and wherein n is an integer of at least 2 (optionally from about 2 to 50) and where L is linker, C is cleavage site, E is epitope, and T is targeting moiety.
  • FIGS. 3A-C show in vitro activity of re-directed virus specific T cells (Multiple Peptide TPEC approach). Recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of two different viral peptides, RPHERNGFTVL (SEQ ID NO: 2) and NLVPMVATV (SEQ ID NO: 1), to the anti-CD20 antibody Rituximab.
  • RPHERNGFTVL SEQ ID NO: 2
  • NLVPMVATV SEQ ID NO: 1
  • Antibody is conjugated using sulfo-SMCC to peptides NLVPMVATVASGV ⁇ CIT ⁇ GC (SEQ ID NO: 3) and RPHERNGFTVLASGFKGC (SEQ ID NO: 4) at different ratios from 100% NLV:0% RPH through to 0% NLV:100% RPH.
  • Target lymphoma cells labeled with TPEC are recognized by lymphocytes specific towards the NLV peptide (A) at all ratios down to 10% of the conjugated peptide being NLVPMVATVASGV ⁇ CIT ⁇ GC (SEQ ID NO: 3).
  • target lymphoma cells are recognized by lymphocytes specific towards the RPH peptide (B) at all ratios down to 10% of the conjugated peptide being the RPHERNGFTVLASGFKGC (SEQ ID NO: 4).
  • B lymphocytes specific towards the RPH peptide
  • C Overlaid plots of (A) and (B) demonstrating activity of both NLV and RPH specific T cells using Rituximab TPECs conjugated with the two different peptides.
  • FIG. 4 illustrates recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of three different viral peptides, VLEETSVML (SEQ ID NO: 5), CRVLCCYVL (SEQ ID NO: 17) and YILEETSVM (SEQ ID NO: 7), to the anti-CD20 antibody Rituximab.
  • VLEETSVML SEQ ID NO: 5
  • CRVLCCYVL SEQ ID NO: 17
  • YILEETSVM SEQ ID NO: 7
  • Antibody is conjugated using sulfo-SMCC to equal amount of peptides VLEETSVMLASGFKGC (SEQ ID NO: 8), BRVLBBYVLASGFKGC (SEQ ID NO: 9) where B is amino butyric acid, a homolog for cysteine and YILEETSVMASGFKGC (SEQ ID NO: 10).
  • Target lymphoma cells labeled with the TPEC are recognized by T cells specific for each of the three peptides conjugated to the antibody. Untreated target cells are not recognized by any of the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIG. 5 demonstrates recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of polytope peptides.
  • Antibody is conjugated using sulfo-SMCC to peptides
  • CGVANLVPMVATVARPHERNGFTVL (SEQ ID NO: 13).
  • Target lymphoma cells labeled with TPEC are recognized by T cells specific for the NLVPMVATV (SEQ ID NO: 1) peptide.
  • Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIGS. 6A-B demonstrate the protein conjugation chemistry of one embodiment of the branched peptide using a stem peptide that contains four azidonorleucine residues and peptides (branches) that contain propargyl glycine at the amino terminus ( FIG. 6A ).
  • a stem peptide that contains four azidonorleucine residues and peptides (branches) that contain propargyl glycine at the amino terminus
  • FIG. 6A Incubation of equimolar concentrations of the branches with the stem peptide in DMSO in the presence of 10 mg in 4 ml of the CuSO 4 5 H2O catalyst mixed with 10 mg in 4 ml ascorbic acid overnight resulted in the formation of the branched peptide used for conjugation. The final concentration of DMSO for the reaction was 50%.
  • the branched peptides were purified using HPLC and verified using mass spectrometry ( FIG. 6B ).
  • the peptides contain an
  • FIGS. 7A-B demonstrate recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of polytope peptides in the branched peptide format.
  • Antibody is conjugated using the embodiment in FIG. 6B using the following peptides:
  • Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides. Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIGS. 8A-B demonstrate recognition of an ovarian carcinoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of polytope peptides in the branched peptide format.
  • Antibody is conjugated using the embodiment in FIG. 6B using peptides
  • Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides. Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIGS. 9A-C provide an embodiment of the bundled domain TPEC.
  • FIG. 9A demonstrates the scaffold (Fibronectin type 3 domain from the fibronectin 1 protein) used for the bundled domain TPEC.
  • the bundled domain sequence ( FIG. 9A ) demonstrates the mutations made in the outer loops of the domain and contains viral epitopes separated from the fibronectin sequence on both sides by a protease recognition sequence specific for MMP2. The protease cleavage sites are underlined and the viral epitope are shown in bold and italics.
  • FIG. 9B demonstrates the structure of the bundled domain and the “BC”, “DE” and “FG” loops that contain the viral epitopes.
  • FIG. 9A demonstrates the scaffold (Fibronectin type 3 domain from the fibronectin 1 protein) used for the bundled domain TPEC.
  • the bundled domain sequence ( FIG. 9A ) demonstrates the mutations made in the outer loops of the domain and contains viral epitop
  • CMV epitopes are contained within an additional protein domain linked to the heavy chain of Cetuximab.
  • the viral epitopes are flanked by an MMP2 protease recognition sequence which will allow release of the viral epitopes in the presence of MMP2, produced by the target cell line.
  • the bundled domain TPEC is produced in Expi293 cells and purified using protein A sepharose beads.
  • Target ovarian carcinoma cells labelled with the bundled domain TPEC are recognized by T cells specific for the viral epitope NLVPMVATV (SEQ ID NO: 1) by release of IFN- ⁇ .
  • T cells specific for the viral epitope NLVPMVATV SEQ ID NO: 1
  • Four different preparations two TPECs produced on each of two days using different concentrations of DNA) of the bundled domain were used, all of which produced similar amounts of bundled domain TPEC and produced similar recognition of target cells by the peptide-specific T cells.
  • Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • Table 1 provides a listing of certain sequences referenced herein.
  • ⁇ Cit ⁇ citrulline CMV TCE and cleavage site from RPHERNGFTVL ASGFKGC 4 capthepsin B cleavage site in bold CMV TCD (IE1, position 316-324, VLEETSVML 5 HLA-A2) CMV TCE BRVLBBYVL, where B is 6 (IE1, 309-317, HLA-C7) alpha-aminobutyric acic, (Peptidomimetic of SEQ ID NO: 17) a homolog for cysteine CMV TCE (IE1, 315-323, HLA-A2) YILEETSVM 7 CMV TCE and cleavage site from VLEETSVML ASGFKGC 8 capthepsin B cleavage site in bold CMV TCE and cleavage site from BRVLBBYVL ASGFKGC , where 9 capthepsin B B is alpha-aminobutyric acid cleavage site in bold CMV TCE and cleavage site from
  • TPECs targeting moiety peptide epitope complexes
  • a targeting moiety may be used to deliver the TPEC to an area of unwanted cells, allowing for a therapeutic effect to be delivered locally.
  • the TPEC also contains a plurality of T-cell epitopes.
  • the TPEC further comprises cleavage sites that release the T-cell epitopes from the targeting agent, and in some embodiments from each other, when they are in the microenvironment of the unwanted cells.
  • the T-cell epitopes function by stimulating an immune response against the unwanted cells.
  • maximal benefits may be achieved by releasing all of the T-cell epitopes from both the targeting agent and from each other in the cleavage process, allowing each T-cell epitope to attract an immune response to the unwanted cell.
  • the cleavage at the cleavage site allows the T-cell epitopes to be trimmed at either or both ends to the appropriate length to produce a peptide that can fit in the peptide-binding groove of HLA class I and be recognized by T-cells, so as to initiate an immune response.
  • the prior art fails to stimulate a sufficient T-cell response because the T-cell epitopes fused together would not be adequately recognized by the patients T-cells and would, thus, not initiate an immune response against the cancer cells.
  • the TPEC comprises a plurality of T-cell epitopes that are separately conjugated to the targeting moiety. Because the T-cell epitopes will be separately conjugated to the targeting moiety, with two exemplary embodiments shown in FIGS. 1A and 1B , this embodiment may be termed the “hairy” embodiment as the T-cell epitopes protrude from the targeting moiety like individual hairs from a person's skin.
  • a composition for retargeting an immune response to unwanted cells may comprise a TPEC comprising the formula T-(L-C-E) n .
  • a plurality of L-C-E each attach separately to T, wherein:
  • T is a targeting moiety that is capable of targeting unwanted cells
  • L is a linker capable of chemical linkage to T
  • C is a cleavage site that is (i) cleaved by an enzyme expressed by the unwanted cells; (ii) cleaved through a pH-sensitive cleavage reaction inside the unwanted cell; (iii) cleaved by a complement-dependent cleavage reaction; or (iv) cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • E is a T-cell epitope.
  • N is an integer of at least 2 (optionally from about 2 to 50).
  • the same cleavage site may optionally be used multiple times in the TPEC and the same epitope may optionally be used multiple times in the TPEC.
  • the C and E moieties may be the same in the plurality of L-C-E moieties affixed to a single T or a single T may have different C and E moieties in the plurality of L-C-E moieties.
  • the L-C-E complexes may be affixed to the targeting moiety in a random fashion.
  • some TPECs may have greater numbers of T-cell epitopes and some may have fewer numbers.
  • the location of TPECs may differ throughout the preparation. In this vein, when these compounds are administered to a patient suffering from a disease such as cancer, the patient's body will have a much more difficult time mounting an inhibitory immune response against the preparation of TPECs. This may allow the patient to receive multiple doses of the TPEC preparation over a significant period of time, as discussed further below in Section III.B below.
  • the TPEC comprises a plurality of T-cell epitopes that are conjugated to the targeting moiety as a polytope (for poly-epitope), but the conjugation within the polytope and to the targeting moiety occurs through cleavage sites allowing the release of the individual T-cell epitopes in the microenvironment of the unwanted cells.
  • FIGS. 2A, 2B, and 2C Several embodiments of this arrangement are shown in FIGS. 2A, 2B, and 2C .
  • the polytope itself can have a linear and/or bundled configuration (like FIGS. 2A and 2B ) or a branched configuration like a hairbrush with bristles (like FIG. 2C ).
  • a composition for retargeting an immune response to unwanted cells comprises a TPEC having at least one of L-(C-E)n with each C-E attached to the L in series and the L attached to the T. It may have one or a plurality of L-(C-E)n attached to the T.
  • the linker may be either a chemical linker, a peptide bond, or at least one peptide.
  • a composition for retargeting an immune response to unwanted cells comprises at TPEC having at least one of L-(C-E)n with each C-E attached to the L in parallel and the L attached to the T. It may have one or a plurality of L-(C-E)n attached to the T.
  • the linker may be a chemical linker
  • T is a targeting moiety that is capable of targeting unwanted cells
  • L is a linker capable of chemical or peptide linkage to T (including a peptide bond);
  • C is a cleavage site (i) cleaved by an enzyme expressed by the unwanted cells; (ii) cleaved through a pH-sensitive cleavage reaction inside the unwanted cell; (iii) cleaved by a complement-dependent cleavage reaction; or (iv) cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • E is a T-cell epitope
  • n is an integer of at least 2 (optionally from about 2 to 50).
  • the C and E moieties may be the same in the plurality of C-E moieties affixed through L to a single T or a single T may have different C and E moieties in the plurality of C-E moieties.
  • the plurality of the T-cell epitopes being conjugated in a polytope allow for a uniform product to be produced that contains a standard group, number, and arrangement of T-cell epitopes, while still allowing for the release of all of the T-cell epitopes in the microenvironment of the unwanted cells.
  • Microenvironment means the specific set of physical, chemical, and biological conditions in the vicinity of cells within a distance where these conditions can have an effect on or be sensed by the cells.
  • more than one polytope are conjugated to the targeting moiety. In some embodiments from about 1 to 30, 1 to 20, or 1 to 10 polytopes are conjugated to the targeting moiety. In some embodiments, about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 polytopes are conjugated to the targeting moiety, each group by one cleavage site. In these embodiments, the polytopes may be the same or different.
  • the TPEC may have both at least one separately conjugated T-cell epitope and at least one polytope, according to sections I.A and I.B, respectively.
  • the TPEC comprises a plurality of T-cell epitopes that, irrespective of how they are arranged on the targeting moiety, comprise more than 10 T-cell epitopes.
  • the T-cell epitopes may be separately conjugated or conjugated in a polytope.
  • a composition for retargeting an immune response to unwanted cells may comprise a TPEC having:
  • cleavage site is (i) cleaved by an enzyme expressed by the unwanted cells; (ii) cleaved through a pH-sensitive cleavage reaction inside the unwanted cell; (iii) cleaved by a complement-dependent cleavage reaction; or (iv) cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC.
  • the immune response against the unwanted cells is notably stronger. In some embodiments, including TPECs with more than 10 T-cell epitopes, the TPEC can be used to treat a greater proportion of patients suffering from the condition characterized by unwanted cells.
  • the T-cell epitopes may be separately conjugated to the targeting moiety, each T-cell epitope by a cleavage site. In some embodiments, with TPECs having more than 10 T-cell epitopes, the T-cell epitopes may be conjugated to the targeting moiety as at least one polytope, each polytope conjugated to the targeting moiety by a cleavage site. In some embodiments, the T-cell epitopes within a polytope have cleavage sites between them.
  • compositions Comprising TPECs
  • a composition may comprise a plurality of TPECs. In some embodiments, all of the TPECs in the composition are the same. In some embodiments, at least some of the TPECs in the composition are not identical.
  • each TPEC is conjugated to a plurality of identical T-cell epitopes.
  • At least some of the TPECs in the composition are conjugated to a plurality of T-cell epitopes that are not identical.
  • a composition may comprise at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or more different TPECs.
  • T-cell epitopes function in the TPECs to attract the patient's own immune response to attack the unwanted cell by labeling it with antigenic T-cell epitopes from infectious agents.
  • T-cell epitopes Every person has six HLA class-I molecules that can bind peptides to present to CD8 T cells with some HLA types more prevalent in the population than others, such as HLA-A201 which is found in ⁇ 45% of the Caucasian population. In situations where the epitopes chosen for conjugation are able to bind to a limited set of HLA molecules that are only found in a proportion of the population, the TPEC may not have any or as much effectiveness in other segments of the population.
  • HLA-A201 Using HLA-A201 as an example, if the targeting moiety is conjugated with a T-cell epitope that binds to HLA-A201 then only patients that express HLA-A201 would bind the epitope and present it to T cells and initiate an immune response. However, in patients who are HLA-A201 negative the epitope may not be able to bind to their HLA molecules and there would be no or a lesser immune response. In situations where the therapy may be provided to a wide segment of the population having different HLA molecules, using different epitopes that bind to more HLA molecules could enhance the effectiveness of the TPEC across the population.
  • T-cell epitopes may be chosen from those that a particular person has been exposed to, a wide variety of people have been exposed to, or for which vaccines have or can be administered.
  • T cells generally recognize the epitope in complex with an HLA molecule when the patient has been previously infected with the virus from which the epitope is derived (or in instances where the patient has previously received a vaccine containing those epitopes).
  • Vaccines may have been administered for a prior purpose (such as childhood vaccines) or may be administered preceding TPEC treatment with the same epitope.
  • T-cell epitopes are chosen from cytomegalovirus (CMV), influenza, Epstein Barr virus (EBV), varicella zoster, mumps, measles, rubella, adenovirus, polio, vaccinia, RSV, rotavirus, tetanus, vaccinia, and yellow fever T-cell epitopes.
  • CMV cytomegalovirus
  • EBV Epstein Barr virus
  • Varicella zoster mumps, measles, rubella, adenovirus, polio, vaccinia, RSV, rotavirus, tetanus, vaccinia, and yellow fever T-cell epitopes.
  • Epitopes may be chosen from infectious agents that are prevalent across the population in question or for which there are vaccines that are regularly administered or could be administered as part of a combination therapy approach.
  • the T-cell epitopes are chosen from at least 2, 3, 4, or 5 different infectious agents. In certain embodiments, at least some of the T-cell epitopes are CMV epitopes.
  • the plurality of T-cell epitopes are not all identical. In some embodiments, the plurality of T-cell epitopes are the same. In certain embodiments, the plurality of T-cell epitopes comprise some that are the same and some that are different.
  • the T-cell epitopes may be all MEC Class I restricted peptides, all MEC class II restricted peptides, or a combination of both Class I and Class II.
  • the plurality of T-cell epitopes are from about 7 to 14 amino acids in length, from about 8 to 13, from about 9 to 12, about 9, or about 10 amino acids.
  • At least 2, 3, 4, 5, 6, 7, 8, 9, or 10 different T-cell epitopes are used in the TPECs, whether the TPECs are the same or different.
  • using a plurality of different T-cell epitopes allows the agent to stimulate a T-cell response in at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, or 90% of the human population.
  • the T-cell epitopes are chosen from HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, CD1d, and MR1.
  • the T-cell epitopes are chosen from HLA-A*01, HLA-A*02, HLA-A*03, HLA-A*11, HLA-A*24, HLA-B*44, HLA-B*07, HLA-B*08, HLA-B*15, HLA-B*35, HLA-B*40, HLA-C*07, HLA-C*03, HLA-C*05, HLA-C*04, HLA-C*06, and HLA-E*0101 restricted antigens.
  • the composition comprises at least the following T-cell epitopes HLA-A*02, HLA-A*01, and HLA-A*03.
  • immunodominant T-cell epitopes When desired, more immunodominant T-cell epitopes may be selected.
  • immunodominant we mean those epitopes that elicit the strongest immune response in a given patient and/or those that are known to be immunogenic across a wide cross-section of people.
  • the T-cell epitopes comprise at least one of the epitopes provided in Table 2. In some embodiments, the T-cell epitopes are chosen from the epitopes provided in Table 2.
  • T-Cell Epitopes Peptide from Sequence Position HLA Type Cytomegalovirus Epitopes IE1 ATTFLQTMLR (SEQ ID NO: 15) 32-41 HLA-A68 IE1 BRVLBBYVL (SEQ ID NO: 6) 309-317 HLA-C7 (variant of SEQ ID NO: 17, where the C residues are changed to B residues, wherein B is alpha- aminobutyric acid) pp65 CPSQEPMSIYVY (SEQ ID NO: 16) 103-114 HLA-B35 IE1 CRVLCCYVL (SEQ ID NO: 17) 309-317 HLA-C7 IE1 CVETMCNEY (SEQ ID NO: 18) 279-287 HLA-A1/B18 IE1 DELRRKMMY (SEQ ID NO: 19) 198-206 HLA-A1/B18 pp65 DTPVLPHETR (SEQ ID NO: 20) 31-40 HLA-A
  • the targeting moiety functions in the TPEC by delivering the TPEC to the local environment of the unwanted cells, enabling a localized treatment strategy.
  • the targeting moiety targets the unwanted cells by specifically binding to the unwanted cells.
  • the targeting moiety specifically binds the unwanted cells even while the plurality of T-cell epitopes are conjugated to the targeting moiety.
  • the targeting moiety is an antibody or functional part thereof.
  • Certain antibody targets may include: Her2/Neu (Epithelial malignancies); CD22 (B cells, autoimmune or malignant); EpCAM (CD326) (Epithelial malignancies); EGFR (epithelial malignancies); PMSA (Prostate Carcinoma); CD30 (B cell malignancies); CD20 (B cells, autoimmune, allergic or malignant); CD33 (Myeloid malignancies); membrane lgE (Allergic B cells); lgE Receptor (CD23) (Mast cells or B cells in allergic disease), CD80 (B cells, autoimmune, allergic or malignant); CD86 (B cells, autoimmune, allergic or malignant); CD2 (T cell or NK cell lymphomas); CA125 (multiple cancers including Ovarian carcinoma); Carbonic Anhydrase IX (multiple cancers including Renal Cell Carcinoma); CD70 (B cells, autoimmune, allergic or malignant); CD74 (B cells, autoimmune, allergic or malignant); CD56
  • antibodies include an anti-epidermal growth factor receptor antibody such as Cetuximab, an anti-Her2 antibody, an anti-CD20 antibody such as Rituximab, an anti-CD22 antibody such as Inotuzumab, G544 or BU59, an anti-CD70 antibody, an antiCD-33 antibody such as hp67.6 or Gemtuzumab, an anti-MUC1 antibody such as GP1.4 and SM3, an anti-CD40 antibody, an anti-CD74 antibody, an anti-P-cadherin antibody, an anti-EpCAM antibody, an anti-CD138 antibody, an anti-E-cadherin antibody, an anti-CEA antibody, an anti-FGFR3 antibody, and an anti- ⁇ 4-integrin antibody such as natalizumab.
  • an anti-epidermal growth factor receptor antibody such as Cetuximab, an anti-Her2 antibody, an anti-CD20 antibody such as Rituximab, an anti-CD22 antibody such as Inotuzumab, G5
  • the cleavage sites function to release the T-cell epitope from the targeting moiety and, in some embodiments, to release the T-cell epitopes from each other. Releasing the T-cell epitopes into single epitopes allows them to most effectively label the unwanted cell for immune attack.
  • the cleavage site may be a separate sequence and in other instances the cleavage site may be integrated into the T-cell epitope such that one sequence serves the function of both elements. This may apply to any of the embodiments described herein and is determined by the selection of the epitope sequences.
  • the cleavage sites can function in different ways to release the T-cell epitopes in the microenvironment of the unwanted cells.
  • the cleavage may occur inside the unwanted cell or outside the unwanted cell, depending on the strategy employed. If cleavage occurs outside the unwanted cell, the T-cell epitope peptides can be presented without first being internalized into a cell and being engaged in the classical antigen-processing pathways. If cleavage occurs outside the unwanted cell, it may occur in the microenvironment surrounding the cell, including at the cell surface. For example, when the unwanted cell is a cancer cell, the cleavage may occur in the tumor microenvironment (outside of an in the vicinity of the cancer cell), including at the surface of the cancer cell.
  • At least one cleavage site may be cleaved by an enzyme expressed by the unwanted cells.
  • Cancer cells for instance, are known to express certain enzymes, such as proteases, and these may be employed in the TPEC strategy to cleave the TPEC's cleavage site.
  • cathepsin B cleaves FR, FK, VA and VR amongst others
  • cathepsin D cleaves PRSFFRLGK (SEQ ID NO: 181)
  • ADAM28 cleaves KPAKFFRL (SEQ ID NO: 182)
  • DPAKFFRL SEQ ID NO: 183
  • KPMKFFRL SEQ ID NO: 184
  • LPAKFFRL SEQ ID NO: 185
  • MMP2 cleaves AIPVSLR (SEQ ID NO: 186).
  • At least one cleavage site may be cleaved through a pH-sensitive cleavage reaction inside the unwanted cell. If the TPEC is internalized into the cell, the cleavage reaction may occur inside the cell and may be triggered by a change in pH between the microenvironment outside the unwanted cell and the interior of the cell.
  • some cancer types are known to have acidic environments in the interior of the cancer cells. Such an approach may be employed when the interior unwanted cell type has a characteristically different pH from the extracellular microenvironment, such as particularly the glycocalyx. Because pH cleavage can occur in all cells in the lysozymes, selection of a targeting agent when using a pH-sensitive cleavage site may require, when desired, more specificity. For example, when a pH-sensitive cleavage site is used, a targeting agent that binds only or highly preferably to cancer cells may be desired (such as, for example, an antibody binding to mesothelin for treatment of lung cancer).
  • At least one cleavage site may be cleaved by a complement-dependent cleavage reaction.
  • the patient's complement cascade may be triggered.
  • the complement cascade may also be used to cleave the T-cell epitope from the targeting agent by using a cleavage site sensitive to a complement protease.
  • C1r and C1s and the C3 convertases are serine proteases.
  • C3/C5 and C5 are also complement proteases Mannose-associated binding proteins (MASP), serine proteases also involved in the complement cascade and responsible for cleaving C4 and C2 into C4b2b (a C3 convertase) may also be used.
  • MASP Mannose-associated binding proteins
  • C1s cleaves YLGRSYKV (SEQ ID NO: 177) and MQLGRX (SEQ ID NO: 178).
  • MASP2 is believed to cleave SLGRKIQI (SEQ ID NO: 179).
  • Complement component C2a and complement factor Bb are believed to cleave GLARSNLDE (SEQ ID NO: 180).
  • At least one cleavage site may be cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC.
  • a protease may be simultaneously directed to the microenvironment of the unwanted cells by conjugating the protease to a targeting agent that delivers the protease to that location.
  • the targeting agent may be any targeting agent described herein.
  • the protease may be affixed to the targeting agent through a peptide or chemical linker and may maintain sufficient enzymatic activity when bound to the targeting agent.
  • the TPEC has a plurality of cleavage sites that are the same. In other embodiments, the TPEC has a plurality of cleavage sites that are not all identical, either in sequence and/or in type, as described above.
  • T-cell epitopes conjugated to cleavage sites may be prepared through standard peptide synthesis chemistry, such as by coupling the carboxyl group of the incoming amino acid to the N-terminus of the growing peptide chain using a N-terminal protecting group addition strategy, such as tert-butoxycaronyl (Boc) and 9-fluorenylmethoxycarbonyl (Fmoc), with their respective deprotection agents TFA and piperidine.
  • Peptide synthesis may occur by hand or in an automated machine. Alternatively, services may be employed that prepare peptides upon order.
  • Polytopes up to ⁇ 50 amino acids could be made by standard peptide synthesis. This would allow up to about 5 epitopes to be incorporated into the polytope. In instances where more epitopes in the polytope are desired, or when human protein domains flank the epitopes in the polytope, then recombinant production of the polytope may occur.
  • the DNA sequence for the polytope would be incorporated into a vector that would allow a cell line such as Chinese hamster ovary (CHO) cells to express the protein.
  • the protein would be secreted by the cell line and could be purified from the cell culture supernatant.
  • the purified polytope could then be conjugated to a targeting moiety through a chemical linker, as described herein.
  • nucleic acids encoding the polytope could be added on to an end of the DNA sequence encoding the targeting moiety to make one continuous polypeptide chain incorporating the targeting moiety and polytope. This could then be expressed in a cell line in the same way as the previous embodiment.
  • Branched polytopes such as shown in FIG. 2C , may also be prepared.
  • Individual T-cell epitopes to be applied to a branched polytope may be prepared according to Section I.H.1 before being conjugated to a connecting stem.
  • the connecting stem may be comprised of amino acids and may be a peptide stem.
  • the peptide stem may comprise amino acids that have a reactive property that can be targeted by crosslinking reagents.
  • cysteine and lysine may be used as there are a large number of crosslinking reagents that may be used at these amino acids.
  • a connecting stem may be a peptide comprising a large number of lysine or cysteine residues to facilitate linking reactions by sulfo-SMCC, for example.
  • the connecting stem may comprise serine or threonine, so as to partner with a crosslinking agent that would link to hydroxyl groups on these amino acids.
  • spacer amino acids may be used in between those that have a reactive property to the crosslinking reagents in order to allow for protease attack without being blocked by other peptides bound to the stem.
  • a basic spacer may include glycine and serine.
  • the incorporation of proline between reactive amino acids may be useful as proline induces a slight rotation of the peptide which may help to keep the protease cleavable peptides bound to the stem further apart.
  • the peptide stem may comprise from about 10 to 80, 20 to 80, or 40 to 80 amino acids. In one embodiment the peptide stem comprises from about 2 to 20 amino acids that are bound to a T-cell epitope and cleavage site.
  • the individual T-cell epitopes may be conjugated to the peptide stem using the chemical linker technology discussed in Section I.I below.
  • the connecting stem comprising the individual T-cell epitopes may also be conjugated to the targeting moiety using the chemical linker technology discussed in Section LI below.
  • a different chemical linker may be chosen for these two conjugations so as to have additional control over the conjugation process.
  • T-cell epitopes may be affixed to the connecting stem by sulfo-SMCC and the connecting stem comprising the T-cell epitopes to the targeting moiety by 3-MPA, for example.
  • cleavage site(s) and plurality of T-cell epitopes may be conjugated to the targeting agent using at least one peptide bond.
  • the conjugation occurs through at least one bond other than a peptide bond.
  • Such a conjugation may be through a chemical linker
  • a nonpeptide bond, such as using a chemical linker may be employed for separately conjugated pairs of T-cell epitopes and cleavage sites or for polytopes.
  • a chemical linker may be a heterobifunctional crosslinking reagent.
  • Heterobifunctional crosslinking reagents covalently bind two proteins together by targeting different functional groups on separate proteins.
  • the amine-to-sulphydryl crosslinking reagents contain an NHS-ester at one end of the reagent, which binds to free amine groups on a first protein/peptide, predominantly on the amino acid lysine.
  • a maleimide group binds to sulphydryl group of a second protein/peptide, which can be found on the amino acid cysteine.
  • Examples of amine-to-sulphydryl crosslinking reagents may include (a) sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (Sulfo-SMCC, which is soluble in water) or succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC, which has poor water solubility), (b) succinimidyl 4-(p-maleimidophenyl)butyrate (SMPB), (c) succinimidyl 6-[(beta-maleimidopropionamido)hexanoate] (SMPH); and (d) Sulfosuccinimidyl 6-(3′-[2-pyridyldithio]-propionamido) hexanoate (Sulfo-LC-SPDP); or (e) maleimide such as 3-maleimidopropionic acid.
  • sulphydryl-to-carbohydrate reagents which contain a maleimide group at one end and a hydrazide group at the other end.
  • the maleimide group binds to a free sulphydryl on a first protein/peptide, such as that found on the amino acid cysteine, and the hydrazide group binds to an aldehyde group formed from an oxidized carbohydrate on a second protein/peptide.
  • This family of reagents includes (a) 3,3′-N-[ ⁇ -Maleimidocaproic acid] hydrazide, trifluoroacetic acid salt (EMCH) and (b)N-beta-Maleimidopropionic acid hydrazide-trifluoroacetic acid (BMPH).
  • EMCH trifluoroacetic acid salt
  • BMPH N-beta-Maleimidopropionic acid hydrazide-trifluoroacetic acid
  • a third group of heterobifunctional cross-linking reagents are the photocleavable reagents including sulfosuccinimidyl 2-([4,4′-azipentanamido]ethyl)-1,3′-dithiopropionate (SDAD). These reagents have an NHS-ester at one end linking to free amines (lysine) and a diazrine group at the other end which can react with any amino acid side chain or peptide backbone upon activation with long-wave ultra violet light (330-370 nm). There are many other reagents from these groups and from other cross-linking groups that can be used in this technology.
  • the T-cell epitopes are flanked on one or both ends by at least one human protein domain.
  • the cleavage sites reside between the T-cell epitopes and the human protein domains
  • human protein domains may be used in this manner.
  • at least one human protein domain may be a beta barrel or a coiled coil.
  • the human protein may be a FN3 (Fibronectin type III) domain.
  • the human protein may be beta-sandwich, Lipocalin, EETI-II/AGRP, Kunitz domain (BPTI), Thioredoxin, Protein A, Ankyrin, gamma-B-crystallin/ubiquitin, CTLD3/Tetranexin, or and LDLR-A
  • the human protein may be human serum albumin, immunoglobulin CH2 domain, or camelid VHH domain.
  • a human protein domain may be a CL, CH2, and/or CH3 domain.
  • a T-cell epitope or plurality of T-cell epitopes may be flanked by CH2 sequences.
  • CH2 sequences may be within the CH2 domain of an antibody or functional part serving as the targeting moiety.
  • CH2 sequences may also be an additional CH2 domain distinct from the targeting moiety.
  • framework regions may be employed in a polytope to give additional three dimensional organization to the polytope.
  • the human protein domain is not a human immunoglobulin protein domain
  • the human protein domain displays the T-cell epitopes on its three-dimensional surface.
  • the TPECs may be employed as pharmaceutical compositions. As such, they may be prepared along with a pharmaceutically acceptable carrier. If parenteral administration is desired, for instance, the TPECs may be provided in sterile, pyrogen-free water for injection or sterile, pyrogen-free saline. Alternatively, the TPECs may be provided in lyophilized form for resuspension with the addition of a sterile liquid carrier.
  • the TPECs described herein may be used in a method of treating a disease in a patient characterized by the presence of unwanted cells comprising administering a TPEC composition to the patient. This may include both treating and preventing a disorder. Additionally, the TPECs described herein may also be used in a method of retargeting (i.e., redirecting) a patient's own immune response to unwanted cells comprising administering a TPEC composition to the patient.
  • the amount of the agent administered to the patient may be chosen by the patient's physician so as to provide an effective amount to treat the condition in question.
  • the patient receiving treatment may be a human.
  • the patient may be a primate or any mammal.
  • the patient may be an animal, such as a domesticated animal (for example, a dog or cat), a laboratory animal (for example, a laboratory rodent, such as a mouse, rat, or rabbit), or an animal important in agriculture (such as horses, cattle, sheep, or goats).
  • a domesticated animal for example, a dog or cat
  • a laboratory animal for example, a laboratory rodent, such as a mouse, rat, or rabbit
  • an animal important in agriculture such as horses, cattle, sheep, or goats.
  • the condition characterized by unwanted cells may include cancer.
  • the cancer may be a solid or non-solid malignancy.
  • the cancer may be any cancer such as breast cancer, ovarian cancer, endometrial cancer, cervical cancer, bladder cancer, renal cancer, melanoma, lung cancer, prostate cancer, testicular cancer, thyroid cancer, brain cancer, oesophageal cancer, gastric cancer, pancreatic cancer, colorectal cancer, liver cancer, leukaemia, myeloma, nonHodgkin's lymphoma, Hodgkin's lymphoma, acute myeloid leukaemia, acute lymphoblastic leukaemia, chronic lymphoblastic leukaemia, lymphoproliferative disorder, myelodysplastic disorder, myeloproliferative disease and premalignant disease.
  • the condition characterized by unwanted cells may also include an allergic or autoimmune disease.
  • autoimmune diseases may include Addison's disease, celiac disease, dermatomyositis, Graves' disease, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, pernicious anemia, reactive arthritis, rheumatoid arthritis, Sjogren syndrome, and systemic lupus erythematosus.
  • the TPECs may be administered alone or in conjunction with other forms of therapy, including surgery, radiation, or traditional chemotherapy.
  • the activity of the TPECs may also be enhanced by boosting the patient's immune response against one or more of the T-cell epitopes used, such as by vaccinating the subject with the T-cell epitope or by administering immunostimulatory agents.
  • the patient receives multiple doses of the composition over at least 30, 45, 60, 75, 90, 120, 150, or more days, or on an ongoing basis. In certain modes the patient receives multiple doses of the composition over at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months, or on an ongoing basis. If approaches are employed to reduce the patient's immune response against the TPEC itself, additional benefits may be achieved by administering the composition to a patient in relapse who received the composition for an earlier round of therapy.
  • having multiple copies of the same T-cell epitope increases an immune response against the unwanted cell when the agent is administered to a patient and having a diversity of T-cell epitopes assures effectiveness across a wide variety of patients from different racial and ethnic groups. Nevertheless, if a physician desires to use a TPEC therapy over a continued period of time, optional steps may be taken to reduce the patient's own immune response against the TPEC itself.
  • the arrangement or composition of T-cell epitopes on the TPEC are random in nature. For example, if a mixture of T-cell epitopes are conjugated using a chemical linker to the targeting moiety, different combinations of T-cell epitopes may affix to the targeting moieties. This makes it significantly more difficult for the patient to mount an immune response against the TPECs themselves. Even in instances where the plurality of T-cell epitopes are the same, affixing them separately to the targeting moiety through a chemical linker may also result in a random placement of the T-cell epitopes along the targeting moiety, likewise damping the patient's own immune response against the TPEC.
  • Such approaches may ensure that the patient does not develop an immune response against the TPEC composition sufficient to inactivate the TPEC composition upon subsequent administrations, meaning that no more than about 0%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the composition is inactivated by the patient's own antibodies to the TPEC.
  • Immunogenicity of a composition may be measured in an ELISA assay using human serum.
  • test compositions may be immobilized on a 96-well plate, blocked and diluted serum samples incubated for 1 hour.
  • Antibodies against the test composition present in the human sera may bind to the test compositions on the plate.
  • Biotinylated test agent or a biotinylated secondary antibody such as an anti-human IgG/IgA/IgM in combination with streptavidin-HRP and TMB could be used to generate a signal.
  • compositions are expected to be at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% less immunogenic than prior compositions.
  • Peptides comprising T-cell epitopes and cleavage sites were ordered from external companies who synthesized them in standard solid phase peptide synthesis.
  • the peptides were dissolved in DMSO to a final concentration of 10 mg/ml to be used for conjugation.
  • polytope peptide comprising a plurality of T-cell epitopes and cleavage sites
  • antibody serving as a targeting moiety by using sulfo-SMCC.
  • the following procedure was used as a standard-operating protocol for separately conjugating a plurality of T-cell epitopes and their corresponding cleavage sites to an antibody serving as a targeting moiety by using sulfo-SMCC.
  • the following procedure was used as a standard-operating protocol for separately conjugating a plurality of T-cell epitopes and their corresponding cleavage sites to an antibody serving as a targeting moiety by using 3-MPA.
  • TPEC Compositions Comprising Two Cytomegalovirus Peptides and Evaluation in B-Lymphoblastoid Cells
  • B-lymphoblastoid cells B-LCL
  • an agent comprising Rituximab conjugated to two different cytomegalovirus peptides NLVPMVATV (SEQ ID NO: 1) and RPHERNGFTVL (SEQ ID NO: 2) each with a cleavage site for cathepsin B.
  • NLVPMVATV SEQ ID NO: 1
  • RPHERNGFTVL SEQ ID NO: 2
  • Rituximab was conjugated with the peptides NLVPMVATVASGV ⁇ CIT ⁇ GC (SEQ ID NO: 3) and RPHERNGFTVLASGFKGC (SEQ ID NO: 4) at the following ratios from Table 3, wherein CIT represents citrulline, a type of amino acid that is similar to arginine
  • TPEC #11 was recognized strongly as seen by a large production of IFN- ⁇ whereas TPEC #1 is not recognized at all as there was no production of IFN- ⁇ . See FIG. 3A .
  • RPH-specific T cells TPEC #1 was recognized strongly as seen by a large production of IFN- ⁇ whereas TPEC #11 is not recognized at all as there was no production of IFN- ⁇ . See FIG. 3B .
  • IFN- ⁇ There is production of IFN- ⁇ by both NLV- and RPH-specific T cells towards TPEC #2-10, demonstrating the notion that conjugating more than one peptide to the antibody can allow one to engage with more than one specificity of peptide-specific T cell.
  • TPEC Compositions Comprising Three Cytomegalovirus Peptides and Evaluation in B-Lymphoblastoid Cells
  • B-lymphoblastoid cells B-LCL
  • an agent comprising Rituximab conjugated to three different cytomegalovirus peptides VLEETSVML (SEQ ID NO: 5), BRVLBBYVL (SEQ ID NO: 6) and YILEETSVM (SEQ ID NO: 7) each with a cleavage site for cathepsin B.
  • Subsequent exposure to peptide-specific T cells resulted in the generation of a T cell response to the B-LCL.
  • Rituximab was conjugated with VLEETSVMLASGFKGC (SEQ ID NO: 8), BRVLBBYVLASGFKGC (SEQ ID NO: 9) where B is amino butyric acid, a homolog for cysteine, and YILEETSVMASGFKGC (SEQ ID NO: 10) at equal amounts of peptide.
  • B-LCL cells were labeled with Rituximab TPEC and after incubation, washed to remove excess TPEC. Labeled target cells were incubated overnight at 37° C. in the presence of VLE-specific, CRV-specific or YIL-specific T cells. Supernatant from the cultures was used to assess the presence of IFN- ⁇ .
  • Results are shown in FIG. 4 . There was IFN- ⁇ released by all of the different peptide-specific T cells in response to the TPEC-labeled target cells suggesting that each of the three conjugated peptides could be released from the antibody and used to stimulate peptide-specific T cells.
  • TPEC Compositions Comprising a Single Peptide Having Two Different Cytomegalovirus Peptides and Evaluation in B-Lymphoblastoid Cells
  • B-lymphoblastoid cells B-LCL
  • an agent comprising Rituximab conjugated to a single peptide which comprised two different cytomegalovirus peptides: (i) NLVPMVATV (SEQ ID NO: 1) and RPHERNGFTVL (SEQ ID NO: 2) or (ii) NLVPMVATV (SEQ ID NO: 1) and VLEETSVML (SEQ ID NO: 5) each separated from the other by a cleavage site for cathepsin B. Subsequent exposure to NLV peptide-specific T cells resulted in the generation of a T cell response to the B-LCL.
  • Rituximab was conjugated with the peptides (i) CGVANLVPMVATVAVAVLEETSVML (SEQ ID NO: 11), (ii) CVARPHERNGFTVLVANLVPMVATV (SEQ ID NO: 12) and (iii) CGVANLVPMVATVARPHERNGFTVL (SEQ ID NO: 13).
  • Target cells were labeled with TPEC and washed after incubation to remove excess TPEC.
  • Target cells were cultured overnight at 37° C. in the presence of NLV-specific T cells and the supernatant assayed for the presence of IFN- ⁇ the following day.
  • NLV-specific T cells were able to recognize target cells labeled with each of the three TPECs tested as determined by IFN- ⁇ release. This demonstrates the ability of a peptide containing more than one cytomegalovirus derived peptide, separated by a protease cleavage site, to stimulate peptide-specific T cells. Furthermore, the position of the NLVPMVATV (SEQ ID NO: 1) peptide in the polytope appears to affect the magnitude of the response with the NLV peptide being furthest from the antibody CVARPHERNGFTVLVANLVPMVATV (SEQ ID NO: 12) producing the largest response.
  • both polytope peptides containing the NLV peptide closest to the antibody CGVANLVPMVATVAVAVLEETSVML (SEQ ID NO: 11) and CGVANLVPMVATVARPHERNGFTVL (SEQ ID NO: 13) also demonstrate a T cell response above background.
  • Results are shown in FIG. 5 .
  • a TPEC comprising polytope branched peptide was prepared.
  • a stem peptide that contains four azidonorleucine residues was provided along with peptides (branches) that contain propargyl glycine at the amino terminus ( FIG. 6A ).
  • Each branched peptide has a NH 2 cap on the C-terminal end which can aid in peptide serum stability.
  • the sequence of the stem peptide was SEEZSEEZSEEZSEEZ, wherein Z is Azidonorleucine (SEQ ID NO: 168).
  • the sequences of the branched peptides were BKPAKFFRLTPRVTGGGAM-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 169), BKPAKFFRLRPHERNGFTVL-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 170), BKPAKFFRLRELRRI M-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 171), and BKPAKFFRLNLVPMVATV-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 172).
  • the sequences of the branched peptides were BAIPVSLRTPRVTGGGAM-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 173), BAIPVSLRRPHERNGFTVL-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 174), BAIPVSLRELRRI M-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 175), and BAIPVSLVTEHDTLLY-nh 2 , wherein B is propargyl glycine (SEQ ID NO: 176).
  • the branched peptide was conjugated to either Rituximab or Cetuximab by firstly reducing the antibody in the presence of approximately 0.1 mM (tris(2-carboxyethyl)phosphine (TCEP) for 90 minutes. The branched peptide is then added at 3 ⁇ the concentration as TCEP for 60 minutes and N-acetyl cysteine is added to quench the free peptide using the same concentration as the branched peptide for 30 minutes. The free peptide is removed using protein A sepahrose beads to bind the TPEC whilst the free peptide is washed off. The TPEC is then collected from the protein A beads by eluting using 0.1M glycine and buffered using 1 m Tris pH8.
  • TCEP tris(2-carboxyethyl)phosphine
  • Two agents comprised of Rituximab conjugated with a branched peptide consisting of four different viral epitopes, each linked to a single stem peptide.
  • Branched TPEC 1 each of the four peptides was separated from the stem peptide by an ADAM28 protease cleavage sequence.
  • Branched TPEC 3 each of the four peptides was separated from the stem peptide by an MMP2 cleavage sequence.
  • the target cells were labelled with the Rituximab-TPEC before being incubated with CD8 T cells specific for one of two different viral epitopes.
  • TPR T cells were specific for the viral epitope TPRVTGGGAM (SEQ ID NO: 49) and this epitope was present in branches 1-1 and 3-1.
  • RPH T cells were specific for the viral epitope RPHERNGFTVL (SEQ ID NO: 2) and this epitope was present in branches 1-2 and 3-2.
  • Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides, especially using the Branch 1 TPEC. Untreated target cells were not recognized by the peptide-specific T cells (negative control) whereas free peptide pulsed target cells were strongly recognized by T cells (positive control).
  • Branched TPEC 1 Two agents comprised of Cetuximab conjugated with a branched peptide consisting of four different viral epitopes, all linked to a single stem peptide was provided.
  • Branched TPEC 1 each of the four peptides was separated from the stem peptide by an ADAM28 protease cleavage sequence.
  • Branched TPEC 3 each of the four peptides was separated from the stem peptide by an MMP2 cleavage sequence.
  • the target cells were labelled with the Cetuximab-TPEC before being incubated with CD8 T cells specific for one of two different viral epitopes.
  • TPR T cells were specific for the viral epitope TPRVTGGGAM (SEQ ID NO: 49) and this epitope was present in branches 1-1 and 3-1.
  • RPH T cells were specific for the viral epitope RPHERNGFTVL (SEQ ID NO: 2) and this epitope was present in branches 1-2 and 3-2.
  • Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides, especially using the Branch 1 TPEC. Untreated target cells were not recognized by the peptide-specific T cells (negative control) whereas free peptide pulsed target cells were strongly recognized by T cells (positive control).
  • DNA for an agent comprising Cetuximab containing an additional fibronectin type 3 domain (from fibronectin 1 protein) attached to each heavy chain (depicted in FIG. 2B ) was synthesized ( FIG. 9A ).
  • the fibronectin type 3 domain was mutated at the “BC”, “DE” and “FG” loops to contain the viral epitopes TPRVTGGGAM (SEQ ID NO: 49), NLVPMVATV (SEQ ID NO: 1), and VLEETSVML (SEQ ID NO: 5).
  • the viral epitopes were separated from the fibronectin type 3 domain by MMP2 protease cleavage sequences on both sides of the CMV epitope as depicted:
  • the DNA for the bundled domain TPEC was transfected into Expi293 cells and the supernatant harvested 10 days post transfection.
  • the bundled domain TPEC was purified from the supernatant using protein A sepharose beads.
  • the target cells, ovarian carcinoma cell line, were labelled with the purified Cetuximab-TPEC with excess, unbound TPEC washed off. The labelled target cells were then incubated overnight in the presence of NLV-specific T cells.
  • malignant cells ovarian carcinoma cell line
  • viral epitopes were released from the additional protein domain by proteolytic cleavage.
  • the released peptides were presented on MHC class I molecules on the malignant cells where they could be recognized by the CD8+ T cells.
  • Recognition of malignant cells by the CD8+ T cells was measured by release of IFN- ⁇ by the T cells.
  • Target ovarian carcinoma cells labeled with bundled domain TPEC were recognized by T cells specific for the NLVPMVATV (SEQ ID NO: 1) peptide from four different bundled domain TPEC preparations. Untreated target cells were not recognized by the peptide-specific T cells (negative control) whereas free peptide pulsed target cells were strongly recognized by T cells (positive control).
  • Example 13 In Vivo Targeting of B Cell Lymphoma Using the Separately Conjugated T-Cell Epitopes (i.e., “Hairbrush”) (e.g., Chronic Lymphocytic Leukaemia)
  • Hairbrush e.g., Chronic Lymphocytic Leukaemia
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide mixture containing equal parts of five different cytomegalovirus-derived peptides each containing a protease cleavage site specific for cathepsin B (i) NLVPMVATVASGV ⁇ CIT ⁇ GC (SEQ ID NO: 3), (ii) VLEETSVMLASGFKGC (SEQ ID NO: 8), (iii) RPHERNGFTVLASGFKGC (SEQ ID NO: 4), (iv) YILEETSVMASGFKGC (SEQ ID NO: 10) and (v) BRVLBBYVLASGFKGC (SEQ ID NO: 9).
  • the patient is infused with the agent, which targets all B cells, healthy and malignant.
  • the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) VLEETSVML (SEQ ID NO: 5), (iii) RPHERNGFTVL (SEQ ID NO: 2), (iv) YILEETSVM (SEQ ID NO: 7) and (v) BRVLBBYVL (SEQ ID NO: 6), which subsequently bind to HLA molecules on the surface of the malignant B cell.
  • the malignant B cells expressing the T-cell epitopes are targeted by the host immune system for cytolysis by T cells.
  • Example 14 In Vivo Targeting of B-Cell Lymphoma Using a TPEC Comprising Polytope (e.g., Chronic Lymphocytic Leukaemia)
  • a TPEC Comprising Polytope e.g., Chronic Lymphocytic Leukaemia
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide containing four different cytomegalovirus-derived epitopes (i) CGSFRVTEHDTLLYGSFRRPHERNGFTVLGSFRELKRKMIYMGSFRN LVPMVATV (SEQ ID NO: 14). Each of the four epitopes is separated from the next one by a protease cleavage site specific for cathepsin B in the conformation targeting agent—C-E 1 -C-E 2 -C-E 3 -C-E 4 where C is protease cleavage and E is epitope.
  • the patient is infused with the agent, which targets all B cells, healthy and malignant.
  • T-cell epitopes Upon binding malignant cells, the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) VTEHDTLLY (SEQ ID NO: 53), (iii) RPHERNGFTVL (SEQ ID NO: 2), and (iv) ELKRKMIYM (SEQ ID NO: 23), which subsequently bind to HLA molecules on the surface of the malignant B cell. The cells expressing the T-cell epitopes are then targeted by the host immune system for cytolysis by T cells.
  • proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) VTEHDTLLY (SEQ ID NO: 53), (iii) RPHERNGFTVL (SEQ ID NO: 2), and (iv) ELKRK
  • Example 15 In Vivo Targeting of B Cell Lymphoma Using the Separately Conjugated T-Cell Epitopes (I.E., “Hairbrush”) (e.g., Chronic Lymphocytic Leukaemia)
  • Hairbrush e.g., Chronic Lymphocytic Leukaemia
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide mixture containing equal parts of five different cytomegalovirus-derived peptides each containing a protease cleavage site specific for either ADAM28 or cathepsin D (i) CKPAKFFRLNLVPMVATV (SEQ ID NO: 58), (ii) CKPAKFFRLRPHERNGFTVL (SEQ ID NO: 59), (iii) CPRSFFRLGKVLEETSVML (SEQ ID NO: 60), (iv) CKPAKFFRLELKRKMIYM (SEQ ID NO: 61) and (v) CPRSFFRLGKQIKVRVDMV (SEQ ID NO: 62).
  • the patient is infused with the agent, which targets all B cells, healthy and malignant.
  • the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) RPHERNGFTVL (SEQ ID NO: 2), (iii) VLEETSVML (SEQ ID NO: 5), (iv) ELKRKMIYM (SEQ ID NO: 23) and (v) QIKVRVDMV (SEQ ID NO: 38), which subsequently bind to HLA molecules on the surface of the malignant B cell.
  • the malignant B cells expressing the T-cell epitopes on their HLA molecules at the cell surface are targeted by the host immune system for cytolysis by T cells.
  • Example 16 In Vivo Targeting of B-Cell Lymphoma Using a TPEC Comprising Polytope (e.g., Chronic Lymphocytic Leukaemia)
  • a TPEC Comprising Polytope e.g., Chronic Lymphocytic Leukaemia
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide containing four different cytomegalovirus-derived epitopes (i) CGSKPAKFFRLYSEHPTFTSQYGSPRSFFRLGKTPRVTGGGAMG SKPAKFFRLQIKVRVDMVGSPRSFFRLGKELRRKMMYM (SEQ ID NO: 63).
  • Each of the four epitopes is separated from the next one by a protease cleavage site specific for either ADAM28 or cathepsin D in a potential conformation, but not limited to the conformation, Targeting agent—C i -E 1 -C ii -E 2 -C i E 3 C ii -E 4 where C is protease cleavage and E is epitope.
  • the patient is infused with the agent, which targets all B cells, healthy and malignant.
  • T-cell epitopes Upon binding malignant cells, the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) YSEHPTFTSQY (SEQ ID NO: 55), (ii) TPRVTGGGAM (SEQ ID NO: 49), (iii) QIKVRVDMV (SEQ ID NO: 38), and (iv) ELRRKMMYM (SEQ ID NO: 24), which subsequently bind to HLA molecules on the surface of the malignant B cell.
  • the cells expressing the T-cell epitopes are then targeted by the host immune system for cytolysis by T cells.
  • Item 1 A composition for retargeting an immune response to unwanted cells comprising a TPEC wherein:
  • Item 2 A composition for retargeting an immune response to unwanted cells comprising a TPEC comprising the formula T-(L-C-E) n or T-(L-C i -E i ) n , wherein:
  • Item 3 A composition for retargeting an immune response to unwanted cells comprising a TPEC comprising the formula T-L-(C i -E i ) n , wherein:
  • Item 4 A composition for retargeting an immune response to unwanted cells comprising a TPEC having:
  • a targeting moiety that is capable of targeting unwanted cells
  • Item 5 The composition of any one of items 1, 2, or 4, wherein the plurality of T-cell epitopes are individually conjugated to the targeting moiety, each T-cell epitope by a cleavage site.
  • Item 6 The composition of any one of items 1, 3, or 4, wherein the plurality of T-cell epitopes are conjugated as at least one bundle to the targeting moiety by one cleavage site.
  • Item 7 The composition of item 6, wherein the T-cell epitopes within a bundle have cleavage sites between them.
  • Item 8 The composition of any one of items 1, 3-4, 6-7, wherein at least two groups of a plurality of T-cell epitopes are conjugated to the targeting moiety, each group by one cleavage site.
  • Item 9 The composition of any one of items 1-8, wherein the plurality of T-cell epitopes are not all identical.
  • Item 10 The composition of any one of items 1-8, wherein the plurality of T-cell epitopes are the same.
  • Item 11 The composition of any one of items 1-8, wherein some the T-cell epitopes are the same and further wherein some are different.
  • Item 12 The composition of any one of items 1-11, wherein the agent has a plurality of cleavage sites that are the same.
  • Item 13 The composition of any one of items 1-11, wherein the agent has a plurality of cleavage sites that are not all identical.
  • Item 14 The composition of any one of items 1, 3-4, and 6-13, wherein the at least one cleavage site and the plurality of T-cell epitopes are conjugated to the targeting agent using at least one peptide bond.
  • Item 15 The composition of any one of items 1-13, wherein the at least one cleavage site and the plurality of T-cell epitopes are conjugated to the targeting agent through at least one bond other than a peptide bond.
  • Item 16 The composition of item 15, wherein the at least one cleavage site and the plurality of T-cell epitopes are conjugated to the targeting agent through a Sulfo-SMCC, SMCC, or maleimide linkage.
  • Item 17 The composition of any one of items 1-16 wherein at least one T-cell epitope is an MHC Class I restricted peptide.
  • Item 18 The composition of any one of items 1-17, wherein at least one T-cell epitope is an MHC Class II restricted peptide.
  • Item 19 The composition of any one of items 1-18, wherein the plurality of T-cell epitopes are from about 7 to about 14 amino acids in length.
  • Item 20 The composition of any one of items 1-19, wherein the plurality of T cell epitopes are about 8 to 13, about 9 to 12, about 9, or about 10 amino acids in length.
  • Item 21 The composition of any one of items 1-20, wherein the agent comprises about or at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 T cell epitopes, optionally from 2 to 100 T cell epitopes.
  • Item 22 The composition of any one of items 1-21, wherein the T-cell epitopes are chosen from CMV, influenza, EBV, hepatitis, chicken pox, mumps, measles, diphtheria, Haemophilus influenzae , rubella, pertussis, polio, pneumococcus, rotavirus, tetanus, vaccinia, and yellow fever T-cell epitopes.
  • the T-cell epitopes are chosen from CMV, influenza, EBV, hepatitis, chicken pox, mumps, measles, diphtheria, Haemophilus influenzae , rubella, pertussis, polio, pneumococcus, rotavirus, tetanus, vaccinia, and yellow fever T-cell epitopes.
  • Item 23 The composition of any one of items 1-22, wherein the composition comprises T-cell epitopes from at least two different infectious agents.
  • Item 24 The composition of any one of items 1-23, wherein the TPEC comprises at least one CMV T-cell epitope.
  • Item 25 The composition of any one of items 1-9 and 11-24, wherein using a plurality of different T-cell epitopes allows the agent to stimulate a T-cell response in at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the human population.
  • Item 26 The composition of any one of items 1-25, wherein the T-cell epitopes are chosen from HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, CD1d, and MR1.
  • Item 27 The composition of any one of items 1-26, wherein the T-cell epitopes are chosen from HLA-A*01, HLA-A*02, HLA-A*03, HLA-A*11, HLA-B*44, HLA-B*07, HLA-B*08, HLA-B*15, HLA-B*35, HLA-B*40, HLA-C*07, HLA-C*03, HLA-C*05, HLA-C*04, HLA-C*06, and HLA-E*0101 restricted antigens.
  • Item 28 The composition of any one of items 1-9 and 11-27, wherein the composition comprises at least the following T-cell epitopes: HLA-A*02, HLA-A*01, and HLA-A*03.
  • Item 29 The composition of any one of items 1-28, wherein having multiple copies of the same T-cell epitope increases an immune response against the unwanted cell when the agent is administered to a subject.
  • Item 30 The composition of any one of items 1-29, wherein the T-cell epitopes comprise at least one of SEQ ID NOS: 1-2, 5-7, 15-57.
  • Item 31 The composition of any one of items 1-30, wherein the targeting moiety targets the unwanted cells by specifically binding to the unwanted cells.
  • Item 32 The composition of any one of items 1-32, wherein the targeting moiety specifically binds the unwanted cells even while the plurality of T-cell epitopes are conjugated to the targeting moiety.
  • Item 33 The composition of any one of items 1-32, wherein the targeting moiety is an antibody or functional part thereof.
  • Item 34 The composition of any one of items 1-33, wherein the T-cell epitopes are flanked on one or both ends by at least one human protein domain.
  • Item 35 The composition of items 34, wherein at least one human protein domain is a beta barrel or a coiled coil.
  • Item 36 The composition of any one of items 34-35, wherein the human protein domain is a CL, CH2, and/or CH3 domain.
  • Item 37 The composition of any one of items 34-35, wherein the human protein domain is a FN3 domain, beta-sandwich, Lipocalin, EETI-II/AGRP, Kunitz domain (BPTI), Thioredoxin, Protein A, Ankyrin, gamma-B-crystallin/ubiquitin, CTLD3/Tetranexin LDLR-A, human serum albumin, immunoglobulin CH2 domain, or camelid VHH domain
  • the human protein domain is a FN3 domain, beta-sandwich, Lipocalin, EETI-II/AGRP, Kunitz domain (BPTI), Thioredoxin, Protein A, Ankyrin, gamma-B-crystallin/ubiquitin, CTLD3/Tetranexin LDLR-A, human serum albumin, immunoglobulin CH2 domain, or camelid VHH domain
  • Item 38 The composition of any one of item 34-35 or 37, wherein the human protein domain is not a human immunoglobulin protein domain.
  • Item 39 The composition of any one of items 34-38, wherein the human protein domain displays the T-cell epitopes on its three-dimensional surface.
  • Item 40 The composition of any one of items 1-39, wherein the cleavage site is capable of being cleaved outside the unwanted cells.
  • Item 41 The composition of any one of items 1-40, wherein the enzyme expressed by the unwanted cells is a protease.
  • Item 42 The composition of any one of items 1-41, wherein the unwanted cells are cancer cells.
  • Item 43 A composition comprising a plurality of different TPECs of any one of items 1-42, wherein each targeting agent is conjugated to a plurality of identical T-cell epitopes.
  • Item 44 A composition comprising a plurality of compositions of any one of items 1-42, wherein at least some of the targeting agents in the composition are conjugated to a plurality of T-cell epitopes that are not identical.
  • Item 45 A composition comprising a plurality of compositions of item 44, wherein at least some of the compositions are not identical.
  • Item 46 A composition comprising a plurality of compositions of any one of items 43-45, wherein the composition comprises at least about 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or more different TPECs.
  • Item 47 A pharmaceutical composition comprising a composition of any one of items 1-46 and a pharmaceutically acceptable carrier.
  • Item 48 A method of treating a disease in a patient characterized by the presence of unwanted cells comprising administering a composition of any one of items 1-47 to the patient.
  • Item 49 A method of retargeting an immune response of a patient to unwanted cells comprising administering a composition of any one of items 1-47 to the patient.
  • Item 50 The method of any of items 48-49, wherein the patient does not develop an immune response against the composition sufficient to inactivate the composition.
  • Item 51 The method of any one of items 48-50, wherein the patient receives multiple doses of the composition over at least 30, 45, 60, 75, 90, 120, 150, or more days or on an ongoing basis.
  • Item 52 The method of any one of items 48-50, wherein the patient receives multiple doses of the composition over at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or on an ongoing basis.
  • Item 53 The method of any one of items 48-52, wherein the composition can be administered to a patient in relapse who received the composition for an earlier round of therapy.
  • Item 54 The method of any one of items 48-53, wherein the patient has cancer.
  • the term about refers to a numeric value, including, for example, whole numbers, fractions, and percentages, whether or not explicitly indicated.
  • the term about generally refers to a range of numerical values (e.g., +/ ⁇ 5-10% of the recited range) that one of ordinary skill in the art would consider equivalent to the recited value (e.g., having the same function or result).
  • the terms modify all of the values or ranges provided in the list.
  • the term about may include numerical values that are rounded to the nearest significant figure.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Virology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Inorganic Chemistry (AREA)
  • Oncology (AREA)
  • Hematology (AREA)
  • Communicable Diseases (AREA)
  • Biotechnology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)

Abstract

A variety of targeting moiety peptide epitope complexes (TPECs) are described in different embodiments. In each of the embodiments, however, a targeting moiety may be used to deliver the TPEC to an area of unwanted cells, allowing for a therapeutic effect to be delivered locally. The TPEC also contains a plurality of T-cell epitopes. The TPEC further comprises cleavage sites that release the T-cell epitopes from the targeting agent, and in some embodiments from each other, when they are in the microenvironment of the unwanted cells. Although the arrangement and number of T-cell epitopes varies in different embodiments described herein, once cleaved from the targeting agent (and any neighboring T-cell epitopes), the T-cell epitopes function by stimulating an immune response against the unwanted cells.

Description

    CROSS-REFERENCE TO RELATED APPLICATIONS
  • This application is a divisional of U.S. application Ser. No. 15/012,115, filed Feb. 1, 2016, which claims the benefit of priority of U.S. Provisional Application No. 62/111,069, filed Feb. 2, 2015.
  • SEQUENCE LISTING
  • The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Apr. 15, 2016, is named 20160415_01131-0005-00US_SeqProject_ST25.txt and is 40,509 bytes in size.
  • DESCRIPTION Field
  • This application relates to immunotherapeutic agents employing a plurality of T-cell epitopes. In particular, it relates to agents that can be used to treat a condition characterized by the presence of unwanted cells, such as cancer or other disease-causing cells.
  • Background
  • Cancer and other diseases caused by the presence of unwanted cells create significant loss of life, suffering, and economic impact. Immunotherapeutic strategies for targeting cancer have been an active area of translational clinical research.
  • WO 2012/123755 discusses the concept of re-directed immunotherapy. In this application, an agent for preventing or treating a condition characterized by the presence of unwanted cells includes a targeting moiety that is capable of targeting to the unwanted cells and a T-cell epitope that can be released from the targeting moiety by selective cleavage of a cleavage site in the agent in the vicinity of the unwanted cells.
  • WO 2014/043523 teaches an agent based on an ScFV directed to cancer cells including from 1-10 immunogenic CD8 T-cell epitopes in one of the following two arrangements: T-c-En-c-Fcn or T-c-Fcn-c-En, where T is the ScFv, En is from 1-10 CD8 T-cell epitopes, c: is a protease cleavage site, and Fcn is from 1-10 Fc portions of an IgG antibody. In this reference, the 1-10 immunogenic CD8 T-cells are released from the ScFv and Fc portions of the agent in a single polypeptide chain, still conjugated to each other.
  • While some positive test data has been shown with prior approaches, clinically-effective therapeutic strategies must be able to elicit a strong immune response in an individual suffering from a disease such as cancer. Additionally, effective therapies should work well in a wide cross-section of patients from different racial and ethnic groups Maximally-effective therapies would also generate an immune response against the unwanted cells without generating an inhibitory immune response against the therapeutic agent itself so that multiple rounds of treatment could be administered over a period of time. Therefore, additional developments in this field of re-directed immunotherapy are required.
  • SUMMARY
  • In accordance with the description, a variety of targeting moiety peptide epitope complexes (TPECs) are described in different embodiment of this application. In each of the embodiments, however, a targeting moiety may be used to deliver the TPEC to an area of unwanted cells, allowing for a therapeutic effect to be delivered locally. The TPEC also contains a plurality of T-cell epitopes. The TPEC further comprises cleavage sites that release the T-cell epitopes from the targeting agent, and in some embodiments from each other, when they are in the microenvironment of the unwanted cells. Although the arrangement and number of T-cell epitopes varies in different embodiments described herein, once cleaved from the targeting agent (and any neighboring T-cell epitopes), the T-cell epitopes function by stimulating an immune response against the unwanted cells. In some embodiments, maximal benefits may be achieved by releasing all of the T-cell epitopes from both the targeting agent and from each other in the cleavage process, allowing each T-cell epitope the structural freedom to attract an immune response to the unwanted cell.
  • Having a plurality of T-cell epitopes, as discussed in detail below, enhances the immune response against the unwanted cells, either by stimulating a stronger immune response in a given patient or by allowing the TPEC to stimulate an immune response across a wide variety of patients in different ethnic and racial groups.
  • In one embodiment, a composition for retargeting an immune response to unwanted cells comprises a TPEC wherein:
  • a. T is a targeting moiety that is capable of targeting unwanted cells;
  • b. L is at least one linker capable of chemical linkage to T where L may be a peptide bond, at least one peptide, or a chemical linker;
  • c. C is at least one cleavage site
      • i. cleaved by an enzyme expressed by the unwanted cells;
      • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
      • iii. cleaved by a complement-dependent cleavage reaction; or
      • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • d. E is at least one T-cell epitope, wherein the L, C, and E moieties are arranged in at least one of the following patterns:
      • i. a plurality of L-C-E, each attached separately to T,
      • ii. at least one of L-(C-E)n, with each C-E attached to the L in parallel, and/or
      • iii. at least one of L-(C-E)n, with each C-E attached to the L in series.
  • In one embodiment, a composition for retargeting an immune response to unwanted cells comprises a TPEC having a plurality of T-cell epitopes separately conjugated to a targeting moiety comprising the formula T-(L-C-E)n or T-(L-Ci-Ej)n, wherein:
  • a. T is a targeting moiety that is capable of targeting unwanted cells;
  • b. L is a linker capable of chemical linkage to T;
  • c. C is a cleavage site
      • i. cleaved by an enzyme expressed by the unwanted cells;
      • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
      • iii. cleaved by a complement-dependent cleavage reaction; or
      • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • b. E is a T-cell epitope
  • wherein n is an integer of at least 2 (optionally from about 2 to 50), i is an integer of at least 2 (optionally from about 1 to 50), and j is an integer of at least 2 (optionally from about 1 to 50). The “n” integer refers to the number of L-C-E moieties on the targeting moiety and the “i” and “j” integers refer to how many different types of cleavage sites and epitopes are within the construct.
  • In some embodiments, a composition for retargeting an immune response to unwanted cells comprises a TPEC with either a (i) linear and/or bundled polytope or a (ii) branched polytope. Such a TPEC may comprise the formula T-L-(Ci-Ej)n, wherein:
  • a. T is a targeting moiety that is capable of targeting unwanted cells;
  • b. L is an optional linker capable of chemical or peptide linkage to T;
  • c. C is a cleavage site
      • i. cleaved by an enzyme expressed by the unwanted cells;
      • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
      • iii. cleaved by a complement-dependent cleavage reaction; or
      • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • d. E is a T-cell epitope;
  • wherein n is an integer of at least 2 (optionally from about 2 to 50), i is an integer of at least 2 (optionally from about 1 to 50), and j is an integer of at least 2 (optionally from about 1 to 50). The “n” integer refers to the number of C-E moieties on the targeting moiety and the “i” and “j” integers refer to how many different types of cleavage sites and epitopes are within the construct.
  • Further, in some embodiments, a composition for retargeting an immune response to unwanted cells comprises a TPEC having:
  • a. a targeting moiety that is capable of targeting unwanted cells;
  • b. a plurality of more than 10 T-cell epitopes conjugated to the targeting moiety with at least one cleavage site, wherein the cleavage site is
      • i. cleaved by an enzyme expressed by the unwanted cells;
      • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
      • iii. cleaved by a complement-dependent cleavage reaction; or
      • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC.
  • Additional objects and advantages will be set forth in part in the description which follows, and in part will be obvious from the description, or may be learned by practice. The objects and advantages will be realized and attained by means of the elements and combinations particularly pointed out in the appended claims.
  • It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are not restrictive of the claims.
  • The accompanying drawings, which are incorporated in and constitute a part of this specification, illustrate one (several) embodiment(s) and together with the description, serve to explain the principles described herein.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIGS. 1A-B show certain embodiments of TPECs. In FIG. 1A, a targeting moiety, optionally an antibody, has a plurality of copies of the same T-cell epitope affixed to it using a chemical linker and a cleavage site. In FIG. 1B, a targeting moiety, optionally an antibody, has a plurality of different T-cell epitopes affixed to it using a chemical linker and a cleavage site. The linker-cleavage site-T-cell-epitopes may be affixed to the targeting moiety in random locations and in random amounts, creating a heterogeneous population of TPECs. In these embodiments, the TPEC comprises a plurality of L-C-E, each attached separately to T, where L is linker, C is cleavage site, E is epitope, and T is targeting moiety.
  • FIGS. 2A-C show certain embodiments of TPECs. In FIG. 2A, a targeting moiety, optionally an antibody, has a plurality of different T-cell epitopes affixed to it using a chemical or peptide linker, wherein the plurality of T-cell epitopes is separated by cleavage sites and affixed to the targeting moiety in a bundle. FIG. 2B shows the bundle of T-cell epitopes having immunoglobulin framework regions flanking certain domains. Both FIGS. 2A and 2B include polytopes with a linear configuration. In the embodiments of FIGS. 2A and 2B, the TPEC comprises at least one of L-(C-E)n, with each C-E attached to the L in series (in a bundled and/or linear configuration), and wherein n is an integer of at least 2 (optionally from about 2 to 50) and where L is linker, C is cleavage site, E is epitope, and T is targeting moiety. FIG. 2C shows one embodiment of a TPEC comprising a polytope with a branched configuration. In another embodiment, not shown, the polytope with a branched configuration may have identical T-cell epitopes. In the embodiments of FIG. 2C, the TPEC comprises at least one of L-(C-E)n, with each C-E attached to the L in parallel (in a branched configuration), and wherein n is an integer of at least 2 (optionally from about 2 to 50) and where L is linker, C is cleavage site, E is epitope, and T is targeting moiety.
  • FIGS. 3A-C show in vitro activity of re-directed virus specific T cells (Multiple Peptide TPEC approach). Recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of two different viral peptides, RPHERNGFTVL (SEQ ID NO: 2) and NLVPMVATV (SEQ ID NO: 1), to the anti-CD20 antibody Rituximab. Antibody is conjugated using sulfo-SMCC to peptides NLVPMVATVASGV{CIT}GC (SEQ ID NO: 3) and RPHERNGFTVLASGFKGC (SEQ ID NO: 4) at different ratios from 100% NLV:0% RPH through to 0% NLV:100% RPH. Target lymphoma cells labeled with TPEC are recognized by lymphocytes specific towards the NLV peptide (A) at all ratios down to 10% of the conjugated peptide being NLVPMVATVASGV{CIT}GC (SEQ ID NO: 3). Similarly, target lymphoma cells are recognized by lymphocytes specific towards the RPH peptide (B) at all ratios down to 10% of the conjugated peptide being the RPHERNGFTVLASGFKGC (SEQ ID NO: 4). In both (A) and (B), there is no T cell recognition by peptide-specific T cells when the ratio of the conjugated peptide recognized by the T cells is 0%. (C) Overlaid plots of (A) and (B) demonstrating activity of both NLV and RPH specific T cells using Rituximab TPECs conjugated with the two different peptides.
  • FIG. 4 illustrates recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of three different viral peptides, VLEETSVML (SEQ ID NO: 5), CRVLCCYVL (SEQ ID NO: 17) and YILEETSVM (SEQ ID NO: 7), to the anti-CD20 antibody Rituximab. Antibody is conjugated using sulfo-SMCC to equal amount of peptides VLEETSVMLASGFKGC (SEQ ID NO: 8), BRVLBBYVLASGFKGC (SEQ ID NO: 9) where B is amino butyric acid, a homolog for cysteine and YILEETSVMASGFKGC (SEQ ID NO: 10). Target lymphoma cells labeled with the TPEC are recognized by T cells specific for each of the three peptides conjugated to the antibody. Untreated target cells are not recognized by any of the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIG. 5 demonstrates recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of polytope peptides. Antibody is conjugated using sulfo-SMCC to peptides
  • (i) CGVANLVPMVATVAVAVLEETSVML (SEQ ID NO: 11), (ii) CVARPHERNGFTVLVANLVPMVATV (SEQ ID NO: 12) and
  • (iii) CGVANLVPMVATVARPHERNGFTVL (SEQ ID NO: 13). Target lymphoma cells labeled with TPEC are recognized by T cells specific for the NLVPMVATV (SEQ ID NO: 1) peptide. Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIGS. 6A-B demonstrate the protein conjugation chemistry of one embodiment of the branched peptide using a stem peptide that contains four azidonorleucine residues and peptides (branches) that contain propargyl glycine at the amino terminus (FIG. 6A). Incubation of equimolar concentrations of the branches with the stem peptide in DMSO in the presence of 10 mg in 4 ml of the CuSO45 H2O catalyst mixed with 10 mg in 4 ml ascorbic acid overnight resulted in the formation of the branched peptide used for conjugation. The final concentration of DMSO for the reaction was 50%. The branched peptides were purified using HPLC and verified using mass spectrometry (FIG. 6B). The peptides contain an N-terminal amide group (-nh2) which is useful in peptide stability compared with the usual carboxyl group (—COOH).
  • FIGS. 7A-B demonstrate recognition of a lymphoblastoid lymphoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of polytope peptides in the branched peptide format. Antibody is conjugated using the embodiment in FIG. 6B using the following peptides:
  • Stem:
    (SEQ ID NO: 168)
    SEEZSEEZSEEZSEEZ (Z: Azidonorleucine);
    For Branch 1 TPEC: branch 1-1:
    (SEQ ID NO: 169)
    BKPAKFFRLTPRVTGGGAM-nh2 (B: propargyl glycine);
    Branch 1-2:
    (SEQ ID NO: 170)
    BKPAKFFRLRPHERNGFTVL-nh2 (B: propargyl glycine);
    Branch 1-3:
    (SEQ ID NO: 171)
    BKPAKFFRLRELRRKMMYM-nh2 (B: propargyl glycine);
    and
    Branch 1-4:
    (SEQ ID NO: 172)
    BKPAKFFRLNLVPMVATV-nh2 (B: propargyl glycine);
    and
    For Branch 3 TPEC, branch 3-1:
    (SEQ ID NO: 173)
    BAIPVSLRTPRVTGGGAM-nh2 (B: propargyl glycine);
    Branch 3-2:
    (SEQ ID NO: 174)
    BAIPVSLRRPHERNGFTVL-nh2 (B: propargyl glycine);
    Branch 3-3:
    (SEQ ID NO: 175)
    BAIPVSLRELRRKMMYM-nh2 (B: propargyl glycine);
    and
    Branch 3-4:
    (SEQ ID NO: 176)
    BAIPVSLVTEHDTLLY-nh2 (B: propargyl glycine).
  • Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides. Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIGS. 8A-B demonstrate recognition of an ovarian carcinoma cell line by CD8+ cytomegalovirus-specific cytotoxic T lymphocytes through conjugation of polytope peptides in the branched peptide format. Antibody is conjugated using the embodiment in FIG. 6B using peptides
  • Stem:
    (SEQ ID NO: 168)
    SEEZSEEZSEEZSEEZ (Z: Azidonorleucine);
    For Branch 1 TPEC, branch 1-1:
    (SEQ ID NO: 169)
    BKPAKFFRLTPRVTGGGAM-nh2 (B: Propargyl glycine);
    Branch 1-2:
    (SEQ ID NO: 170)
    BKPAKFFRLRPHERNGFTVL-nh2 (B: Propargyl glycine);
    Branch 1-3:
    (SEQ ID NO: 171)
    BKPAKFFRLRELRRIM-nh2 (B: Propargyl glycine);
    Branch 1-4:
    (SEQ ID NO: 172)
    BKPAKFFRLNLVPMVATV-nh2 (B: Propargyl glycine);
    and
    For Branch 3 TPEC, branch 3-1:
    (SEQ ID NO: 173)
    BAIPVSLRTPRVTGGGAM-nh2 (B: Propargyl glycine);
    Branch 3-2:
    (SEQ ID NO: 174)
    BAIPVSLRRPHERNGFTVL-nh2 (B: Propargyl glycine);
    Branch 3-3:
    (SEQ ID NO: 175)
    BAIPVSLRELRRIM-nh2 (B: Propargyl glycine);
    and
    Branch 3-4:
    (SEQ ID NO: 176)
    BAIPVSLVTEHDTLLY-nh2 (B: Propargyl glycine).
  • Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides. Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • FIGS. 9A-C provide an embodiment of the bundled domain TPEC. FIG. 9A demonstrates the scaffold (Fibronectin type 3 domain from the fibronectin 1 protein) used for the bundled domain TPEC. The bundled domain sequence (FIG. 9A) demonstrates the mutations made in the outer loops of the domain and contains viral epitopes separated from the fibronectin sequence on both sides by a protease recognition sequence specific for MMP2. The protease cleavage sites are underlined and the viral epitope are shown in bold and italics. FIG. 9B demonstrates the structure of the bundled domain and the “BC”, “DE” and “FG” loops that contain the viral epitopes. FIG. 9C demonstrates recognition of an ovarian carcinoma cell line by CD8+ cytomegalovirus specific cytotoxic T lymphocytes. CMV epitopes are contained within an additional protein domain linked to the heavy chain of Cetuximab. The viral epitopes are flanked by an MMP2 protease recognition sequence which will allow release of the viral epitopes in the presence of MMP2, produced by the target cell line. The bundled domain TPEC is produced in Expi293 cells and purified using protein A sepharose beads.
  • Target ovarian carcinoma cells labelled with the bundled domain TPEC are recognized by T cells specific for the viral epitope NLVPMVATV (SEQ ID NO: 1) by release of IFN-γ. Four different preparations (two TPECs produced on each of two days using different concentrations of DNA) of the bundled domain were used, all of which produced similar amounts of bundled domain TPEC and produced similar recognition of target cells by the peptide-specific T cells. Untreated target cells are not recognized by the peptide-specific T cells (negative control) and free peptide pulsed target cells are strongly recognized by T cells (positive control).
  • DESCRIPTION OF THE SEQUENCES
  • Table 1 provides a listing of certain sequences referenced herein.
  • TABLE 1
    Description of the Sequences and SEQ ID NOs
    Description Sequence #
    T-cell description from NLVPMVATV   1
    cytomegalovirus (CMV TCE)
    (pp65, position 495-503, HLA-A2)
    CMV TCE (pp65, position 265-275, RPHERNGFTVL   2
    HLA-B7)
    CMV TCE and cleavage site from NLVPMVATVASGV{Cit} GC   3
    capthepsin B cleavage site in bold.
    {Cit} = citrulline
    CMV TCE and cleavage site from RPHERNGFTVLASGFKGC   4
    capthepsin B cleavage site in bold
    CMV TCD (IE1, position 316-324, VLEETSVML   5
    HLA-A2)
    CMV TCE BRVLBBYVL, where B is   6
    (IE1, 309-317, HLA-C7) alpha-aminobutyric acic,
    (Peptidomimetic of SEQ ID NO: 17) a homolog for cysteine
    CMV TCE (IE1, 315-323, HLA-A2) YILEETSVM   7
    CMV TCE and cleavage site from VLEETSVMLASGFKGC   8
    capthepsin B cleavage site in bold
    CMV TCE and cleavage site from BRVLBBYVLASGFKGC, where   9
    capthepsin B B is alpha-aminobutyric
    acid
    cleavage site in bold
    CMV TCE and cleavage site from YILEETSVMASGFKGC  10
    capthepsin B cleavage site in bold
    Polytope containing two different CGVANLVPMVATVAVAVLEETSVML  11
    CMV-derived epitopes separated by cleavage sites in bold
    cathepsin B cleavage site
    Polytope containing two different CVARPHERNGFTVLVANLVPMVATV  12
    CMV-derived epitopes separated by cleavage site in bold
    cathepsin B cleavage site
    Polytope containing two different CGVANLVPMVATVARPHERNGFTVL  13
    CMV-derived epitopes separated by cleavage site in bold
    cathepsin B cleavage site
    Polytope containing five different CGSFRVTEHDTLLYGSFRRPHERNGFTVLG  14
    CMV-derived epitopes separated by SFRELKRKMIYMGSFRNLVPMVATV
    cathepsin B cleavage sites cleavage sites in bold
    CMV TCE (IE1, 32-41, HLA-A68 ATTFLQTMLR  15
    CMV TCE (pp65, 103-114, HLA-B35) CPSQEPMSIYVY  16
    CMV TCE (IE1, 309-317, HLA-C7) CRVLCCYVL  17
    CMV TCE (IE1, 279-287, HLA-A1/B18) CVETMCNEY  18
    CMV TCE (IE1, 198-206, HLA-A1/B18) DELRRKMMY  19
    CMV TCE (pp65, 31-40, HLA-A68) DTPVLPHETR  20
    CMV TCE (IE1, 381-389, HLA-B44) EEAIVAYTL  21
    CMV TCE (pp65, 512-521, HLA-B44) EFFDANDIY  22
    CBV TCE (IE1, 199-207, HLA-B8) ELKRKMIYM  23
    CMV TCE (IE1, 199-207, HLA-B8) ELRRKMMYM  24
    CMV TCE (IE1, 334-342, HLA-A68) EVISVMKRR  25
    CMV TCE (IE2, 381-389, HLA-B41) FEQQPTETPP  26
    CMV TCE (IE1, 221-231, HLA-B55) FPKTTNGCSQA  27
    CMV TCE (pp65, 188-195, HLA-B35) FPTKDVAL  28
    CMV TCE (pp65, 369-379, HLA-A24) FTSQYRIQGKL  29
    CMV TCE (pp65, 186-196, HLA-A68) FVFPTKDVALR  30
    CMV TCE (IE2, 242-250, HLA-A2) IIYTRNHEVK  31
    CMV TCE (pp65, 123-131, HLA-B35) IPSINVHHY  32
    CMV TCE (pp150, 101-109, HLA-B7) KARDHLAVL  33
    CMV TCE (IE1, 42-50, HLA-B40) KEVNSQLSL  34
    CMV TCE (IE1, 201-209, HLA-B27) KRKMIYMCY  35
    CMV TCE (pp65, 120-128, HLA-A2) MLNIPSINV  36
    CMV TCE (pp150, 212-220, HLA-B7) NVRRSWEEL  37
    CMV TCE (IE1, 88-96, HLA-B8) QIKVRVDMV  38
    CMV TCE (pp65, 52-61, HLA-B35) QPSLILVSQY  39
    CMV TCE (pp150, 792-802, HLA-A68) QTVTSTPVQGR  40
    CMV TCE (pp65, 341-349, HLA-A24) QYDVPAALF  41
    CMV TCE (pp65, 222-231, HLA-A24) QYVKVYLESF  42
    CMV TCE (pp50, 274-282, HLA-A1) RGDPFDKNY  43
    CMV TCE (pp65, 522-530, HLA-A2) RIFAELEGV  44
    CMV TCE (gB, 4-12, HLA-A2) RIWCLVVCV  45
    CMV TCE (IE1, 341-349, HLA-B27) RRIEEICMK  46
    CMV TCE (IE1, 201-209, HLA-B27) RRKMMYMCY  47
    CMV TCE (pp65, 364-373, HLA-B44) SEHPTFTSQY  48
    CMV TCE (pp65, 417-426, HLA-B7) TPRVTGGGAM  49
    CMV TCE (pp150, 945-955, HLA-A3) TTVYPPSSTAK  50
    CMV TCE (pp50, 52-60, HLA-A3) TVRSHCVSK  51
    CMV TCE (IE1, 81-89, HLA-A2) VLAELVKQI  52
    CMV TCE (pp50, 245-253, HLA-A1) VTEHDTLLY  53
    CMV TCE (pp65, 113-121, HLA-A24) VYALPLKML  54
    CMV TCE (pp65, 363-373, HLA-A1) YSEHPTFTSQY  55
    CMV TCE (pp65, 61-70, HLA-A68) YTPDSTPCHR  56
    CMV TCE (IE1, 316-324, HLA-A2) YVLEETSVM  57
    CMV TCE and cleavage site from ADAM28 CKPAKFFRLNLVPMVATV  58
    CMV TCE and cleavage site from ADAM28 CKPAKFFRLRPHERNGFTVL  59
    CMV TCE and cleavage site from capthepsin D CPRSFFRLGKVLEETSVML  60
    CMV TCE and cleavage site from ADAM28 CKPAKFFRLELKRKMIYM  61
    CMV TCE and cleavage site from capthepsin D CPRSFFRLGKQIKVRVDMV  62
    Polytope comprising four different CGSKPAKFFRLYSEHPTFTSQYGSPRSFFR  63
    cytomegalovirus epitopes, each separated by LGKTPRVTGGGAMGSKPAKFFRLQIKVRVD
    either and ADAM28 or cathepsin D cleavage MVGSPRSFFRLGKELRRKMMYM
    site
    T-cell epitope from Epstein Barr Virus RPQKRPSCI  64
    (EBV TCE) EBNA1
    EBV TCE EBNA1 HPVGEADYF  65
    EBV TCE EBNA1 HPVGEADYFEY  66
    EBV TCE EBNA1 IPQCRLTPL  67
    EBV TCE EBNA1 VLKDAIKDL  68
    EBV TCE EBNA2 YHLIVDTDSL  69
    EBV TCE EBNA2 DTPLIPLTIF  70
    EBV TCE EBNA2 RPTELQPTP  71
    EBV TCE EBNA3A QAKWRLQTL  72
    EBV TCE EBNA3A AYSSWMYSY  73
    EBV TCE EBNA3A RYSIFFDY  74
    EBV TCE EBNA3A FLRGRAYGL  75
    EBV TCE EBNA3A KRPPIFIRRL  76
    EBV TCE EBNA3A RPPIFIRRL  77
    EBV TCE EBNA3A LEKARGSTY  78
    EBV TCE EBNA3A HLAAQGMAY  79
    EBV TCE EBNA3A YPLHEQHGM  80
    EBV TCE EBNA3A VFSDGRVAC  81
    EBV TCE EBNA3A VPAPAGPIV  82
    EBV TCE EBNA3A SVRDRLARL  83
    EBV TCE EBNA3A RLRAEAQVK  84
    EBV TCE EBNA3A VQPPQLTLQV  85
    EBV TCE EBNA3B HRCQAIRKK  86
    EBV TCE EBNA3B TYSAGIVQI  87
    EBV TCE EBNA3B RRARSLSAERY  88
    EBV TCE EBNA3B VSFIEFVGW  89
    EBV TCE EBNA3B AVFDRKSDAK  90
    EBV TCE EBNA3B IVTDFSVIK  91
    EBV TCE EBNA3B AVLLHEESM  92
    EBV TCE EBNA3B VEITPYKPTW  93
    EBV TCE EBNA3C EGGVGWRHW  94
    EBV TCE EBNA3C QNGALAINTF  95
    EBV TCE EBNA3C LRGKWQRRYR  96
    EBV TCE EBNA3C RRIYDLIEL  97
    EBV TCE EBNA3C HHIWQNLL  98
    EBV TCE EBNA3C EENLLDFVRF  99
    EBV TCE EBNA3C LLDFVRFMGV 100
    EBV TCE EBNA3C LDFVRFMGV 101
    EBV TCE EBNA3C KEHVIQNAF 102
    EBV TCE EBNA3C FRKAQIQGL 103
    EBV TCE EBNA3C QPRAPIRPI 104
    EBV TCE EBNA-LP SLREWLLRI 105
    EBV TCE LMP1 FWLYIVMSD 106
    EBV TCE LMP1 FRRDLLCPLGA 107
    EBV TCE LMP1 YLLEMLWRL 108
    EBV TCE LMP1 YLQQNWWTL 109
    EBV TCE LMP1 TLLVDLLWL 110
    EBV TCE LMP1 DPHGPVQLSYYD 111
    EBV TCE LMP2 MGSLEMVPM 112
    EBV TCE LMP2 EDPYWGNGDRHSDYQ 113
    EBV TCE LMP2 NPVCLPVIVAPYLF 114
    EBV TCE LMP2 LPVIVAPYL 115
    EBV TCE LMP2 PYLFWLAAI 116
    EBV TCE LMP2 ASCFTASVSTVVTA 117
    EBV TCE LMP2 FTASVSTVV 118
    EBV TCE LMP2 IEDPPFNSL 119
    EBV TCE LMP2 RRRWRRLTV 120
    EBV TCE LMP2 RRWRRLTVC 121
    EBV TCE LMP2 RRLTVCGGIMF 122
    EBV TCE LMP2 TVCGGIMFL 123
    EBV TCE LMP2 MFLACVLVLIVDAV 124
    EBV TCE LMP2 LIVDAVLQL 125
    EBV TCE LMP2 GLGTLGAAI 126
    EBV TCE LMP2 LLWTLVVLL 127
    EBV TCE LMP2 SSCSSCPLSKI 128
    EBV TCE LMP2 ILLARLFLY 129
    EBV TCE LMP2 FLYALALLL 130
    EBV TCE LMP2 TYGPVFMCL 131
    EBV TCE LMP2 CLGGLLTMV 132
    EBV TCE LMP2 VMSNTLLSAW 133
    EBV TCE LMP2 LTAGFLIFL 134
    EBV TCE LMP2 LLSAWILTA 135
    EBV TCE BRLF1 LVSDYCNVLNKEFT 136
    EBV TCE BRLF1 LVSDYCNVL 137
    EBV TCE BRLF1 DYCNVLNKEF 138
    EBV TCE BRLF1 AENAGNDAC 139
    EBV TCE BRLF1 IACPIVMRYYVLDHLI 140
    EBV TCE BRLF1 YVLDHLIVV 141
    EBV TCE BRLF1 FFIQAPSNRVMIPAT 142
    EBV TCE BRLF1 ATIGTAMYK 143
    EBV TCE BRLF1 KHSRVRAYTYSKVLG 144
    EBV TCE BRLF1 RALIKTLPRASYSSH 145
    EBV TCE BRLF1 ERPIFPHPSKPTFLP 146
    EBV TCE BRLF1 QKEEAAICGQMDLS 147
    EBV TCE BRLF1 EVCQPKRIRPFHPPG 148
    EBV TCE BZLF1 LPEPLPQGQLTAY 149
    EBV TCE BZLF1 EPLPQGQLTAY 150
    EBV TCE BZLF1 APENAYQAY 151
    EBV TCE BZLF1 LQHYREVAA 152
    EBV TCE BZLF1 DSELEIKRYKNR 153
    EBV TCE BZLF1 RKCCRAKFKQLLQHYR 154
    EBV TCE BZLF1 RAKFKQLL 155
    EBV TCE BZLF1 SENDRLRLL 156
    T-cell epitope from Influenza A CTELKLSDY 157
    Virus (IAV TCE) PR8
    IAV TCE PB1 VSDGGPNLY 158
    IAV TCE MP GILGFVFTL 159
    IAV TCE MP ILGFVFTLTV 160
    IAV TCE PR8 ILRGSVAHK 161
    IAV TCE MP SIIPSGPLK 162
    IAV TCE MP1 RMVLASTTAK 163
    IAV TCE MP2 KSMREEYRK 164
    IAV TCE NP SPIVPSFDM 165
    IAV TCE PB1 QPEWFRNVL 166
    IAV TCE NP SRYWAIRTR 167
    Stem from branched peptide SEEZSEEZSEEZSEEZ, 168
    wherein Z is
    Azidonorleucine
    Branch 1-1 for branched peptide BKPAKFFRLTPRVTGGGAM-nh2, 169
    wherein B is propargyl glycine
    Branch 1-2 for branched peptide BKPAKFFRLRPHERNGFTVL-nh2, 170
    wherein B is propargyl glycine
    Branch 1-3 for branched peptide BKPAKFFRLRELRRKMMYM-nh2, 171
    wherein B is propargyl glycine
    Branch 1-4 for branched peptide BKPAKFFRLNLVPMVATV-nh2, 172
    wherein B is propargyl glycine
    Branch 3-1 for branched peptide BAIPVSLRTPRVTGGGAM-nh2, 173
    wherein B is propargyl glycine
    Branch 3-2 for branched peptide BAIPVSLRRPHERNGFTVL-nh2, 174
    wherein B is propargyl glycine
    Branch 3-3 for branched peptide BAIPVSLRELRRKMMYM-nh2, 175
    wherein B is propargyl glycine
    Branch 3-4 for branched peptide BAIPVSLVTEHDTLLY-nh2, 176
    wherein B is propargyl glycine
    C1s cleavage site YLGRSYKV 177
    C1s cleavage site MQLGRX 178
    MASP2 cleavage site SLGRKIQI 179
    C2a cleavage site GLARSNLDE 180
    Cathepsin D cleavage site PRSFFRLGK 181
    ADAM28 cleavage site KPAKFFRL 182
    ADAM28 cleavage site DPAKFFRL 183
    ADAM28 cleavage site KPMKFFRL 184
    ADAM28 cleavage site LPAKFFRL 185
    MMP2 cleavage site AIPVSLR 186
    187
    Bundled domain sequence SASGGGSGGGSVSDVPRDLEVVAATPTSLL 188
    ISWDAPAVGGGGSGGGGSTIPVSLRSTPRV
    TGGAMTIPVSLRSGGGGSGGGGSTVRYYRI
    TYGETGGNSPVQEFTVPGSKSTATISGLKP
    GVDYTITVYAVTGGGGGSGGGGSTIPVSLR
    SNLVPMVATVTIPVSLRSGGGGSGGGGSSP
    ASSKPISINYRTGGGGSGGGGSTIPVSLRS
    VLEETSVML
    MMP2 cleavage site TIPVSLRS 188
  • DESCRIPTION OF THE EMBODIMENTS
  • I. Targeting Moiety Peptide Epitope Complexes Having A Plurality of T-Cell Epitopes
  • A variety of targeting moiety peptide epitope complexes (TPECs) are described in different embodiments. In each of the embodiments, however, a targeting moiety may be used to deliver the TPEC to an area of unwanted cells, allowing for a therapeutic effect to be delivered locally. The TPEC also contains a plurality of T-cell epitopes. The TPEC further comprises cleavage sites that release the T-cell epitopes from the targeting agent, and in some embodiments from each other, when they are in the microenvironment of the unwanted cells. Although the arrangement and number of T-cell epitopes varies in different embodiments described herein, once cleaved from the targeting agent (and any neighboring T-cell epitopes), the T-cell epitopes function by stimulating an immune response against the unwanted cells. In some embodiments, maximal benefits may be achieved by releasing all of the T-cell epitopes from both the targeting agent and from each other in the cleavage process, allowing each T-cell epitope to attract an immune response to the unwanted cell.
  • Having a plurality of T-cell epitopes, as discussed in detail below, enhances the immune response against the unwanted cells, either by stimulating a stronger immune response in a given patient or by allowing the TPEC to stimulate an immune response across a wide variety of patients in different ethnic and racial groups. In one embodiment, and while not being bound by theory, the cleavage at the cleavage site allows the T-cell epitopes to be trimmed at either or both ends to the appropriate length to produce a peptide that can fit in the peptide-binding groove of HLA class I and be recognized by T-cells, so as to initiate an immune response.
  • Without cleavage of these epitopes, the prior art fails to stimulate a sufficient T-cell response because the T-cell epitopes fused together would not be adequately recognized by the patients T-cells and would, thus, not initiate an immune response against the cancer cells.
  • A. TPECs with a Plurality of T-Cell Epitopes Separately Conjugated
  • In one embodiment, the TPEC comprises a plurality of T-cell epitopes that are separately conjugated to the targeting moiety. Because the T-cell epitopes will be separately conjugated to the targeting moiety, with two exemplary embodiments shown in FIGS. 1A and 1B, this embodiment may be termed the “hairy” embodiment as the T-cell epitopes protrude from the targeting moiety like individual hairs from a person's skin. In other words, in some embodiments, a composition for retargeting an immune response to unwanted cells may comprise a TPEC comprising the formula T-(L-C-E)n. In such embodiments, a plurality of L-C-E, each attach separately to T, wherein:
  • (a) T is a targeting moiety that is capable of targeting unwanted cells;
  • (b) L is a linker capable of chemical linkage to T;
  • (c) C is a cleavage site that is (i) cleaved by an enzyme expressed by the unwanted cells; (ii) cleaved through a pH-sensitive cleavage reaction inside the unwanted cell; (iii) cleaved by a complement-dependent cleavage reaction; or (iv) cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • (d) E is a T-cell epitope.
  • N is an integer of at least 2 (optionally from about 2 to 50). The same cleavage site may optionally be used multiple times in the TPEC and the same epitope may optionally be used multiple times in the TPEC.
  • The C and E moieties may be the same in the plurality of L-C-E moieties affixed to a single T or a single T may have different C and E moieties in the plurality of L-C-E moieties. Thus, there may be more than one type of cleavage site or only one type of cleavage site. There may also, independently, be more than one type of T-cell epitope or only one type of T-cell epitope.
  • In certain aspects of the embodiments discussed in this section, the L-C-E complexes may be affixed to the targeting moiety in a random fashion. Thus, in a preparation of TPECs with a plurality of T-cell epitopes separately conjugated to the targeting moiety, some TPECs may have greater numbers of T-cell epitopes and some may have fewer numbers. Additionally, in a preparation of TPECs with a plurality of T-cell epitopes separately conjugated to the targeting moiety, the location of TPECs may differ throughout the preparation. In this vein, when these compounds are administered to a patient suffering from a disease such as cancer, the patient's body will have a much more difficult time mounting an inhibitory immune response against the preparation of TPECs. This may allow the patient to receive multiple doses of the TPEC preparation over a significant period of time, as discussed further below in Section III.B below.
  • B. TPECs with at Least One Polytope
  • In another embodiment, the TPEC comprises a plurality of T-cell epitopes that are conjugated to the targeting moiety as a polytope (for poly-epitope), but the conjugation within the polytope and to the targeting moiety occurs through cleavage sites allowing the release of the individual T-cell epitopes in the microenvironment of the unwanted cells. Several embodiments of this arrangement are shown in FIGS. 2A, 2B, and 2C. Thus, the polytope itself can have a linear and/or bundled configuration (like FIGS. 2A and 2B) or a branched configuration like a hairbrush with bristles (like FIG. 2C).
  • In FIGS. 2A-B, a composition for retargeting an immune response to unwanted cells comprises a TPEC having at least one of L-(C-E)n with each C-E attached to the L in series and the L attached to the T. It may have one or a plurality of L-(C-E)n attached to the T. In the embodiments of FIGS. 2A-B, the linker may be either a chemical linker, a peptide bond, or at least one peptide.
  • In FIG. 2C, a composition for retargeting an immune response to unwanted cells comprises at TPEC having at least one of L-(C-E)n with each C-E attached to the L in parallel and the L attached to the T. It may have one or a plurality of L-(C-E)n attached to the T. In embodiment 2C, the linker may be a chemical linker
  • In all of the embodiments of FIG. 2A-C,
  • (a) T is a targeting moiety that is capable of targeting unwanted cells;
  • (b) L is a linker capable of chemical or peptide linkage to T (including a peptide bond);
  • (c) C is a cleavage site (i) cleaved by an enzyme expressed by the unwanted cells; (ii) cleaved through a pH-sensitive cleavage reaction inside the unwanted cell; (iii) cleaved by a complement-dependent cleavage reaction; or (iv) cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
  • (d) E is a T-cell epitope;
  • wherein n is an integer of at least 2 (optionally from about 2 to 50).
  • The C and E moieties may be the same in the plurality of C-E moieties affixed through L to a single T or a single T may have different C and E moieties in the plurality of C-E moieties. Thus, there may be more than one type of cleavage site or only one type of cleavage site. There may also, independently, be more than one type of T-cell epitope or only one type of T-cell epitope.
  • In some embodiments, the plurality of the T-cell epitopes being conjugated in a polytope allow for a uniform product to be produced that contains a standard group, number, and arrangement of T-cell epitopes, while still allowing for the release of all of the T-cell epitopes in the microenvironment of the unwanted cells. Microenvironment means the specific set of physical, chemical, and biological conditions in the vicinity of cells within a distance where these conditions can have an effect on or be sensed by the cells.
  • In some embodiments, more than one polytope are conjugated to the targeting moiety. In some embodiments from about 1 to 30, 1 to 20, or 1 to 10 polytopes are conjugated to the targeting moiety. In some embodiments, about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 polytopes are conjugated to the targeting moiety, each group by one cleavage site. In these embodiments, the polytopes may be the same or different.
  • In some embodiments, the TPEC may have both at least one separately conjugated T-cell epitope and at least one polytope, according to sections I.A and I.B, respectively.
  • C. TPECs with More Than 10 T-Cell Epitopes
  • In another embodiment, the TPEC comprises a plurality of T-cell epitopes that, irrespective of how they are arranged on the targeting moiety, comprise more than 10 T-cell epitopes. In these embodiments, the T-cell epitopes may be separately conjugated or conjugated in a polytope. In other words, a composition for retargeting an immune response to unwanted cells may comprise a TPEC having:
  • (a) a targeting moiety that is capable of targeting unwanted cells;
  • (b) a plurality of more than 10 T-cell epitopes conjugated to the targeting moiety with at least one cleavage site, wherein the cleavage site is (i) cleaved by an enzyme expressed by the unwanted cells; (ii) cleaved through a pH-sensitive cleavage reaction inside the unwanted cell; (iii) cleaved by a complement-dependent cleavage reaction; or (iv) cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC.
  • In some embodiments, including TPECs with more than 10 T-cell epitopes, the immune response against the unwanted cells is notably stronger. In some embodiments, including TPECs with more than 10 T-cell epitopes, the TPEC can be used to treat a greater proportion of patients suffering from the condition characterized by unwanted cells.
  • In some compositions with TPECs having more than 10 T-cell epitopes, the T-cell epitopes may be separately conjugated to the targeting moiety, each T-cell epitope by a cleavage site. In some embodiments, with TPECs having more than 10 T-cell epitopes, the T-cell epitopes may be conjugated to the targeting moiety as at least one polytope, each polytope conjugated to the targeting moiety by a cleavage site. In some embodiments, the T-cell epitopes within a polytope have cleavage sites between them.
  • D. Compositions Comprising TPECs
  • A composition may comprise a plurality of TPECs. In some embodiments, all of the TPECs in the composition are the same. In some embodiments, at least some of the TPECs in the composition are not identical.
  • In some embodiments, each TPEC is conjugated to a plurality of identical T-cell epitopes.
  • In some embodiments, at least some of the TPECs in the composition are conjugated to a plurality of T-cell epitopes that are not identical.
  • In some embodiments, a composition may comprise at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or more different TPECs.
  • E. T-Cell Epitopes
  • T-cell epitopes function in the TPECs to attract the patient's own immune response to attack the unwanted cell by labeling it with antigenic T-cell epitopes from infectious agents.
  • Depending on desired aspects of the therapy, a variety of optional factors may be considered when choosing T-cell epitopes. Every person has six HLA class-I molecules that can bind peptides to present to CD8 T cells with some HLA types more prevalent in the population than others, such as HLA-A201 which is found in ˜45% of the Caucasian population. In situations where the epitopes chosen for conjugation are able to bind to a limited set of HLA molecules that are only found in a proportion of the population, the TPEC may not have any or as much effectiveness in other segments of the population. Using HLA-A201 as an example, if the targeting moiety is conjugated with a T-cell epitope that binds to HLA-A201 then only patients that express HLA-A201 would bind the epitope and present it to T cells and initiate an immune response. However, in patients who are HLA-A201 negative the epitope may not be able to bind to their HLA molecules and there would be no or a lesser immune response. In situations where the therapy may be provided to a wide segment of the population having different HLA molecules, using different epitopes that bind to more HLA molecules could enhance the effectiveness of the TPEC across the population.
  • As an additional factor to consider, in some embodiments, T-cell epitopes may be chosen from those that a particular person has been exposed to, a wide variety of people have been exposed to, or for which vaccines have or can be administered. T cells generally recognize the epitope in complex with an HLA molecule when the patient has been previously infected with the virus from which the epitope is derived (or in instances where the patient has previously received a vaccine containing those epitopes). Vaccines may have been administered for a prior purpose (such as childhood vaccines) or may be administered preceding TPEC treatment with the same epitope.
  • In certain instances, T-cell epitopes are chosen from cytomegalovirus (CMV), influenza, Epstein Barr virus (EBV), varicella zoster, mumps, measles, rubella, adenovirus, polio, vaccinia, RSV, rotavirus, tetanus, vaccinia, and yellow fever T-cell epitopes. Epitopes may be chosen from infectious agents that are prevalent across the population in question or for which there are vaccines that are regularly administered or could be administered as part of a combination therapy approach.
  • In certain embodiments, the T-cell epitopes are chosen from at least 2, 3, 4, or 5 different infectious agents. In certain embodiments, at least some of the T-cell epitopes are CMV epitopes.
  • In any of the various TPECs described herein, in some embodiments, the plurality of T-cell epitopes are not all identical. In some embodiments, the plurality of T-cell epitopes are the same. In certain embodiments, the plurality of T-cell epitopes comprise some that are the same and some that are different.
  • The T-cell epitopes may be all MEC Class I restricted peptides, all MEC class II restricted peptides, or a combination of both Class I and Class II.
  • In some embodiments, the plurality of T-cell epitopes are from about 7 to 14 amino acids in length, from about 8 to 13, from about 9 to 12, about 9, or about 10 amino acids.
  • In some embodiments, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 different T-cell epitopes are used in the TPECs, whether the TPECs are the same or different. In some embodiments, using a plurality of different T-cell epitopes allows the agent to stimulate a T-cell response in at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, or 90% of the human population.
  • In some embodiments, the T-cell epitopes are chosen from HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, CD1d, and MR1. In certain embodiments, the T-cell epitopes are chosen from HLA-A*01, HLA-A*02, HLA-A*03, HLA-A*11, HLA-A*24, HLA-B*44, HLA-B*07, HLA-B*08, HLA-B*15, HLA-B*35, HLA-B*40, HLA-C*07, HLA-C*03, HLA-C*05, HLA-C*04, HLA-C*06, and HLA-E*0101 restricted antigens.
  • In certain embodiments, the composition comprises at least the following T-cell epitopes HLA-A*02, HLA-A*01, and HLA-A*03.
  • When desired, more immunodominant T-cell epitopes may be selected. By immunodominant, we mean those epitopes that elicit the strongest immune response in a given patient and/or those that are known to be immunogenic across a wide cross-section of people.
  • In some embodiments, the T-cell epitopes comprise at least one of the epitopes provided in Table 2. In some embodiments, the T-cell epitopes are chosen from the epitopes provided in Table 2.
  • TABLE 2
    Exemplary T-Cell Epitopes
    Peptide from Sequence Position HLA Type
    Cytomegalovirus Epitopes
    IE1 ATTFLQTMLR (SEQ ID NO: 15) 32-41 HLA-A68
    IE1 BRVLBBYVL (SEQ ID NO: 6) 309-317 HLA-C7
    (variant of SEQ ID NO: 17, where
    the C residues are changed to B
    residues, wherein B is alpha-
    aminobutyric acid)
    pp65 CPSQEPMSIYVY (SEQ ID NO: 16) 103-114 HLA-B35
    IE1 CRVLCCYVL (SEQ ID NO: 17) 309-317 HLA-C7
    IE1 CVETMCNEY (SEQ ID NO: 18) 279-287 HLA-A1/B18
    IE1 DELRRKMMY (SEQ ID NO: 19) 198-206 HLA-A1/B18
    pp65 DTPVLPHETR (SEQ ID NO: 20) 31-40 HLA-A68
    IE1 EEAIVAYTL (SEQ ID NO: 21) 381-389 HLA-B44
    pp65 EFFDANDIY (SEQ ID NO: 22) 512-521 HLA-B44
    IE1 ELKRKMIYM (SEQ ID NO: 23) 199-207 HLA-B8
    IE1 ELRRKMMYM (SEQ ID NO: 24) 199-207 HLA-B8
    IE1 EVISVMKRR (SEQ ID NO: 25) 334-342 HLA-A68
    1E2 FEQPTETPP (SEQ ID NO: 26) 381-389 HLA-B41
    IE1 FPKTTNGCSQA (SEQ ID NO: 27) 221-231 HLA-B55
    pp65 FPTKDVAL (SEQ ID NO: 28) 188-195 HLA-B35
    pp65 FTSQYRIQGKL (SEQ ID NO: 29) 369-379 HLA-A24
    pp65 FVFPTKDVALR (SEQ ID NO: 30) 186-196 HLA-A68
    IE2 IIYTRNHEVK (SEQ ID NO: 31) 242-250 HLA-A2
    pp65 IPSINVHHY (SEQ ID NO: 32) 123-131 HLA-B35
    pp150 KARDHLAVL (SEQ ID NO: 33) 101-109 FRA-B7
    IE1 KEVNSQLSL (SEQ ID NO: 34) 42-50 FRA-B40
    IE1 KRKMIYMCY (SEQ ID NO: 35) 201-209 FRA-B27
    pp65 MLNIPSINV (SEQ ID NO: 36) 120-128 HLA-A2
    pp65 NLVPMVATV (SEQ ID NO: 1) 495-503 HLA-A2
    pp150 NVRRSWEEL (SEQ ID NO: 37) 212-220 HLA-B7
    IE1 QIKVRVDMV (SEQ ID NO: 38) 88-96 HLA-B8
    pp65 QPSLILVSQY (SEQ ID NO: 39) 52-61 HLA-B35
    pp150 QTVTSTPVQGR (SEQ ID NO: 40) 792-802 HLA-A68
    pp65 QYDVPAALF (SEQ ID NO: 41) 341-349 HLA-A24
    pp65 QYVKVYLESF (SEQ ID NO: 42) 222-231 HLA-A24
    pp50 RGDPFDKNY (SEQ ID NO: 43) 274-282 HLA-A1
    pp65 RIFAELEGV (SEQ ID NO: 44) 522-530 HLA-A2
    gB RIWCLVVCV (SEQ ID NO: 45)  4-12 HLA-A2
    pp65 RPHERNGFTVL (SEQ ID NO: 2) 265-275 HLA-B7
    IE1 RRIEEICMK (SEQ ID NO: 46) 341-349 HLA-B27
    IE1 RRKMMYMCY (SEQ ID NO: 47) 201-209 FRA-B27
    pp65 SEHPTFTSQY (SEQ ID NO: 48) 364-373 HLA-B44
    pp65 TPRVTGGGAM (SEQ ID NO: 49) 417-426 HLA-B7
    pp150 TTVYPPSSTAK (SEQ ID NO: 50) 945-955 HLA-A3
    pp50 TVRSHCVSK (SEQ ID NO: 51) 52-60 HLA-A3
    IE1 VLAELVKQI (SEQ ID NO: 52) 81-89 HLA-A2
    IE1 VLEETSVML (SEQ ID NO: 5) 316-324 HLA-A2
    pp50 VTEHDTLLY (SEQ ID NO: 53) 245-253 HLA-A1
    pp65 VYALPLKML (SEQ ID NO: 54) 113-121 HLA-A24
    IE1 YILEETSVM (SEQ ID NO: 7) 315-323 HLA-A2
    pp65 YSEHPTFTSQY (SEQ ID NO: 55) 363-373 HLA-A1
    pp65 YTPDSTPCHR (SEQ ID NO: 56) 61-70 HLA-A68
    IE1 YVLEETSVM (SEQ ID NO: 57) 316-324 HLA-A2
    Epstein Barr Virus
    EBNA1 RPQKRPSCI (SEQ ID NO: 64) 72-80 HLA-B7
    EBNA1 HPVGEADYF (SEQ ID NO: 65) 407-415 HLA-B53
    EBNA1 HPVGEADYFEY (SEQ ID NO: 66) 407-417 HLA-B35
    EBNA1 IPQCRLTPL (SEQ ID NO: 67) 528-536 HLA-B7
    EBNA1 VLKDAIKDL (SEQ ID NO: 68) 574-582 HLA-A2
    EBNA2 YHLIVDTDSL (SEQ ID NO: 69) 14-23 HLA-B38
    EBNA2 DTPLIPLTIF (SEQ ID NO: 70) 42-51 HLA-A2/B51
    EBNA2 RPTELQPTP (SEQ ID NO: 71) 234 242 HLA-B55
    EBNA3A QAKWRLQTL (SEQ ID NO: 72) 158 166 HLA-B8
    EBNA3A AYSSWMYSY (SEQ ID NO: 73) 176 184 HLA-A30
    EBNA3A RYSIFFDY (SEQ ID NO: 74) 246-253 HLA-A24
    EBNA3A FLRGRAYGL (SEQ ID NO: 75) 325-333 HLA-B8
    EBNA3A KRPPIFIRRL (SEQ ID NO: 76) 378 387 HLA-B27
    EBNA3A RPPIFIRRL (SEQ ID NO: 77) 379-387 HLA-B7
    EBNA3A LEKARGSTY (SEQ ID NO: 78) 406-414 HLA-B62
    EBNA3A HLAAQGMAY (SEQ ID NO: 79) 450-458 HLA-A1
    EBNA3A YPLHEQHGM (SEQ ID NO: 80) 458-466 HLA-B35
    EBNA3A VFSDGRVAC (SEQ ID NO: 81) 491-499 HLA-A29
    EBNA3A VPAPAGPIV (SEQ ID NO: 82) 502-510 HLA-B7
    EBNA3A SVRDRLARL (SEQ ID NO: 83) 596-604 HLA-A2
    EBNA3A RLRAEAQVK (SEQ ID NO: 84) 603-611 HLA-A3
    EBNA3A VQPPQLTLQV (SEQ ID NO: 85) 617 625 HLA-B46
    EBNA3B HRCQAIRKK (SEQ ID NO: 86) 149-457 HLA-B27
    EBNA3B TYSAGIVQI (SEQ ID NO: 87) 217-225 HLA-A24
    EBNA3B RRARSLSAERY (SEQ ID NO: 88) 244-254 HLA-B27
    EBNA3B VSFIEFVGW (SEQ ID NO: 89) 279-287 HLA-B58
    EBNA3B AVFDRKSDAK (SEQ ID NO: 90) 399-408 HLA-A11
    EBNA3B IVTDFSVIK (SEQ ID NO: 91) 416-424 HLA-A11
    EBNA3B AVLLHEESM (SEQ ID NO: 92) 488-496 HLA-B35.01
    EBNA3B VEITPYKPTW (SEQ ID NO: 93) 657-666 HLA-B44
    EBNA3C EGGVGWRHW (SEQ ID NO: 94) 163-171 HLA-B44
    EBNA3C QNGALAINTF (SEQ ID NO: 95) 213-222 HLA-B62
    EBNA3C LRGKWQRRYR (SEQ ID NO: 96) 249-258 HLA-B27
    EBNA3C RRIYDLIEL (SEQ ID NO: 97) 258-266 HLA-B27
    EBNA3C HHIWQNLL (SEQ ID NO: 98) 271-278 HLA-B39
    EBNA3C EENLLDFVRF (SEQ ID NO: 99) 281-290 HLA-B44
    EBNA3C LLDFVRFMGV (SEQ ID NO: 100) 284-293 HLA-A2
    EBNA3C LDFVRFMGV (SEQ ID NO: 101) 285-293 HLA-B37
    EBNA3C KEHVIQNAF (SEQ ID NO: 102) 335-343 HLA-B44
    EBNA3C FRKAQIQGL (SEQ ID NO: 103) 343-351 HLA-B27
    EBNA3C QPRAPIRPI (SEQ ID NO: 104) 881-889 HLA-B7
    EBNA-LP SLREWLLRI (SEQ ID NO: 105) 284-292 HLA-A2
    (A*0203)
    LMP1 FWLYIVMSD (SEQ ID NO: 106) 38-46 MHC Class I
    LMP1 FRRDLLCPLGA (SEQ ID NO: 107) 72-82 HLA-B40
    LMP1 YLLEMLWRL (SEQ ID NO: 108) 125-133 HLA-A2
    LMP1 YLQQNWWTL (SEQ ID NO: 109) 159-167 HLA-A2
    LMP1 TLLVDLLWL (SEQ ID NO: 110) 166-174 HLA-A2
    LMP1 DPHGPVQLSYYD (SEQ ID NO: 111) 375-386 HLA-B51
    LMP2 MGSLEMVPM (SEQ ID NO: 112) 1-9 HLA-B35
    LMP2 EDPYWGNGDRHSDYQ (SEQ ID NO: 113) 61-75 MHC Class I
    LMP2 MPVCLPVIVAPYLF (SEQ ID NO: 114) 121-134 MHC Class I
    LMP2 LPVIVAPYL (SEQ ID NO: 115) 125-133 HLA-B53
    LMP2 PYLFWLAAI (SEQ ID NO: 116) 131-139 HLA-A23
    LMP2 ASCFTASVSTVVTA (SEQ ID NO: 117) 141-154 MHC Class I
    LMP2 FTASVSTVV (SEQ ID NO: 118) 144-152 HLA-A68
    LMP2 IEDPPFNSL (SEQ ID NO: 119) 200-208 HLA-B40
    LMP2 RRRWRRLTV (SEQ ID NO: 120) 236-244 HLA-B27
    LMP2 RRWRRLTVC (SEQ ID NO: 121) 237-245 HLA-B14
    LMP2 RRLTVCGGIMF (SEQ ID NO: 122) 240-250 HLA-B27
    LMP2 TVCGGIMFL (SEQ ID NO: 123) 243-251 HLA-A1
    LMP2 MFLACVLVLIVDAV (SEQ ID NO: 124) 249-262 MHC Class I
    LMP2 LIVDAVLQL (SEQ ID NO: 125) 257-265 HLA-A2
    LMP2 GLGTLGAAI (SEQ ID NO: 126) 293-301 HLA-A2
    LMP2 LLWTLVVLL (SEQ ID NO: 127) 329-337 HLA-A2
    LMP2 SSCSSCPLSKI (SEQ ID NO: 128) 340-350 HLA-A11
    LMP2 ILLARLFLY (SEQ ID NO: 129) 349-358 HLA-A29
    LMP2 FLYALALLL (SEQ ID NO: 130) 356-364 HLA-A2
    LMP2 TYGPVFMCL (SEQ ID NO: 131) 419-427 HLA-A24
    LMP2 CLGGLLTMV (SEQ ID NO: 132) 426-434 HLA-A2
    LMP2 MVSNTLLSAW (SEQ ID NO: 133) 442-451 HLA-A25
    LMP2 LTAGFLIFL (SEQ ID NO: 134) 453-461 HLA-A2
    LMP2 LLSAWILTA (SEQ ID NO: 135) 447-455 HLA-A2
    BRLF1 LVSDYCNVLNKEFT (SEQ ID NO: 136) 25-39 MHC Class I
    BRLF1 LVSDYCNVL (SEQ ID NO: 137) 25-33 HLA-A2
    BRLF1 DYCNVLNKEF (SEQ ID NO: 138) 28-37 HLA-A24
    BRLF1 AENAGNDAC (SEQ ID NO: 139) 91-99 HLA-B45
    BRLF1 IACPIVMRYYVLDHLI (SEQ ID NO: 140) 101-115 HLA-A24/C2
    BRLF1 YVLDHLIVV (SEQ ID NO: 141) 109-117 HLA-A2
    BRLF1 FFIQAPSNRVMIPAT (SEQ ID NO: 142) 121-135 MHC Class I
    BRLF1 ATIGTAMYK (SEQ ID NO: 143) 134-142 HLA-A11
    BRLF1 KHSRVRAYTYSKVLG (SEQ ID NO: 144) 145-159 HLA-A3
    BRLF1 RALIKTLPRASYSSH (SEQ ID NO: 145) 225-239 HLA-A2
    BRLF1 ERPIFPHPSKPTFLP (SEQ ID NO: 146) 393-407 HLA-C4
    BRLF1 QKEEAAICGQMDLS (SEQ ID NO: 147) 529-543 HLA-B61
    BRLF1 EVCQPKRIRPFHPPG (SEQ ID NO: 148) 441-455 MHC Class I
    BZLF1 LPEPLPQGQLTAY (SEQ ID NO: 149) 52-64 MHC Class I
    BZLF1 EPLPQGQLTAY (SEQ ID NO: 150) 54-63 HLA-B35
    BZLF1 APENAYQAY (SEQ ID NO: 151) 81-89 HLA-B35
    BZLF1 LQHYREVAA (SEQ ID NO: 152) 101-115 HLA-C8
    BZLF1 DSELEIKRYKNR (SEQ ID NO: 153) 172-183 HLA-B18
    BZLF1 RKCCRAKFKQLLQHYR (SEQ ID NO: 154) 186-201 HLA-C6
    BZLF1 RAKFKQLL (SEQ ID NO: 155) 190-197 HLA-B8
    BZLF1 SENDRLRLL (SEQ ID NO: 156) 209-217 HLA-B60
    Influenza A Virus
    PR8 CTELKLSDY (SEQ ID NO: 157) 44-52 HLA-A1
    PB1 VSDGGPNLY (SEQ ID NO: 158) 591-599 HLA-A1
    MP GILGFVFTL (SEQ ID NO: 159) 58-66 HLA-A2
    MP ILGFVFTLTV (SEQ ID NO: 160) 59-68 HLA-A2
    PR8 ILRGSVAHK (SEQ ID NO: 161) 265-274 HLA-A3
    MP SIIPSGPLK (SEQ ID NO: 162) 13-21 HLA-A11
    MP1 RMVLASTTAK (SEQ ID NO: 163) 178-187 HLA-A11
    MP2 KSMREEYRK (SEQ ID NO: 164) 70-78 HLA-A11
    NP SPIVPSFDM (SEQ ID NO: 165) 473-481 HLA-B7
    PB1 QPEWFRNVL (SEQ ID NO: 166) 329-337 HLA-B7
    NP SRYWAIRTR (SEQ ID NO: 167) 383-391 HLA-B27
  • F. Targeting Moiety
  • The targeting moiety functions in the TPEC by delivering the TPEC to the local environment of the unwanted cells, enabling a localized treatment strategy. In certain embodiments, the targeting moiety targets the unwanted cells by specifically binding to the unwanted cells. In some instances, the targeting moiety specifically binds the unwanted cells even while the plurality of T-cell epitopes are conjugated to the targeting moiety.
  • In certain embodiments, the targeting moiety is an antibody or functional part thereof.
  • Certain antibody targets (with examples of unwanted cell types in parentheses) may include: Her2/Neu (Epithelial malignancies); CD22 (B cells, autoimmune or malignant); EpCAM (CD326) (Epithelial malignancies); EGFR (epithelial malignancies); PMSA (Prostate Carcinoma); CD30 (B cell malignancies); CD20 (B cells, autoimmune, allergic or malignant); CD33 (Myeloid malignancies); membrane lgE (Allergic B cells); lgE Receptor (CD23) (Mast cells or B cells in allergic disease), CD80 (B cells, autoimmune, allergic or malignant); CD86 (B cells, autoimmune, allergic or malignant); CD2 (T cell or NK cell lymphomas); CA125 (multiple cancers including Ovarian carcinoma); Carbonic Anhydrase IX (multiple cancers including Renal Cell Carcinoma); CD70 (B cells, autoimmune, allergic or malignant); CD74 (B cells, autoimmune, allergic or malignant); CD56 (T cell or NK cell lymphomas); CD40 (B cells, autoimmune, allergic or malignant); CD19 (B cells, autoimmune, allergic or malignant); c-met/HGFR (Gastrointestinal tract and hepatic malignancies; TRAIL-R1 (multiple malignancies including ovarian and colorectal carcinoma); DRS (multiple malignancies including ovarian and colorectal carcinoma); PD-1 (B cells, autoimmune, allergic or malignant); PD1L (Multiple malignancies including epithelial adenocarcinoma); IGF-1R (Most malignancies including epithelial adenocarcinoma); VEGF-R2 (The vasculature associated with the majority of malignancies including epithelial adenocarcinomas; Prostate stem cell antigen (PSCA) (Prostate Adenocarcinoma); MUC1 (Epithelial malignancies); CanAg (tumors such as carcinomas of the colon and pancreas); Mesothelin (many tumors including mesothelioma and ovarian and pancreatic adenocarcinoma); P-cadherin (Epithelial malignancies, including breast adenocarcinoma); Myostatin (GDF8) (many tumors including sarcoma and ovarian and pancreatic adenocarcinoma); Cripto (TDGF1) (Epithelial malignancies including colon, breast, lung, ovarian, and pancreatic cancers); ACVRL 1/ALK1 (multiple malignancies including leukaemias and lymphomas); MUC5AC (Epithelial malignancies, including breast adenocarcinoma); CEACAM (Epithelial malignancies, including breast adenocarcinoma); CD137 (B cells or T cells, autoimmune, allergic or malignant); CXCR4 (B cells or T cells, autoimmune, allergic or malignant); Neuropilin 1 (Epithelial malignancies, including lung cancer); Glypicans (multiple cancers including liver, brain and breast cancers); HERS/EGFR (Epithelial malignancies); PDGFRa (Epithelial malignancies); EphA2 (multiple cancers including neuroblastoma, melanoma, breast cancer, and small cell lung carcinoma); CD38 (Myeloma); CD138 (Myeloma); a4-integrin (AML, myeloma, CLL, and most lymphomas).
  • In certain modes, antibodies include an anti-epidermal growth factor receptor antibody such as Cetuximab, an anti-Her2 antibody, an anti-CD20 antibody such as Rituximab, an anti-CD22 antibody such as Inotuzumab, G544 or BU59, an anti-CD70 antibody, an antiCD-33 antibody such as hp67.6 or Gemtuzumab, an anti-MUC1 antibody such as GP1.4 and SM3, an anti-CD40 antibody, an anti-CD74 antibody, an anti-P-cadherin antibody, an anti-EpCAM antibody, an anti-CD138 antibody, an anti-E-cadherin antibody, an anti-CEA antibody, an anti-FGFR3 antibody, and an anti-α4-integrin antibody such as natalizumab.
  • G. Cleavage Sites
  • The cleavage sites function to release the T-cell epitope from the targeting moiety and, in some embodiments, to release the T-cell epitopes from each other. Releasing the T-cell epitopes into single epitopes allows them to most effectively label the unwanted cell for immune attack.
  • In some instances, the cleavage site may be a separate sequence and in other instances the cleavage site may be integrated into the T-cell epitope such that one sequence serves the function of both elements. This may apply to any of the embodiments described herein and is determined by the selection of the epitope sequences.
  • The cleavage sites can function in different ways to release the T-cell epitopes in the microenvironment of the unwanted cells. The cleavage may occur inside the unwanted cell or outside the unwanted cell, depending on the strategy employed. If cleavage occurs outside the unwanted cell, the T-cell epitope peptides can be presented without first being internalized into a cell and being engaged in the classical antigen-processing pathways. If cleavage occurs outside the unwanted cell, it may occur in the microenvironment surrounding the cell, including at the cell surface. For example, when the unwanted cell is a cancer cell, the cleavage may occur in the tumor microenvironment (outside of an in the vicinity of the cancer cell), including at the surface of the cancer cell.
  • In certain embodiments, at least one cleavage site may be cleaved by an enzyme expressed by the unwanted cells. Cancer cells, for instance, are known to express certain enzymes, such as proteases, and these may be employed in the TPEC strategy to cleave the TPEC's cleavage site. By way of nonlimiting example, cathepsin B cleaves FR, FK, VA and VR amongst others; cathepsin D cleaves PRSFFRLGK (SEQ ID NO: 181), ADAM28 cleaves KPAKFFRL (SEQ ID NO: 182), DPAKFFRL (SEQ ID NO: 183), KPMKFFRL (SEQ ID NO: 184) and LPAKFFRL (SEQ ID NO: 185); and MMP2 cleaves AIPVSLR (SEQ ID NO: 186).
  • In some embodiments, at least one cleavage site may be cleaved through a pH-sensitive cleavage reaction inside the unwanted cell. If the TPEC is internalized into the cell, the cleavage reaction may occur inside the cell and may be triggered by a change in pH between the microenvironment outside the unwanted cell and the interior of the cell. Specifically, some cancer types are known to have acidic environments in the interior of the cancer cells. Such an approach may be employed when the interior unwanted cell type has a characteristically different pH from the extracellular microenvironment, such as particularly the glycocalyx. Because pH cleavage can occur in all cells in the lysozymes, selection of a targeting agent when using a pH-sensitive cleavage site may require, when desired, more specificity. For example, when a pH-sensitive cleavage site is used, a targeting agent that binds only or highly preferably to cancer cells may be desired (such as, for example, an antibody binding to mesothelin for treatment of lung cancer).
  • In certain embodiments, at least one cleavage site may be cleaved by a complement-dependent cleavage reaction. Once TPECs bind to the unwanted cell, the patient's complement cascade may be triggered. In such a case, the complement cascade may also be used to cleave the T-cell epitope from the targeting agent by using a cleavage site sensitive to a complement protease. For example, C1r and C1s and the C3 convertases (C4B,2a and C3b,Bb) are serine proteases. C3/C5 and C5 are also complement proteases Mannose-associated binding proteins (MASP), serine proteases also involved in the complement cascade and responsible for cleaving C4 and C2 into C4b2b (a C3 convertase) may also be used. For example, and without limitation, C1s cleaves YLGRSYKV (SEQ ID NO: 177) and MQLGRX (SEQ ID NO: 178). MASP2 is believed to cleave SLGRKIQI (SEQ ID NO: 179). Complement component C2a and complement factor Bb are believed to cleave GLARSNLDE (SEQ ID NO: 180).
  • In some embodiments, at least one cleavage site may be cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC. For example, any protease may be simultaneously directed to the microenvironment of the unwanted cells by conjugating the protease to a targeting agent that delivers the protease to that location. The targeting agent may be any targeting agent described herein. The protease may be affixed to the targeting agent through a peptide or chemical linker and may maintain sufficient enzymatic activity when bound to the targeting agent.
  • In some embodiments, the TPEC has a plurality of cleavage sites that are the same. In other embodiments, the TPEC has a plurality of cleavage sites that are not all identical, either in sequence and/or in type, as described above.
  • H. Preparation of the T-Cell Epitopes and Cleavage Sites
  • 1. Preparation of Individual T-Cell Epitopes and Cleavage Sites to be Separately Conjugated to Targeting Agent
  • Individual T-cell epitopes conjugated to cleavage sites may be prepared through standard peptide synthesis chemistry, such as by coupling the carboxyl group of the incoming amino acid to the N-terminus of the growing peptide chain using a N-terminal protecting group addition strategy, such as tert-butoxycaronyl (Boc) and 9-fluorenylmethoxycarbonyl (Fmoc), with their respective deprotection agents TFA and piperidine. Peptide synthesis may occur by hand or in an automated machine. Alternatively, services may be employed that prepare peptides upon order.
  • 2. Preparation of Linear Polytopes
  • Polytopes up to −50 amino acids could be made by standard peptide synthesis. This would allow up to about 5 epitopes to be incorporated into the polytope. In instances where more epitopes in the polytope are desired, or when human protein domains flank the epitopes in the polytope, then recombinant production of the polytope may occur. The DNA sequence for the polytope would be incorporated into a vector that would allow a cell line such as Chinese hamster ovary (CHO) cells to express the protein. The protein would be secreted by the cell line and could be purified from the cell culture supernatant. The purified polytope could then be conjugated to a targeting moiety through a chemical linker, as described herein. In another embodiment, nucleic acids encoding the polytope could be added on to an end of the DNA sequence encoding the targeting moiety to make one continuous polypeptide chain incorporating the targeting moiety and polytope. This could then be expressed in a cell line in the same way as the previous embodiment.
  • 3. Preparation of Branched Polytope
  • Branched polytopes, such as shown in FIG. 2C, may also be prepared. Individual T-cell epitopes to be applied to a branched polytope may be prepared according to Section I.H.1 before being conjugated to a connecting stem. In some embodiments, the connecting stem may be comprised of amino acids and may be a peptide stem.
  • The peptide stem may comprise amino acids that have a reactive property that can be targeted by crosslinking reagents. In some embodiments, cysteine and lysine may be used as there are a large number of crosslinking reagents that may be used at these amino acids. In one embodiment, a connecting stem may be a peptide comprising a large number of lysine or cysteine residues to facilitate linking reactions by sulfo-SMCC, for example. In another embodiment, the connecting stem may comprise serine or threonine, so as to partner with a crosslinking agent that would link to hydroxyl groups on these amino acids.
  • In another embodiment, spacer amino acids may be used in between those that have a reactive property to the crosslinking reagents in order to allow for protease attack without being blocked by other peptides bound to the stem. In certain aspects, a basic spacer may include glycine and serine. In some embodiments, the incorporation of proline between reactive amino acids may be useful as proline induces a slight rotation of the peptide which may help to keep the protease cleavable peptides bound to the stem further apart.
  • In certain embodiments, the peptide stem may comprise from about 10 to 80, 20 to 80, or 40 to 80 amino acids. In one embodiment the peptide stem comprises from about 2 to 20 amino acids that are bound to a T-cell epitope and cleavage site.
  • The individual T-cell epitopes may be conjugated to the peptide stem using the chemical linker technology discussed in Section I.I below. The connecting stem comprising the individual T-cell epitopes may also be conjugated to the targeting moiety using the chemical linker technology discussed in Section LI below. In some embodiments, a different chemical linker may be chosen for these two conjugations so as to have additional control over the conjugation process. In one embodiment, T-cell epitopes may be affixed to the connecting stem by sulfo-SMCC and the connecting stem comprising the T-cell epitopes to the targeting moiety by 3-MPA, for example.
  • I. Method of Conjugation to the Targeting Moiety
  • Different approaches may be employed to conjugate the cleavage site(s) and plurality of T-cell epitopes (whether as separate T-cell epitope and cleavage site pairs or whether as a polytope) to the targeting agent. In some aspects, a polytope comprising a plurality of cleavage sites and a plurality of T-cell epitopes are conjugated to the targeting agent using at least one peptide bond. In certain aspects, the conjugation occurs through at least one bond other than a peptide bond. Such a conjugation may be through a chemical linker A nonpeptide bond, such as using a chemical linker, may be employed for separately conjugated pairs of T-cell epitopes and cleavage sites or for polytopes.
  • In some instances, a chemical linker may be a heterobifunctional crosslinking reagent. Heterobifunctional crosslinking reagents covalently bind two proteins together by targeting different functional groups on separate proteins. The amine-to-sulphydryl crosslinking reagents contain an NHS-ester at one end of the reagent, which binds to free amine groups on a first protein/peptide, predominantly on the amino acid lysine. At the other end of the reagent, a maleimide group binds to sulphydryl group of a second protein/peptide, which can be found on the amino acid cysteine. Examples of amine-to-sulphydryl crosslinking reagents may include (a) sulfosuccinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (Sulfo-SMCC, which is soluble in water) or succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC, which has poor water solubility), (b) succinimidyl 4-(p-maleimidophenyl)butyrate (SMPB), (c) succinimidyl 6-[(beta-maleimidopropionamido)hexanoate] (SMPH); and (d) Sulfosuccinimidyl 6-(3′-[2-pyridyldithio]-propionamido) hexanoate (Sulfo-LC-SPDP); or (e) maleimide such as 3-maleimidopropionic acid.
  • Alternatively, another class of cross-linking reagents are the sulphydryl-to-carbohydrate reagents, which contain a maleimide group at one end and a hydrazide group at the other end. The maleimide group binds to a free sulphydryl on a first protein/peptide, such as that found on the amino acid cysteine, and the hydrazide group binds to an aldehyde group formed from an oxidized carbohydrate on a second protein/peptide. This family of reagents includes (a) 3,3′-N-[ε-Maleimidocaproic acid] hydrazide, trifluoroacetic acid salt (EMCH) and (b)N-beta-Maleimidopropionic acid hydrazide-trifluoroacetic acid (BMPH).
  • A third group of heterobifunctional cross-linking reagents are the photocleavable reagents including sulfosuccinimidyl 2-([4,4′-azipentanamido]ethyl)-1,3′-dithiopropionate (SDAD). These reagents have an NHS-ester at one end linking to free amines (lysine) and a diazrine group at the other end which can react with any amino acid side chain or peptide backbone upon activation with long-wave ultra violet light (330-370 nm). There are many other reagents from these groups and from other cross-linking groups that can be used in this technology.
  • J. Inclusion of Human Protein Domains
  • In certain embodiments, the T-cell epitopes are flanked on one or both ends by at least one human protein domain. In some embodiments, the cleavage sites reside between the T-cell epitopes and the human protein domains
  • Various human protein domains may be used in this manner. For example, at least one human protein domain may be a beta barrel or a coiled coil. In some embodiments, the human protein may be a FN3 (Fibronectin type III) domain. In some embodiments, the human protein may be beta-sandwich, Lipocalin, EETI-II/AGRP, Kunitz domain (BPTI), Thioredoxin, Protein A, Ankyrin, gamma-B-crystallin/ubiquitin, CTLD3/Tetranexin, or and LDLR-A In some embodiments, the human protein may be human serum albumin, immunoglobulin CH2 domain, or camelid VHH domain.
  • In certain instances, a human protein domain may be a CL, CH2, and/or CH3 domain. For example, a T-cell epitope or plurality of T-cell epitopes may be flanked by CH2 sequences. Such CH2 sequences may be within the CH2 domain of an antibody or functional part serving as the targeting moiety. Such CH2 sequences may also be an additional CH2 domain distinct from the targeting moiety. In some embodiments, such as shown in FIG. 2B, framework regions may be employed in a polytope to give additional three dimensional organization to the polytope.
  • In some aspects, the human protein domain is not a human immunoglobulin protein domain
  • In some aspects, the human protein domain displays the T-cell epitopes on its three-dimensional surface.
  • II. Pharmaceutical Compositions
  • The TPECs may be employed as pharmaceutical compositions. As such, they may be prepared along with a pharmaceutically acceptable carrier. If parenteral administration is desired, for instance, the TPECs may be provided in sterile, pyrogen-free water for injection or sterile, pyrogen-free saline. Alternatively, the TPECs may be provided in lyophilized form for resuspension with the addition of a sterile liquid carrier.
  • III. Methods of Treatment
  • A. Reduction of Unwanted Cells, Retargeting of Immune Response, and Treatment of Cancer
  • The TPECs described herein may be used in a method of treating a disease in a patient characterized by the presence of unwanted cells comprising administering a TPEC composition to the patient. This may include both treating and preventing a disorder. Additionally, the TPECs described herein may also be used in a method of retargeting (i.e., redirecting) a patient's own immune response to unwanted cells comprising administering a TPEC composition to the patient.
  • The amount of the agent administered to the patient may be chosen by the patient's physician so as to provide an effective amount to treat the condition in question.
  • The patient receiving treatment may be a human. The patient may be a primate or any mammal. Alternatively, the patient may be an animal, such as a domesticated animal (for example, a dog or cat), a laboratory animal (for example, a laboratory rodent, such as a mouse, rat, or rabbit), or an animal important in agriculture (such as horses, cattle, sheep, or goats).
  • The condition characterized by unwanted cells may include cancer. The cancer may be a solid or non-solid malignancy. The cancer may be any cancer such as breast cancer, ovarian cancer, endometrial cancer, cervical cancer, bladder cancer, renal cancer, melanoma, lung cancer, prostate cancer, testicular cancer, thyroid cancer, brain cancer, oesophageal cancer, gastric cancer, pancreatic cancer, colorectal cancer, liver cancer, leukaemia, myeloma, nonHodgkin's lymphoma, Hodgkin's lymphoma, acute myeloid leukaemia, acute lymphoblastic leukaemia, chronic lymphoblastic leukaemia, lymphoproliferative disorder, myelodysplastic disorder, myeloproliferative disease and premalignant disease.
  • The condition characterized by unwanted cells may also include an allergic or autoimmune disease. For instance, autoimmune diseases may include Addison's disease, celiac disease, dermatomyositis, Graves' disease, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, pernicious anemia, reactive arthritis, rheumatoid arthritis, Sjogren syndrome, and systemic lupus erythematosus.
  • The TPECs may be administered alone or in conjunction with other forms of therapy, including surgery, radiation, or traditional chemotherapy. In some embodiments, the activity of the TPECs may also be enhanced by boosting the patient's immune response against one or more of the T-cell epitopes used, such as by vaccinating the subject with the T-cell epitope or by administering immunostimulatory agents.
  • In some embodiments, the patient receives multiple doses of the composition over at least 30, 45, 60, 75, 90, 120, 150, or more days, or on an ongoing basis. In certain modes the patient receives multiple doses of the composition over at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months, or on an ongoing basis. If approaches are employed to reduce the patient's immune response against the TPEC itself, additional benefits may be achieved by administering the composition to a patient in relapse who received the composition for an earlier round of therapy.
  • B. Reduction of Immune Response Against TPEC Itself
  • In certain aspects described herein, having multiple copies of the same T-cell epitope increases an immune response against the unwanted cell when the agent is administered to a patient and having a diversity of T-cell epitopes assures effectiveness across a wide variety of patients from different racial and ethnic groups. Nevertheless, if a physician desires to use a TPEC therapy over a continued period of time, optional steps may be taken to reduce the patient's own immune response against the TPEC itself.
  • In certain embodiments, the arrangement or composition of T-cell epitopes on the TPEC are random in nature. For example, if a mixture of T-cell epitopes are conjugated using a chemical linker to the targeting moiety, different combinations of T-cell epitopes may affix to the targeting moieties. This makes it significantly more difficult for the patient to mount an immune response against the TPECs themselves. Even in instances where the plurality of T-cell epitopes are the same, affixing them separately to the targeting moiety through a chemical linker may also result in a random placement of the T-cell epitopes along the targeting moiety, likewise damping the patient's own immune response against the TPEC.
  • Such approaches may ensure that the patient does not develop an immune response against the TPEC composition sufficient to inactivate the TPEC composition upon subsequent administrations, meaning that no more than about 0%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the composition is inactivated by the patient's own antibodies to the TPEC.
  • Immunogenicity of a composition may be measured in an ELISA assay using human serum. For example, test compositions may be immobilized on a 96-well plate, blocked and diluted serum samples incubated for 1 hour. Antibodies against the test composition present in the human sera may bind to the test compositions on the plate. Biotinylated test agent or a biotinylated secondary antibody such as an anti-human IgG/IgA/IgM in combination with streptavidin-HRP and TMB could be used to generate a signal.
  • The present compositions are expected to be at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% less immunogenic than prior compositions.
  • EXAMPLES Example 1. Preparation of T-cell Epitopes and Cleavage Sites
  • Peptides comprising T-cell epitopes and cleavage sites were ordered from external companies who synthesized them in standard solid phase peptide synthesis. The peptides were dissolved in DMSO to a final concentration of 10 mg/ml to be used for conjugation.
  • Example 2. Standard Operating Protocol for Conjugation of Polytope Using Sulfo-SMCC
  • The following procedure was used as a standard-operating protocol for conjugation of polytope peptide (comprising a plurality of T-cell epitopes and cleavage sites) to an antibody serving as a targeting moiety by using sulfo-SMCC.
  • 1. Cysteinylated peptides dissolved in DMSO to final concentration of 10 mg/ml.
  • 2. Weigh 1 mg Sulfosuccinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate (Sulfo-SMCC) and dissolve in 200 μl phosphate buffered saline (PBS) (final concentration 5 mg/ml).
  • 3. Add 100 μl antibody (10 mg/ml, 1 mg antibody) to 10 μl dissolved Sulfo-SMCC (5 mg/ml) and incubate at room temperature for 30 minutes.
  • 4. Wash a ZebaSpin desalting column (Pierce) by firstly spinning the column at 1500 g for 60 seconds to remove the ethanol (storage buffer).
  • 5. Add 300 μl PBS and spin at 1500 g for 60 seconds. Remove eluate and repeat a further three times.
  • 6. Add up to 125 μl antibody-SMCC to each column, and centrifuge at 1500 g for 120 seconds, collecting the eluate.
  • 7. To 100 μl antibody-SMCC conjugate, add 3 μl cysteinylated peptide (10 mg/ml) and incubate at room temperature for 30 minutes.
  • 8. Wash a Protein A column (GE Healthcare) by firstly spinning the column at 100 g for 30 seconds to remove the ethanol (storage buffer).
  • 9. Add 500 μl PBS and spin at 100 g for 30 seconds. Remove eluate and repeat a further two times.
  • 10. Dilute antibody-peptide conjugate to 500 μl in PBS and add it to the protein A column, mixing the antibody with the beads. Leave at room temperature for 20 minutes, shaking
  • 11. Spin the column at 100 g and remove the eluate, the antibody-peptide complex should still be coupled to the beads.
  • 12. Wash the column by adding 500 μl PBS and mixing the beads well before spinning at 100 g for 30 seconds and removing eluate. Repeat this step a further three times.
  • 13. To elute the bound antibody, add 200 μl 0.1M citric acid to the beads and incubate for 5 minutes at room temperature. Place column in a 2 ml eppendorf containing 25 μl 1M Tris pH9 and spin at 100 g for 30 seconds; collect eluate.
  • 14. Optionally repeat step 13.
  • 15. Store antibody-peptide complex at 4° C.
  • Example 3. Standard Operating Protocol for Production of a TPEC Comprising Separately-Conjugated Epitopes Using Sulfo-SMCC
  • The following procedure was used as a standard-operating protocol for separately conjugating a plurality of T-cell epitopes and their corresponding cleavage sites to an antibody serving as a targeting moiety by using sulfo-SMCC.
  • 1. Cysteinylated peptides dissolved in DMSO to final concentration of 10 mg/ml.
  • 2. Weigh 1 mg Sulfosuccinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate (Sulfo-SMCC) and dissolve in 200 μl phosphate buffered saline (PBS) (final concentration 5 mg/ml).
  • 3. Add 100 μl antibody (10 mg/ml, 1 mg antibody) to 10 μl dissolved Sulfo-SMCC (5 mg/ml) and incubate at room temperature for 30 minutes.
  • 4. Wash a ZebaSpin desalting column (Pierce) by firstly spinning the column at 1500 g for 60 seconds to remove the ethanol (storage buffer).
  • 5. Add 300 μl PBS and spin at 1500 g for 60 seconds. Remove eluate and repeat a further three times.
  • 6. Add up to 125 μl antibody-SMCC to each column, and centrifuge at 1500 g for 120 seconds, collecting the eluate.
  • 7. Generate a mixture or required peptides in a tube so that there is a total of 30 μg of total peptide. Add the peptide mixture to 100 μl of antibody-SMCC complex and leave at room temperature for 30 minutes.
  • 8. Wash a Protein A column (GE Healthcare) by firstly spinning the column at 100 g for 30 seconds to remove the ethanol (storage buffer).
  • 9. Add 500 μl PBS and spin at 100 g for 30 seconds. Remove eluate and repeat a further two times.
  • 10. Dilute antibody-peptide conjugate to 500 μl in PBS and add it to the protein A column, mixing the antibody with the beads. Leave at room temperature for 20 minutes, shaking.
  • 11. Spin the column at 100 g and remove the eluate, the antibody-peptide complex should still be coupled to the beads.
  • 12. Wash the column by adding 500 μl PBS and mixing the beads well before spinning at 100 g for 30 seconds and removing eluate. Repeat this step a further three times.
  • 13. To elute the bound antibody, add 200 μl 0.1M citric acid to the beads and incubate for 5 minutes at room temperature. Place column in a 2 ml eppendorf containing 25 μl 1M Tris pH9 and spin at 100 g for 30 seconds; collect eluate.
  • 14. Optionally repeat step 13.
  • 15. Store antibody-peptide complex at 4° C.
  • Example 4. Standard Operating Protocol for Production of Polytope TPEC Using 3-Maleimidopropionic Acid Linked Peptide
  • The following procedure was used as a standard-operating protocol for separately conjugating a polytope to an antibody serving as a targeting moiety by using 3-MPA.
  • 1. 3-maleimidopropioinc acid linked peptides dissolved in DMSO to final concentration of 10 mg/ml.
  • 2. To 100 μl antibody (diluted in PBS if required), add 3 μl polytope peptide (10 mg/ml) and incubate at room temperature for 30 minutes.
  • 3. Wash a Protein A column (GE Healthcare) by firstly spinning the column at 100 g for 30 seconds to remove the ethanol (storage buffer).
  • 4. Add 500 μl PBS and spin at 100 g for 30 seconds. Remove eluate and repeat a further two times.
  • 5. Dilute antibody-peptide conjugate to 500 μl in PBS and add it to the protein A column, mixing the antibody with the beads. Leave at room temperature for 20 minutes, shaking
  • 6. Spin the column at 100 g and remove the eluate, the antibody-peptide complex should still be coupled to the beads.
  • 7. Wash the column by adding 500 μl PBS and mixing the beads well before spinning at 100 g for 30 seconds and removing eluate. Repeat this step a further three times.
  • 8. To elute the bound antibody, add 200 μl 0.1M citric acid to the beads and incubate for 5 minutes at room temperature. Place column in a 2 ml eppendorf containing 25 μl 1M Tris pH9 and spin at 100 g for 30 seconds; collect eluate.
  • 9. Optionally repeat step 8.
  • 10. Store antibody-peptide complex at 4° C.
  • Example 5. Standard Operating Protocol for Production of a TPEC Comprising Separately-Conjugated Epitopes Using 3-Maleimidopropionic Acid Linked Peptide
  • The following procedure was used as a standard-operating protocol for separately conjugating a plurality of T-cell epitopes and their corresponding cleavage sites to an antibody serving as a targeting moiety by using 3-MPA.
  • 1. 3-maleimidopropioinc acid linked peptides dissolved in DMSO to final concentration of 10 mg/ml.
  • 2. Generate a mixture or required peptides in a tube so that there is a total of 30 μg of total peptide, add to 100 μl of antibody (diluted in PBS if required) and incubate at room temperature for 30 minutes.
  • 3. Wash a Protein A column (GE Healthcare) by firstly spinning the column at 100 g for 30 seconds to remove the ethanol (storage buffer).
  • 4. Add 500 μl PBS and spin at 100 g for 30 seconds. Remove eluate and repeat a further two times.
  • 5. Dilute antibody-peptide conjugate to 500 μl in PBS and add it to the protein A column, mixing the antibody with the beads. Leave at room temperature for 20 minutes, shaking
  • 6. Spin the column at 100 g and remove the eluate, the antibody-peptide complex should still be coupled to the beads.
  • 7. Wash the column by adding 500 μl PBS and mixing the beads well before spinning at 100 g for 30 seconds and removing eluate. Repeat this step a further three times.
  • 8. To elute the bound antibody, add 200 μl 0.1M citric acid to the beads and incubate for 5 minutes at room temperature. Place column in a 2 ml eppendorf containing 25 μl 1M Tris pH9 and spin at 100 g for 30 seconds; collect eluate.
  • Optionally repeat step 8.
  • Store antibody-peptide complex at 4° C.
  • Example 6. TPEC Compositions Comprising Two Cytomegalovirus Peptides and Evaluation in B-Lymphoblastoid Cells
  • We contacted B-lymphoblastoid cells (B-LCL) with an agent comprising Rituximab conjugated to two different cytomegalovirus peptides NLVPMVATV (SEQ ID NO: 1) and RPHERNGFTVL (SEQ ID NO: 2) each with a cleavage site for cathepsin B. Subsequent exposure to peptide-specific T cells resulted in the generation of a T cell response to the B-LCL.
  • Rituximab was conjugated with the peptides NLVPMVATVASGV{CIT}GC (SEQ ID NO: 3) and RPHERNGFTVLASGFKGC (SEQ ID NO: 4) at the following ratios from Table 3, wherein CIT represents citrulline, a type of amino acid that is similar to arginine
  • TABLE 3
    Peptide Ratios
    NLVPMVATVASGV RPHERNGFTVLAS
    {CIT}GC GFKGC
    TPEC (SEQ ID NO: 3) (SEQ ID NO: 4)
     1   0% 100%
     2  10%  90%
     3  20%  80%
     4  30%  70%
     5  40%  60%
     6  50%  50%
     7  60%  40%
     8  70%  30%
     9  80%  20%
    10  90%  10%
    11 100%   0%
  • After staining the cells with Rituximab conjugated to the mixture of peptides, labeled cells were washed and cultured overnight at 37° C. in the presence of peptide-specific T cells. Supernatant was harvested and assayed for the presence of IFN-γ.
  • Using NLV-specific T cells, TPEC #11 was recognized strongly as seen by a large production of IFN-γ whereas TPEC #1 is not recognized at all as there was no production of IFN-γ. See FIG. 3A. Conversely, using RPH-specific T cells TPEC #1 was recognized strongly as seen by a large production of IFN-γ whereas TPEC #11 is not recognized at all as there was no production of IFN-γ. See FIG. 3B. There is production of IFN-γ by both NLV- and RPH-specific T cells towards TPEC #2-10, demonstrating the notion that conjugating more than one peptide to the antibody can allow one to engage with more than one specificity of peptide-specific T cell.
  • Example 7. TPEC Compositions Comprising Three Cytomegalovirus Peptides and Evaluation in B-Lymphoblastoid Cells
  • We contacted B-lymphoblastoid cells (B-LCL) with an agent comprising Rituximab conjugated to three different cytomegalovirus peptides VLEETSVML (SEQ ID NO: 5), BRVLBBYVL (SEQ ID NO: 6) and YILEETSVM (SEQ ID NO: 7) each with a cleavage site for cathepsin B. Subsequent exposure to peptide-specific T cells resulted in the generation of a T cell response to the B-LCL.
  • Rituximab was conjugated with VLEETSVMLASGFKGC (SEQ ID NO: 8), BRVLBBYVLASGFKGC (SEQ ID NO: 9) where B is amino butyric acid, a homolog for cysteine, and YILEETSVMASGFKGC (SEQ ID NO: 10) at equal amounts of peptide. B-LCL cells were labeled with Rituximab TPEC and after incubation, washed to remove excess TPEC. Labeled target cells were incubated overnight at 37° C. in the presence of VLE-specific, CRV-specific or YIL-specific T cells. Supernatant from the cultures was used to assess the presence of IFN-γ.
  • Results are shown in FIG. 4. There was IFN-γ released by all of the different peptide-specific T cells in response to the TPEC-labeled target cells suggesting that each of the three conjugated peptides could be released from the antibody and used to stimulate peptide-specific T cells.
  • Example 8. TPEC Compositions Comprising a Single Peptide Having Two Different Cytomegalovirus Peptides and Evaluation in B-Lymphoblastoid Cells
  • We contacted B-lymphoblastoid cells (B-LCL) with an agent comprising Rituximab conjugated to a single peptide which comprised two different cytomegalovirus peptides: (i) NLVPMVATV (SEQ ID NO: 1) and RPHERNGFTVL (SEQ ID NO: 2) or (ii) NLVPMVATV (SEQ ID NO: 1) and VLEETSVML (SEQ ID NO: 5) each separated from the other by a cleavage site for cathepsin B. Subsequent exposure to NLV peptide-specific T cells resulted in the generation of a T cell response to the B-LCL.
  • Rituximab was conjugated with the peptides (i) CGVANLVPMVATVAVAVLEETSVML (SEQ ID NO: 11), (ii) CVARPHERNGFTVLVANLVPMVATV (SEQ ID NO: 12) and (iii) CGVANLVPMVATVARPHERNGFTVL (SEQ ID NO: 13). Target cells were labeled with TPEC and washed after incubation to remove excess TPEC. Target cells were cultured overnight at 37° C. in the presence of NLV-specific T cells and the supernatant assayed for the presence of IFN-γ the following day.
  • NLV-specific T cells were able to recognize target cells labeled with each of the three TPECs tested as determined by IFN-γ release. This demonstrates the ability of a peptide containing more than one cytomegalovirus derived peptide, separated by a protease cleavage site, to stimulate peptide-specific T cells. Furthermore, the position of the NLVPMVATV (SEQ ID NO: 1) peptide in the polytope appears to affect the magnitude of the response with the NLV peptide being furthest from the antibody CVARPHERNGFTVLVANLVPMVATV (SEQ ID NO: 12) producing the largest response. However, both polytope peptides containing the NLV peptide closest to the antibody CGVANLVPMVATVAVAVLEETSVML (SEQ ID NO: 11) and CGVANLVPMVATVARPHERNGFTVL (SEQ ID NO: 13) also demonstrate a T cell response above background.
  • Results are shown in FIG. 5.
  • Example 9. Preparation of a TPEC Comprising Polytope Branched Peptide
  • A TPEC comprising polytope branched peptide was prepared. A stem peptide that contains four azidonorleucine residues was provided along with peptides (branches) that contain propargyl glycine at the amino terminus (FIG. 6A). Each branched peptide has a NH2 cap on the C-terminal end which can aid in peptide serum stability. The sequence of the stem peptide was SEEZSEEZSEEZSEEZ, wherein Z is Azidonorleucine (SEQ ID NO: 168). For Branched TPEC 1, the sequences of the branched peptides were BKPAKFFRLTPRVTGGGAM-nh2, wherein B is propargyl glycine (SEQ ID NO: 169), BKPAKFFRLRPHERNGFTVL-nh2, wherein B is propargyl glycine (SEQ ID NO: 170), BKPAKFFRLRELRRI M-nh2, wherein B is propargyl glycine (SEQ ID NO: 171), and BKPAKFFRLNLVPMVATV-nh2, wherein B is propargyl glycine (SEQ ID NO: 172).
  • And for Branched TPEC 3, the sequences of the branched peptides were BAIPVSLRTPRVTGGGAM-nh2, wherein B is propargyl glycine (SEQ ID NO: 173), BAIPVSLRRPHERNGFTVL-nh2, wherein B is propargyl glycine (SEQ ID NO: 174), BAIPVSLRELRRI M-nh2, wherein B is propargyl glycine (SEQ ID NO: 175), and BAIPVSLVTEHDTLLY-nh2, wherein B is propargyl glycine (SEQ ID NO: 176).
  • Incubation of equimolar concentrations of the branches with the stem peptide in DMSO in the presence of 10 mg in 4 ml of the CuSO4.5H2O catalyst mixed with 10 mg in 4 ml ascorbic acid overnight resulted in the formation of the branched peptide used for conjugation. The final concentration of DMSO for the reaction was 50%. The branched peptides were purified using HPLC and verified using mass spectrometry (FIG. 6B).
  • The branched peptide was conjugated to either Rituximab or Cetuximab by firstly reducing the antibody in the presence of approximately 0.1 mM (tris(2-carboxyethyl)phosphine (TCEP) for 90 minutes. The branched peptide is then added at 3× the concentration as TCEP for 60 minutes and N-acetyl cysteine is added to quench the free peptide using the same concentration as the branched peptide for 30 minutes. The free peptide is removed using protein A sepahrose beads to bind the TPEC whilst the free peptide is washed off. The TPEC is then collected from the protein A beads by eluting using 0.1M glycine and buffered using 1 m Tris pH8.
  • Example 10. In Vitro Targeting of a Transformed B Cell Line Using TPEC Comprising Polytope Branched Peptide
  • Two agents comprised of Rituximab conjugated with a branched peptide consisting of four different viral epitopes, each linked to a single stem peptide. In Branched TPEC 1, each of the four peptides was separated from the stem peptide by an ADAM28 protease cleavage sequence. In Branched TPEC 3, each of the four peptides was separated from the stem peptide by an MMP2 cleavage sequence. The target cells were labelled with the Rituximab-TPEC before being incubated with CD8 T cells specific for one of two different viral epitopes. Specifically, TPR T cells were specific for the viral epitope TPRVTGGGAM (SEQ ID NO: 49) and this epitope was present in branches 1-1 and 3-1. RPH T cells were specific for the viral epitope RPHERNGFTVL (SEQ ID NO: 2) and this epitope was present in branches 1-2 and 3-2.
  • Upon binding malignant cells (transformed B cell line), viral epitopes were released from the stem peptide by proteolytic cleavage releasing the viral epitopes TPRVTGGGAM (SEQ ID NO: 49), RPHERNGFTVL (SEQ ID NO: 2), ELRRKMMYM (SEQ ID NO: 24) and VTEHDTLLY (SEQ ID NO: 53). Upon release, the peptides were presented on MHC class I molecules on the malignant cells where they could be recognized by the CD8 T cells. Recognition of malignant cells by the CD8 T cells was measured by release of IFN-γ by the T cells which can be used as a proxy for T cell killing
  • Results are shown in FIGS. 7A and 7B. Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides, especially using the Branch 1 TPEC. Untreated target cells were not recognized by the peptide-specific T cells (negative control) whereas free peptide pulsed target cells were strongly recognized by T cells (positive control).
  • These results demonstrate that branched TPECs can obtain positive results in a widely-recognized model for retargeting a T cell response.
  • Example 11. In Vitro Targeting of Ovarian Carcinoma Cell Line Using TPEC Comprising Polytope Branched Peptide
  • Two agents comprised of Cetuximab conjugated with a branched peptide consisting of four different viral epitopes, all linked to a single stem peptide was provided. In Branched TPEC 1, each of the four peptides was separated from the stem peptide by an ADAM28 protease cleavage sequence. In Branched TPEC 3, each of the four peptides was separated from the stem peptide by an MMP2 cleavage sequence. The target cells were labelled with the Cetuximab-TPEC before being incubated with CD8 T cells specific for one of two different viral epitopes. Specifically, TPR T cells were specific for the viral epitope TPRVTGGGAM (SEQ ID NO: 49) and this epitope was present in branches 1-1 and 3-1. RPH T cells were specific for the viral epitope RPHERNGFTVL (SEQ ID NO: 2) and this epitope was present in branches 1-2 and 3-2.
  • Upon binding malignant cells (ovarian carcinoma cell line), viral epitopes were released from the stem peptide by proteolytic cleavage releasing the viral epitopes TPRVTGGGAM (SEQ ID NO: 49), RPHERNGFTVL (SEQ ID NO: 2), ELRRKMMYM (SEQ ID NO: 24) and VTEHDTLLY (SEQ ID NO: 53). Upon release, the peptides were presented on MHC class I molecules on the malignant cells where they could be recognized by the CD8 T cells. Recognition of malignant cells by the CD8 T cells was measured by release of IFN-γ by the T cells.
  • Results are shown in FIGS. 8A and 8B. Target lymphoma cells labeled with branched peptide TPEC are recognized by T cells specific for the RPHERNGFTVL (SEQ ID NO: 2) and TPRVTGGGAM (SEQ ID NO: 49) peptides, especially using the Branch 1 TPEC. Untreated target cells were not recognized by the peptide-specific T cells (negative control) whereas free peptide pulsed target cells were strongly recognized by T cells (positive control).
  • These results demonstrate that branched TPECs can obtain positive results in a widely-recognized model for retargeting a T cell response.
  • Example 12. In Vitro Targeting of Ovarian Carcinoma Cell Line Using TPEC Containing a Bundled Polytope Domain
  • DNA for an agent comprising Cetuximab containing an additional fibronectin type 3 domain (from fibronectin 1 protein) attached to each heavy chain (depicted in FIG. 2B) was synthesized (FIG. 9A). The fibronectin type 3 domain was mutated at the “BC”, “DE” and “FG” loops to contain the viral epitopes TPRVTGGGAM (SEQ ID NO: 49), NLVPMVATV (SEQ ID NO: 1), and VLEETSVML (SEQ ID NO: 5). The viral epitopes were separated from the fibronectin type 3 domain by MMP2 protease cleavage sequences on both sides of the CMV epitope as depicted:
      • Cetuximab heavy chain—Domain—MMP2—Epitope—MMP2—Domain—MMP2—Epitope—MMP2—Domain—MMP2—Epitope
  • This would allow release of the viral epitopes from the bundled domain and targeting agent (Cetuximab) after proteolytic cleavage by MMP2. The DNA for the bundled domain TPEC was transfected into Expi293 cells and the supernatant harvested 10 days post transfection. The bundled domain TPEC was purified from the supernatant using protein A sepharose beads. The target cells, ovarian carcinoma cell line, were labelled with the purified Cetuximab-TPEC with excess, unbound TPEC washed off. The labelled target cells were then incubated overnight in the presence of NLV-specific T cells.
  • Upon binding malignant cells (ovarian carcinoma cell line), viral epitopes were released from the additional protein domain by proteolytic cleavage. The released peptides were presented on MHC class I molecules on the malignant cells where they could be recognized by the CD8+ T cells. Recognition of malignant cells by the CD8+ T cells was measured by release of IFN-γ by the T cells.
  • Results are shown in FIG. 9. Target ovarian carcinoma cells labeled with bundled domain TPEC were recognized by T cells specific for the NLVPMVATV (SEQ ID NO: 1) peptide from four different bundled domain TPEC preparations. Untreated target cells were not recognized by the peptide-specific T cells (negative control) whereas free peptide pulsed target cells were strongly recognized by T cells (positive control).
  • These results demonstrate that bundled domain TPECs can obtain positive results in a widely-recognized model for retargeting a T cell response.
  • Example 13. In Vivo Targeting of B Cell Lymphoma Using the Separately Conjugated T-Cell Epitopes (i.e., “Hairbrush”) (e.g., Chronic Lymphocytic Leukaemia)
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide mixture containing equal parts of five different cytomegalovirus-derived peptides each containing a protease cleavage site specific for cathepsin B (i) NLVPMVATVASGV{CIT}GC (SEQ ID NO: 3), (ii) VLEETSVMLASGFKGC (SEQ ID NO: 8), (iii) RPHERNGFTVLASGFKGC (SEQ ID NO: 4), (iv) YILEETSVMASGFKGC (SEQ ID NO: 10) and (v) BRVLBBYVLASGFKGC (SEQ ID NO: 9). The patient is infused with the agent, which targets all B cells, healthy and malignant. Upon binding malignant cells, the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) VLEETSVML (SEQ ID NO: 5), (iii) RPHERNGFTVL (SEQ ID NO: 2), (iv) YILEETSVM (SEQ ID NO: 7) and (v) BRVLBBYVL (SEQ ID NO: 6), which subsequently bind to HLA molecules on the surface of the malignant B cell. The malignant B cells expressing the T-cell epitopes are targeted by the host immune system for cytolysis by T cells.
  • Example 14. In Vivo Targeting of B-Cell Lymphoma Using a TPEC Comprising Polytope (e.g., Chronic Lymphocytic Leukaemia)
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide containing four different cytomegalovirus-derived epitopes (i) CGSFRVTEHDTLLYGSFRRPHERNGFTVLGSFRELKRKMIYMGSFRN LVPMVATV (SEQ ID NO: 14). Each of the four epitopes is separated from the next one by a protease cleavage site specific for cathepsin B in the conformation targeting agent—C-E1-C-E2-C-E3-C-E4 where C is protease cleavage and E is epitope. The patient is infused with the agent, which targets all B cells, healthy and malignant. Upon binding malignant cells, the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) VTEHDTLLY (SEQ ID NO: 53), (iii) RPHERNGFTVL (SEQ ID NO: 2), and (iv) ELKRKMIYM (SEQ ID NO: 23), which subsequently bind to HLA molecules on the surface of the malignant B cell. The cells expressing the T-cell epitopes are then targeted by the host immune system for cytolysis by T cells.
  • Example 15. In Vivo Targeting of B Cell Lymphoma Using the Separately Conjugated T-Cell Epitopes (I.E., “Hairbrush”) (e.g., Chronic Lymphocytic Leukaemia)
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide mixture containing equal parts of five different cytomegalovirus-derived peptides each containing a protease cleavage site specific for either ADAM28 or cathepsin D (i) CKPAKFFRLNLVPMVATV (SEQ ID NO: 58), (ii) CKPAKFFRLRPHERNGFTVL (SEQ ID NO: 59), (iii) CPRSFFRLGKVLEETSVML (SEQ ID NO: 60), (iv) CKPAKFFRLELKRKMIYM (SEQ ID NO: 61) and (v) CPRSFFRLGKQIKVRVDMV (SEQ ID NO: 62). The patient is infused with the agent, which targets all B cells, healthy and malignant. Upon binding malignant cells, the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) NLVPMVATV (SEQ ID NO: 1), (ii) RPHERNGFTVL (SEQ ID NO: 2), (iii) VLEETSVML (SEQ ID NO: 5), (iv) ELKRKMIYM (SEQ ID NO: 23) and (v) QIKVRVDMV (SEQ ID NO: 38), which subsequently bind to HLA molecules on the surface of the malignant B cell. The malignant B cells expressing the T-cell epitopes on their HLA molecules at the cell surface are targeted by the host immune system for cytolysis by T cells.
  • Example 16. In Vivo Targeting of B-Cell Lymphoma Using a TPEC Comprising Polytope (e.g., Chronic Lymphocytic Leukaemia)
  • An agent comprising Rituximab or an anti-CD22 antibody is conjugated with a peptide containing four different cytomegalovirus-derived epitopes (i) CGSKPAKFFRLYSEHPTFTSQYGSPRSFFRLGKTPRVTGGGAMG SKPAKFFRLQIKVRVDMVGSPRSFFRLGKELRRKMMYM (SEQ ID NO: 63). Each of the four epitopes is separated from the next one by a protease cleavage site specific for either ADAM28 or cathepsin D in a potential conformation, but not limited to the conformation, Targeting agent—Ci-E1-Cii-E2-CiE3 Cii-E4 where C is protease cleavage and E is epitope. The patient is infused with the agent, which targets all B cells, healthy and malignant. Upon binding malignant cells, the agent comes into contact with proteases whereby cleavage of the protease recognition domain releases the T-cell epitopes (i) YSEHPTFTSQY (SEQ ID NO: 55), (ii) TPRVTGGGAM (SEQ ID NO: 49), (iii) QIKVRVDMV (SEQ ID NO: 38), and (iv) ELRRKMMYM (SEQ ID NO: 24), which subsequently bind to HLA molecules on the surface of the malignant B cell. The cells expressing the T-cell epitopes are then targeted by the host immune system for cytolysis by T cells.
  • Example 17. Embodiments Described Herein
  • Various embodiments are described in the following nonlimiting items.
  • Item 1. A composition for retargeting an immune response to unwanted cells comprising a TPEC wherein:
      • a. T is a targeting moiety that is capable of targeting unwanted cells;
      • b. L is at least one linker capable of linkage to T, where L may be a peptide bond, at least one peptide, or a chemical linker;
      • c. C is at least one cleavage site
        • i. cleaved by an enzyme expressed by the unwanted cells;
        • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
        • iii. cleaved by a complement-dependent cleavage reaction; or
        • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
      • d. E is at least one T-cell epitope,
        wherein the L, C, and E moieties are arranged in at least one of the following patterns:
      • i. a plurality of L-C-E, each attached separately to T,
      • ii. at least one of L-(C-E)n, n is an integer of at least 2 (optionally from about 2 to 50) and with each C-E attached to the L in parallel, and/or
      • iii. at least one of L-(C-E)n, n is an integer of at least 2 (optionally from about 2 to 50) and with each C-E attached to the L in series.
  • Item 2. A composition for retargeting an immune response to unwanted cells comprising a TPEC comprising the formula T-(L-C-E)n or T-(L-Ci-Ei)n, wherein:
      • a. T is a targeting moiety that is capable of targeting unwanted cells;
      • b. L is a linker capable of chemical linkage to T;
      • c. C is a cleavage site
        • i. cleaved by an enzyme expressed by the unwanted cells;
        • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
        • iii. cleaved by a complement-dependent cleavage reaction; or
        • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
      • d. E is a T-cell epitope
        wherein n is an integer of at least 2 (optionally from about 2 to 50), i is an integer of at least 1 (optionally from about 1 to 50), and j is an integer of at least 2 (optionally from about 1 to 50).
  • Item 3. A composition for retargeting an immune response to unwanted cells comprising a TPEC comprising the formula T-L-(Ci-Ei)n, wherein:
      • a. T is a targeting moiety that is capable of targeting unwanted cells;
      • b. L is an optional linker capable of chemical or peptide linkage to T;
      • c. C is a cleavage site
        • i. cleaved by an enzyme expressed by the unwanted cells;
        • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
        • iii. cleaved by a complement-dependent cleavage reaction; or
        • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
      • d. E is a T-cell epitope;
        wherein n is an integer of at least 2 (optionally from about 2 to 50), i is an integer of at least 1 (optionally from about 1 to 50), and j is an integer of at least 1 (optionally from about 1 to 50).
  • Item 4. A composition for retargeting an immune response to unwanted cells comprising a TPEC having:
  • a. a targeting moiety that is capable of targeting unwanted cells;
  • b. a plurality of more than 10 T-cell epitopes conjugated to the targeting moiety with at least one cleavage site, wherein the cleavage site is
      • i. cleaved by an enzyme expressed by the unwanted cells;
      • ii. cleaved through a pH-sensitive cleavage reaction inside the unwanted cell;
      • iii. cleaved by a complement-dependent cleavage reaction; or
      • iv. cleaved by a protease that is colocalized to the unwanted cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC.
  • Item 5. The composition of any one of items 1, 2, or 4, wherein the plurality of T-cell epitopes are individually conjugated to the targeting moiety, each T-cell epitope by a cleavage site.
  • Item 6. The composition of any one of items 1, 3, or 4, wherein the plurality of T-cell epitopes are conjugated as at least one bundle to the targeting moiety by one cleavage site.
  • Item 7. The composition of item 6, wherein the T-cell epitopes within a bundle have cleavage sites between them.
  • Item 8. The composition of any one of items 1, 3-4, 6-7, wherein at least two groups of a plurality of T-cell epitopes are conjugated to the targeting moiety, each group by one cleavage site.
  • Item 9. The composition of any one of items 1-8, wherein the plurality of T-cell epitopes are not all identical.
  • Item 10. The composition of any one of items 1-8, wherein the plurality of T-cell epitopes are the same.
  • Item 11. The composition of any one of items 1-8, wherein some the T-cell epitopes are the same and further wherein some are different.
  • Item 12. The composition of any one of items 1-11, wherein the agent has a plurality of cleavage sites that are the same.
  • Item 13. The composition of any one of items 1-11, wherein the agent has a plurality of cleavage sites that are not all identical.
  • Item 14. The composition of any one of items 1, 3-4, and 6-13, wherein the at least one cleavage site and the plurality of T-cell epitopes are conjugated to the targeting agent using at least one peptide bond.
  • Item 15. The composition of any one of items 1-13, wherein the at least one cleavage site and the plurality of T-cell epitopes are conjugated to the targeting agent through at least one bond other than a peptide bond.
  • Item 16. The composition of item 15, wherein the at least one cleavage site and the plurality of T-cell epitopes are conjugated to the targeting agent through a Sulfo-SMCC, SMCC, or maleimide linkage.
  • Item 17. The composition of any one of items 1-16 wherein at least one T-cell epitope is an MHC Class I restricted peptide.
  • Item 18. The composition of any one of items 1-17, wherein at least one T-cell epitope is an MHC Class II restricted peptide.
  • Item 19. The composition of any one of items 1-18, wherein the plurality of T-cell epitopes are from about 7 to about 14 amino acids in length.
  • Item 20. The composition of any one of items 1-19, wherein the plurality of T cell epitopes are about 8 to 13, about 9 to 12, about 9, or about 10 amino acids in length.
  • Item 21. The composition of any one of items 1-20, wherein the agent comprises about or at least about 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 T cell epitopes, optionally from 2 to 100 T cell epitopes.
  • Item 22. The composition of any one of items 1-21, wherein the T-cell epitopes are chosen from CMV, influenza, EBV, hepatitis, chicken pox, mumps, measles, diphtheria, Haemophilus influenzae, rubella, pertussis, polio, pneumococcus, rotavirus, tetanus, vaccinia, and yellow fever T-cell epitopes.
  • Item 23. The composition of any one of items 1-22, wherein the composition comprises T-cell epitopes from at least two different infectious agents.
  • Item 24. The composition of any one of items 1-23, wherein the TPEC comprises at least one CMV T-cell epitope.
  • Item 25. The composition of any one of items 1-9 and 11-24, wherein using a plurality of different T-cell epitopes allows the agent to stimulate a T-cell response in at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the human population.
  • Item 26. The composition of any one of items 1-25, wherein the T-cell epitopes are chosen from HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, CD1d, and MR1.
  • Item 27. The composition of any one of items 1-26, wherein the T-cell epitopes are chosen from HLA-A*01, HLA-A*02, HLA-A*03, HLA-A*11, HLA-B*44, HLA-B*07, HLA-B*08, HLA-B*15, HLA-B*35, HLA-B*40, HLA-C*07, HLA-C*03, HLA-C*05, HLA-C*04, HLA-C*06, and HLA-E*0101 restricted antigens.
  • Item 28. The composition of any one of items 1-9 and 11-27, wherein the composition comprises at least the following T-cell epitopes: HLA-A*02, HLA-A*01, and HLA-A*03.
  • Item 29. The composition of any one of items 1-28, wherein having multiple copies of the same T-cell epitope increases an immune response against the unwanted cell when the agent is administered to a subject.
  • Item 30. The composition of any one of items 1-29, wherein the T-cell epitopes comprise at least one of SEQ ID NOS: 1-2, 5-7, 15-57.
  • Item 31. The composition of any one of items 1-30, wherein the targeting moiety targets the unwanted cells by specifically binding to the unwanted cells.
  • Item 32. The composition of any one of items 1-32, wherein the targeting moiety specifically binds the unwanted cells even while the plurality of T-cell epitopes are conjugated to the targeting moiety.
  • Item 33. The composition of any one of items 1-32, wherein the targeting moiety is an antibody or functional part thereof.
  • Item 34. The composition of any one of items 1-33, wherein the T-cell epitopes are flanked on one or both ends by at least one human protein domain.
  • Item 35. The composition of items 34, wherein at least one human protein domain is a beta barrel or a coiled coil.
  • Item 36. The composition of any one of items 34-35, wherein the human protein domain is a CL, CH2, and/or CH3 domain.
  • Item 37. The composition of any one of items 34-35, wherein the human protein domain is a FN3 domain, beta-sandwich, Lipocalin, EETI-II/AGRP, Kunitz domain (BPTI), Thioredoxin, Protein A, Ankyrin, gamma-B-crystallin/ubiquitin, CTLD3/Tetranexin LDLR-A, human serum albumin, immunoglobulin CH2 domain, or camelid VHH domain
  • Item 38. The composition of any one of item 34-35 or 37, wherein the human protein domain is not a human immunoglobulin protein domain.
  • Item 39. The composition of any one of items 34-38, wherein the human protein domain displays the T-cell epitopes on its three-dimensional surface.
  • Item 40. The composition of any one of items 1-39, wherein the cleavage site is capable of being cleaved outside the unwanted cells.
  • Item 41. The composition of any one of items 1-40, wherein the enzyme expressed by the unwanted cells is a protease.
  • Item 42. The composition of any one of items 1-41, wherein the unwanted cells are cancer cells.
  • Item 43. A composition comprising a plurality of different TPECs of any one of items 1-42, wherein each targeting agent is conjugated to a plurality of identical T-cell epitopes.
  • Item 44. A composition comprising a plurality of compositions of any one of items 1-42, wherein at least some of the targeting agents in the composition are conjugated to a plurality of T-cell epitopes that are not identical.
  • Item 45. A composition comprising a plurality of compositions of item 44, wherein at least some of the compositions are not identical.
  • Item 46. A composition comprising a plurality of compositions of any one of items 43-45, wherein the composition comprises at least about 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, or more different TPECs.
  • Item 47. A pharmaceutical composition comprising a composition of any one of items 1-46 and a pharmaceutically acceptable carrier.
  • Item 48. A method of treating a disease in a patient characterized by the presence of unwanted cells comprising administering a composition of any one of items 1-47 to the patient.
  • Item 49. A method of retargeting an immune response of a patient to unwanted cells comprising administering a composition of any one of items 1-47 to the patient.
  • Item 50. The method of any of items 48-49, wherein the patient does not develop an immune response against the composition sufficient to inactivate the composition.
  • Item 51. The method of any one of items 48-50, wherein the patient receives multiple doses of the composition over at least 30, 45, 60, 75, 90, 120, 150, or more days or on an ongoing basis.
  • Item 52. The method of any one of items 48-50, wherein the patient receives multiple doses of the composition over at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or on an ongoing basis.
  • Item 53. The method of any one of items 48-52, wherein the composition can be administered to a patient in relapse who received the composition for an earlier round of therapy.
  • Item 54. The method of any one of items 48-53, wherein the patient has cancer.
  • EQUIVALENTS
  • The foregoing written specification is considered to be sufficient to enable one skilled in the art to practice the embodiments. The foregoing description and Examples detail certain embodiments and describes the best mode contemplated by the inventors. It will be appreciated, however, that no matter how detailed the foregoing may appear in text, the embodiment may be practiced in many ways and should be construed in accordance with the appended claims and any equivalents thereof.
  • As used herein, the term about refers to a numeric value, including, for example, whole numbers, fractions, and percentages, whether or not explicitly indicated. The term about generally refers to a range of numerical values (e.g., +/−5-10% of the recited range) that one of ordinary skill in the art would consider equivalent to the recited value (e.g., having the same function or result). When terms such as at least and about precede a list of numerical values or ranges, the terms modify all of the values or ranges provided in the list. In some instances, the term about may include numerical values that are rounded to the nearest significant figure.

Claims (21)

What is claimed is:
1. A method of treating cancer in a patient comprising administering a composition comprising a targeting moiety peptide epitope complex (TPEC) to the patient, wherein:
a. T is a targeting moiety that is an antibody or antigen-binding fragment thereof capable of targeting cancer cells;
b. L is at least one linker capable of linkage to T where L is a peptide bond or at least one peptide;
c. C is at least one cleavage site cleaved by an enzyme outside of the cancer cell and expressed by the cancer cell or cleaved by a protease that is outside of the cancer cell and colocalized to the cancer cell by a targeting moiety that is the same or different from the targeting moiety in the TPEC; and
d. E is at least one viral T-cell epitope that elicits an existing immune response in a human subject and binds to an HLA molecule on the surface of the cancer cells of the human subject and has an HLA matched to the subject, wherein the L, C, and E moieties are arranged in a pattern of at least one of L-(C-E)n, wherein n is an integer of at least 2 and with each C-E attached to the L in series.
2. The method of claim 1, wherein the method comprises retargeting an immune response of a patient to cancer cells.
3. The method of claim 2, wherein the composition comprises a plurality of more than 10 T-cell epitopes conjugated to the targeting moiety with at least one cleavage site, optionally wherein the plurality of T-cell epitopes are not all identical.
4. The method of claim 2, wherein at least one T-cell epitope is an MHC Class I restricted peptide or an MHC Class II restricted peptide.
5. The method of claim 2, wherein the plurality of T-cell epitopes are from about 7 to about 14 amino acids in length.
6. The method of claim 2, wherein the composition comprises at least about 2, 3, 4, 5, 6, 7, 8, 9, or 10 T cell epitopes.
7. The method of claim 2, wherein the T-cell epitopes are chosen from CMV, influenza, EBV, hepatitis, chicken pox, mumps, measles, rubella, polio, rotavirus, vaccinia, and yellow fever T-cell epitopes.
8. The method of claim 2, wherein the composition comprises T-cell epitopes from at least two different viruses.
9. The method of claim 2, wherein the T-cell epitopes are chosen from HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, HLA-G, CD1d, and MR1.
10. The method of claim 2, wherein the T-cell epitopes are chosen from HLA-A*01, HLA-A*02, HLA-A*03, HLA-A*11, HLA-B*44, HLA-B*07, HLA-B*08, HLA-B*15, HLA-B*35, HLA-B*40, HLA-C*07, HLA-C*03, HLA-C*05, HLA-C*04, HLA-C*06, and HLA-E*0101 restricted antigens.
11. The method of claim 2, wherein the composition comprises at least the following T-cell epitopes: HLA-A*02, HLA-A*01, and HLA-A*03.
12. The method of claim 2, wherein the T-cell epitopes comprise at least one of SEQ ID NOS: 1-2, 5-7, 15-57.
13. The method of claim 2, wherein the T-cell epitopes are flanked on one or both ends by at least one human protein domain.
14. The method of claim 2, wherein the enzyme expressed by the cancer cells is a protease.
15. The method of claim 2, wherein the antibody or antigen-binding fragment thereof is an anti-CEA or anti-CEACAM antibody or antigen-binding fragment thereof.
16. The method of claim 2, wherein the patient does not develop an immune response against the composition sufficient to inactivate the composition.
17. The method of claim 2, wherein the patient receives multiple doses of the composition over at least 30, 45, 60, 75, 90, 120, 150, or more days or on an ongoing basis.
18. The method of claim 2, wherein the patient receives multiple doses of the composition over at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months or on an ongoing basis.
19. The method of claim 2, wherein the composition can be administered to a patient in relapse who received the composition for an earlier round of therapy.
20. The method of claim 2, wherein the cancer is breast cancer, ovarian cancer, endometrial cancer, cervical cancer, bladder cancer, renal cancer, melanoma, lung cancer, prostate cancer, testicular cancer, thyroid cancer, brain cancer, esophageal cancer, gastric cancer, pancreatic cancer, colorectal cancer, liver cancer, leukemia, myeloma, nonHodgkin's lymphoma, Hodgkin's lymphoma, acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphoblastic leukemia, lymphoproliferative disorder, myelodysplastic disorder, myeloproliferative disease, or premalignant disease
21. The method of claim 2, wherein the composition is administered in conjunction with surgery, radiation, traditional chemotherapy, or an immunostimulatory agent.
US16/558,467 2015-02-02 2019-09-03 Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes Abandoned US20200016262A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/558,467 US20200016262A1 (en) 2015-02-02 2019-09-03 Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201562111069P 2015-02-02 2015-02-02
US15/012,115 US10441649B2 (en) 2015-02-02 2016-02-01 Targeting moiety peptide epitope complexes having a plurality of T-cell epitopes
US16/558,467 US20200016262A1 (en) 2015-02-02 2019-09-03 Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US15/012,115 Division US10441649B2 (en) 2015-02-02 2016-02-01 Targeting moiety peptide epitope complexes having a plurality of T-cell epitopes

Publications (1)

Publication Number Publication Date
US20200016262A1 true US20200016262A1 (en) 2020-01-16

Family

ID=55629091

Family Applications (2)

Application Number Title Priority Date Filing Date
US15/012,115 Expired - Fee Related US10441649B2 (en) 2015-02-02 2016-02-01 Targeting moiety peptide epitope complexes having a plurality of T-cell epitopes
US16/558,467 Abandoned US20200016262A1 (en) 2015-02-02 2019-09-03 Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US15/012,115 Expired - Fee Related US10441649B2 (en) 2015-02-02 2016-02-01 Targeting moiety peptide epitope complexes having a plurality of T-cell epitopes

Country Status (7)

Country Link
US (2) US10441649B2 (en)
EP (1) EP3253419A1 (en)
JP (2) JP2018508481A (en)
CN (1) CN107427590B (en)
AU (1) AU2016215604B2 (en)
CA (1) CA2971288A1 (en)
WO (1) WO2016126611A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113527443A (en) * 2020-04-16 2021-10-22 中国科学院微生物研究所 Influenza A virus PB1 protein T cell epitope polypeptide fragment and its application

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3031172A1 (en) * 2016-07-18 2018-01-25 The Council Of The Queensland Institute Of Medical Research Multivirus-specific t cell immunotherapy
EP3661550A4 (en) * 2017-08-03 2021-08-04 Regents of the University of Minnesota ACTIVATION OF RESIDENT MEMORY T-CELLS FOR TREATMENT OF CANCER
US11673961B2 (en) * 2018-02-20 2023-06-13 Memorial Sloan Kettering Cancer Center Anti-CD20 antibody and uses thereof
KR102552440B1 (en) * 2019-02-08 2023-07-11 주식회사 굳티셀 A Method for activating T cells to treat cancer
US20230076637A1 (en) 2020-02-06 2023-03-09 Ajou University Industry-Academic Cooperation Foundation Fusion antibody for presenting antigen-derived t cell antigen epitope or peptide containing same on cell surface, and composition comprising same
CN113234145A (en) * 2020-08-12 2021-08-10 中山大学附属第五医院 Antibodies that specifically bind to novel coronaviruses
EP4308242A1 (en) * 2021-03-17 2024-01-24 Molecular Templates, Inc. Pd-l1 binding proteins comprising shiga toxin a subunit scaffolds and cd8+ t cell antigens

Family Cites Families (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3578568A (en) 1968-11-29 1971-05-11 Atlantic Richfield Co Purification of low molecular weight epoxides by extractive distillation with a glycol or glycol ether
US5229490A (en) * 1987-05-06 1993-07-20 The Rockefeller University Multiple antigen peptide system
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
CA2047244C (en) 1989-02-24 2002-09-17 Zanetti Maurizio Genetically engineered immunoglobulins
US5969109A (en) 1990-02-28 1999-10-19 Bona; Constantin Chimeric antibodies comprising antigen binding sites and B and T cell epitopes
WO1991014438A1 (en) 1990-03-20 1991-10-03 The Trustees Of Columbia University In The City Of New York Chimeric antibodies with receptor binding ligands in place of their constant region
GB9014932D0 (en) 1990-07-05 1990-08-22 Celltech Ltd Recombinant dna product and method
EP0659438A1 (en) 1993-12-23 1995-06-28 Boehringer Mannheim Gmbh Conjugates consisting of peptidic T cell antigens and cell binding groups, and their use for therapy
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5698679A (en) 1994-09-19 1997-12-16 National Jewish Center For Immunology And Respiratory Medicine Product and process for targeting an immune response
JP4212111B2 (en) 1995-05-03 2009-01-21 バイオエンハンスメンツ リミテッド Bispecific antibodies whose binding ability is reversibly inhibited by photocleavable molecules
AU721927B2 (en) 1995-12-22 2000-07-20 Immunomedics Inc. Use of immunoconjugates to enhance the efficacy of multi-stage cascade boosting vaccines
AU715632B2 (en) 1996-09-12 2000-02-03 Merck & Co., Inc. Conjugates useful in the treatment of prostate cancer
HRP970566A2 (en) 1996-10-30 1998-08-31 Jones Deborah Defeo Conjugates useful in the treatment of prostate canser
GB9624993D0 (en) 1996-11-30 1997-01-15 Aepact Ltd Tumour therapy
US20070218053A1 (en) 1997-01-07 2007-09-20 Habib Zaghouani Coupling of peripheral tolerance to endogenous il-10 promotes effective modulation of t cells and ameliorates autoimmune disease
US6737057B1 (en) 1997-01-07 2004-05-18 The University Of Tennessee Research Corporation Compounds, compositions and methods for the endocytic presentation of immunosuppressive factors
US20020081298A1 (en) 1997-01-07 2002-06-27 Habib Zaghouani Compounds, compositions and methods for the endocytic presentation of immunosuppressive factors
US20090280132A1 (en) 1997-01-07 2009-11-12 Habib Zaghouani Coupling of peripheral tolerance to endogenous il-10 promotes effective modulation of t cells and ameliorates autoimmune disease
WO1998041641A1 (en) 1997-03-20 1998-09-24 The Government Of The United States As Represented By The Secretary Of The Department Of Health And Human Services Recombinant antibodies and immunoconjugates targeted to cd-22 bearing cells and tumors
AU740597B2 (en) 1997-07-10 2001-11-08 Merck & Co., Inc. Conjugates useful in the treatment of prostate cancer
US7279462B1 (en) 1998-04-27 2007-10-09 Nevagen Llc Somatic transgene immunization and related methods
DE69911793T2 (en) 1998-07-28 2004-08-12 Micromet Ag HETERO MINI BODY
AU2001265417A1 (en) 2000-06-05 2002-04-08 University Of Tennessee Corporation Compositions and methods for the endocytic presentation of immunosuppressive factors
AU2002223350A1 (en) 2000-12-01 2002-06-11 Eleanor N. Fish Cytokine receptor binding peptides
DE60136656D1 (en) 2000-12-05 2009-01-02 Alexion Pharma Inc Rationally designed antibodies
GB0102145D0 (en) 2001-01-26 2001-03-14 Scancell Ltd Substances
AUPR593101A0 (en) * 2001-06-26 2001-07-19 Council Of The Queensland Institute Of Medical Research, The Cytomegalovirus t cell epitopes
MY144532A (en) * 2001-08-20 2011-09-30 Lundbeck & Co As H Novel method for down-regulation of amyloid
ATE468348T1 (en) 2001-09-26 2010-06-15 Government Of The Us Secretary MUTATED ANTI-CD22 ANTIBODIES WITH INCREASED AFFINITY FOR CD22-EXPRESSING LEUKEMIA CELLS
AU2002363861A1 (en) 2001-11-30 2003-06-10 Crucell Holland B.V. Antigen presenting cell targeting conjugate, an intigen presenting cell contacted with such conjugate, their use for vaccination or as medicament, and methods for their production or generation
CN101914158A (en) 2002-02-14 2010-12-15 免疫医疗公司 Anti-cd20 antibodies and fusion proteins thereof and methods of use
EP2258712A3 (en) 2002-03-15 2011-05-04 Multicell Immunotherapeutics, Inc. Compositions and Methods to Initiate or Enhance Antibody and Major-histocompatibility Class I or Class II-restricted T Cell Responses by Using Immunomodulatory, Non-coding RNA Motifs
US8029803B2 (en) 2002-06-20 2011-10-04 Paladin Labs, Inc. Chimeric antigens for eliciting an immune response
US7247303B2 (en) * 2002-07-15 2007-07-24 Board Of Regents, The University Of Texas System Selected antibody CDRs for binding to aminophospholipids
PT2357006E (en) 2002-07-31 2016-01-22 Seattle Genetics Inc Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease
AU2003265866A1 (en) * 2002-09-03 2004-03-29 Vit Lauermann Targeted release
CA2501757C (en) 2002-10-08 2012-04-24 Immunomedics, Inc. Combination therapy with class iii anti-cea monoclonal antibodies and therapeutic agents
CA2504818C (en) 2002-11-07 2013-04-23 Immunogen, Inc. Anti-cd33 antibodies and method for treatment of acute myeloid leukemia using the same
CN1756768A (en) 2003-02-06 2006-04-05 麦克罗梅特股份公司 Trimeric polypeptide construct to induce an enduring t cell response
US20050048550A1 (en) 2003-07-30 2005-03-03 University Of Pittsburgh-Of The Commonwealth System Of Higher Education EphA2 T-cell epitope agonists and uses therefor
US8007805B2 (en) 2003-08-08 2011-08-30 Paladin Labs, Inc. Chimeric antigens for breaking host tolerance to foreign antigens
JP5097400B2 (en) * 2003-09-03 2012-12-12 デンドリセラピューティクス、インク. Combined vaccine
CA2544532C (en) 2003-11-28 2015-06-16 Micromet Ag Compositions comprising polypeptides
US7235641B2 (en) 2003-12-22 2007-06-26 Micromet Ag Bispecific antibodies
WO2005082003A2 (en) 2004-02-24 2005-09-09 Alexion Pharmaceuticals, Inc. Peptides and uses thereof
WO2005082004A2 (en) 2004-02-24 2005-09-09 Alexion Pharmaceuticals, Inc. Rationally designed antibodies having a domain-exchanged scaffold
GB0404187D0 (en) 2004-02-25 2004-03-31 Biotransformations Ltd Binding agents
US7273608B2 (en) 2004-03-11 2007-09-25 City Of Hope Humanized anti-CEA T84.66 antibody and uses thereof
US20060045881A1 (en) 2004-08-26 2006-03-02 Board Of Regents, The University Of Texas System Anti-cancer vaccines
RU2007108716A (en) 2004-09-10 2008-10-20 Вайет (Us) HUMANIZED ANTIBODIES TO 5T4 ANTIGEN AND CONJUGATES OF THE HUMANIZED ANTIBODIES TO 5T4 ANTIGEN WITH KALIHEAMICIN
CA2597638A1 (en) 2005-02-16 2006-08-24 University Of Zuerich Methods for treating cancer using an immunotoxin comprising an exotoxin a moiety having a furin cleavage site replaced with a cancer-associated protease site cleaved by mmp-2 or mmp-9
US20060286604A1 (en) * 2005-04-07 2006-12-21 The University Of Iowa Research Foundation Lectin binding to choroidal neovascularization
WO2007022477A2 (en) 2005-08-17 2007-02-22 Multicell Immunotherapeutics, Inc. Methods and compositions to generate and control the effector profile of t cells
US20090238822A1 (en) 2005-10-13 2009-09-24 Virexx Medical Corp. Chimeric Hepatitis C Virus Antigens For Eliciting an Immune Response
US20100184651A1 (en) 2005-11-18 2010-07-22 Dabur Pharma Limited Targeted fusion proteins for cancer therapy
GB0605702D0 (en) 2006-03-21 2006-05-03 Biotransformations Ltd Materials and methods for immune cell stimulation
WO2008019366A2 (en) 2006-08-07 2008-02-14 Ludwig Institute For Cancer Research Methods and compositions for increased priming of t-cells through cross-presentation of exogenous antigens
EP2079840A4 (en) 2006-10-30 2010-06-30 Viventia Biotech Inc Immunotox n fusions comprising an antibody fragment and a plant toxin linked by protease cleavable linkers
WO2008063113A1 (en) 2006-11-20 2008-05-29 Cepep Iii Ab Cell -penetrating peptides and constructs containing them consisting 15-25 amino acids of tumor supressor protein p14arf or p19arf
EP2423220B1 (en) 2007-01-30 2015-04-29 Epivax, Inc. Regulatory t cell epitopes, compositions and uses thereof
EP2527363A1 (en) 2007-02-02 2012-11-28 Baylor Research Institute Vaccines based on targeting antigen to dcir expressed on antigen-presenting cells
GB0706070D0 (en) 2007-03-28 2007-05-09 Scancell Ltd Nucleic acids
AU2008257792B2 (en) * 2007-05-31 2013-08-29 Isa Pharmaceuticals B.V. HPV epitopes targeted by T cells infiltrating cervical malignancies for use in vaccines
GB0716160D0 (en) 2007-08-17 2007-09-26 Biotransformations Ltd Materials and methods for treating cancers which express folate receptors
CA3128656A1 (en) 2007-08-22 2009-02-26 The Regents Of The University Of California Activatable binding polypeptides and methods of identification and use thereof
AU2009213141A1 (en) * 2008-02-14 2009-08-20 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
CN101362795B (en) * 2008-09-11 2011-06-01 中国人民解放军第三军医大学 Epitope of epididymal protease inhibitor B cell and antigen peptides containing thereof
WO2010037837A2 (en) 2008-10-01 2010-04-08 Micromet Ag Bispecific single chain antibodies with specificity for high molecular weight target antigens
JP5851842B2 (en) 2009-01-12 2016-02-03 サイトムエックス セラピューティクス, インク.CytomX Therapeutics, Inc. Modified antibody composition and methods of making and using the same
CN108373509A (en) 2009-03-10 2018-08-07 贝勒研究院 The antiviral vaccine of target antigen presenting cells
EA201592264A1 (en) * 2009-08-26 2016-08-31 Селекта Байосайенсиз, Инк. COMPOSITIONS WHICH INDUCE T-CELL HELPER EFFECT
IN2012DN02692A (en) 2009-11-05 2015-09-04 Ct Molecular Med & Immunology
WO2011110953A2 (en) * 2010-03-09 2011-09-15 Artemev, Timur Polyepitope constructs and methods for their preparation and use
BR112013013960A8 (en) * 2010-12-06 2017-12-05 Univ Heidelberg Ruprecht Karls COMPOSI%C3%87%C3%95ES OF MAL%C3%81RIA VACCINES, POLYPEPT%C3%8DDEOS, FRAGMENTS THEREOF, MOL%C3%89NUCLEIC ACID%C3%89CELLS, AND USES THEREOF
DK3138581T3 (en) 2011-03-17 2019-04-15 Univ Birmingham REDIRECTED IMMUNTERY
WO2013054320A1 (en) 2011-10-11 2013-04-18 Tel Hashomer Medical Research Infrastructure And Services Ltd. Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam)
US9556271B2 (en) 2011-12-01 2017-01-31 The Brigham And Women's Hospital, Inc. Anti-CEACAM1 recombinant antibodies for cancer therapy
GB201203442D0 (en) 2012-02-28 2012-04-11 Univ Birmingham Immunotherapeutic molecules and uses
CN104168918A (en) 2012-03-19 2014-11-26 德国癌症研究中心 B-cell receptor complex binding proteins containing T-cell epitopes
WO2014043523A1 (en) * 2012-09-14 2014-03-20 The Johns Hopkins University Compositions and methods for rendering tumor cells susceptible to cd8+ t cell-mediated killing

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113527443A (en) * 2020-04-16 2021-10-22 中国科学院微生物研究所 Influenza A virus PB1 protein T cell epitope polypeptide fragment and its application

Also Published As

Publication number Publication date
CN107427590B (en) 2021-08-31
EP3253419A1 (en) 2017-12-13
CN107427590A (en) 2017-12-01
JP2021176877A (en) 2021-11-11
WO2016126611A1 (en) 2016-08-11
AU2016215604B2 (en) 2020-08-13
US10441649B2 (en) 2019-10-15
AU2016215604A1 (en) 2017-06-29
WO2016126611A4 (en) 2016-09-15
US20160220665A1 (en) 2016-08-04
JP2018508481A (en) 2018-03-29
CA2971288A1 (en) 2016-08-11

Similar Documents

Publication Publication Date Title
US20200016262A1 (en) Targeting Moiety Peptide Epitope Complexes Having a Plurality of T-Cell Epitopes
US7833532B2 (en) Immunogenic lipopeptides comprising T-helper and cytotoxic T lymphocyte (CTL) epitopes
ES2890230T3 (en) HIV vaccine based on maximized Gag and Nef targeting to dendritic cells
JP3872813B2 (en) Heterodimeric polypeptide immunogenic carrier compositions and methods
CA2793087C (en) Peptides, conjugates and method for increasing immunogenicity of a vaccine
US20070066534A1 (en) Novel immunogenic lipopeptides comprising t-helper and b-cell epitopes
Zeng et al. A modular approach to assembly of totally synthetic self-adjuvanting lipopeptide-based vaccines allows conformational epitope building
KR20140038364A (en) Monomeric and multimeric immunogenic peptides
KR102077876B1 (en) Immunogenic compounds comprising hiv gp41 peptide coupled to crm197 carrier protein
AU2019351458A1 (en) Immunity-inducing agent comprising antigen peptide-adjuvant nucleotide conjugate and pharmaceutical composition comprising same
US7264965B2 (en) Method for producing or enhancing a T-cell response against a target cell using a complex comprising an HLA class I molecule and an attaching means
Brumeanu et al. Derivatization with monomethoxypolyethylene glycol of Igs expressing viral epitopes obviates adjuvant requirements.
Nicoli et al. ORCA–Online Research@ Cardiff
AU2006202423A1 (en) Immunogenic Lipopeptides
Jackson et al. Lipopeptide-Based Vaccines

Legal Events

Date Code Title Description
AS Assignment

Owner name: THE UNIVERSITY OF BIRMINGHAM, UNITED KINGDOM

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:COBBOLD, MARK;MILLAR, DAVID;REEL/FRAME:050641/0484

Effective date: 20160212

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION