US20190030147A1 - Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines - Google Patents
Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines Download PDFInfo
- Publication number
- US20190030147A1 US20190030147A1 US16/108,739 US201816108739A US2019030147A1 US 20190030147 A1 US20190030147 A1 US 20190030147A1 US 201816108739 A US201816108739 A US 201816108739A US 2019030147 A1 US2019030147 A1 US 2019030147A1
- Authority
- US
- United States
- Prior art keywords
- fusion
- specific
- cancer
- peptides
- patient
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 230000004927 fusion Effects 0.000 title claims abstract description 601
- 229960005486 vaccine Drugs 0.000 title claims abstract description 304
- 238000000034 method Methods 0.000 title claims abstract description 183
- 229940022511 therapeutic cancer vaccine Drugs 0.000 title description 9
- 238000010276 construction Methods 0.000 title description 7
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 276
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 194
- 201000011510 cancer Diseases 0.000 claims abstract description 159
- 230000001225 therapeutic effect Effects 0.000 claims abstract description 46
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 407
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 279
- 108700028369 Alleles Proteins 0.000 claims description 82
- 150000001413 amino acids Chemical class 0.000 claims description 74
- 108020004414 DNA Proteins 0.000 claims description 26
- 239000012472 biological sample Substances 0.000 claims description 21
- 239000000523 sample Substances 0.000 claims description 21
- 239000002671 adjuvant Substances 0.000 claims description 17
- 238000003559 RNA-seq method Methods 0.000 claims description 15
- 230000004048 modification Effects 0.000 claims description 14
- 238000012986 modification Methods 0.000 claims description 14
- 210000000612 antigen-presenting cell Anatomy 0.000 claims description 13
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 12
- 210000001519 tissue Anatomy 0.000 claims description 12
- 230000003993 interaction Effects 0.000 claims description 11
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 9
- 238000004458 analytical method Methods 0.000 claims description 9
- 150000007523 nucleic acids Chemical group 0.000 claims description 9
- 206010060862 Prostate cancer Diseases 0.000 claims description 8
- 210000004443 dendritic cell Anatomy 0.000 claims description 8
- 201000001441 melanoma Diseases 0.000 claims description 7
- 206010006187 Breast cancer Diseases 0.000 claims description 6
- 208000026310 Breast neoplasm Diseases 0.000 claims description 6
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 6
- 206010039491 Sarcoma Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 6
- 201000005202 lung cancer Diseases 0.000 claims description 6
- 208000020816 lung neoplasm Diseases 0.000 claims description 6
- 208000014653 solitary fibrous tumor Diseases 0.000 claims description 6
- 206010005003 Bladder cancer Diseases 0.000 claims description 5
- 206010009944 Colon cancer Diseases 0.000 claims description 5
- 206010035226 Plasma cell myeloma Diseases 0.000 claims description 5
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 5
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 5
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 5
- 206010017758 gastric cancer Diseases 0.000 claims description 5
- 201000011549 stomach cancer Diseases 0.000 claims description 5
- 201000002510 thyroid cancer Diseases 0.000 claims description 5
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 5
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 4
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 4
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 4
- 208000032612 Glial tumor Diseases 0.000 claims description 4
- 206010018338 Glioma Diseases 0.000 claims description 4
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 4
- 206010025323 Lymphomas Diseases 0.000 claims description 4
- 206010033128 Ovarian cancer Diseases 0.000 claims description 4
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 4
- 206010038389 Renal cancer Diseases 0.000 claims description 4
- 208000000453 Skin Neoplasms Diseases 0.000 claims description 4
- 208000024313 Testicular Neoplasms Diseases 0.000 claims description 4
- 206010057644 Testis cancer Diseases 0.000 claims description 4
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 4
- 201000010881 cervical cancer Diseases 0.000 claims description 4
- 239000012530 fluid Substances 0.000 claims description 4
- 208000005017 glioblastoma Diseases 0.000 claims description 4
- 201000010536 head and neck cancer Diseases 0.000 claims description 4
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 4
- 201000010982 kidney cancer Diseases 0.000 claims description 4
- 208000032839 leukemia Diseases 0.000 claims description 4
- 201000007270 liver cancer Diseases 0.000 claims description 4
- 208000014018 liver neoplasm Diseases 0.000 claims description 4
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 4
- 201000000050 myeloid neoplasm Diseases 0.000 claims description 4
- 201000002528 pancreatic cancer Diseases 0.000 claims description 4
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 4
- 201000000849 skin cancer Diseases 0.000 claims description 4
- 201000003120 testicular cancer Diseases 0.000 claims description 4
- 238000001712 DNA sequencing Methods 0.000 claims description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 2
- 206010061289 metastatic neoplasm Diseases 0.000 claims description 2
- 238000000734 protein sequencing Methods 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 7
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 71
- 108010075704 HLA-A Antigens Proteins 0.000 description 71
- 239000000203 mixture Substances 0.000 description 66
- 235000018102 proteins Nutrition 0.000 description 58
- 102000004169 proteins and genes Human genes 0.000 description 58
- 102100028976 HLA class I histocompatibility antigen, B alpha chain Human genes 0.000 description 56
- 108010058607 HLA-B Antigens Proteins 0.000 description 56
- 229940024606 amino acid Drugs 0.000 description 48
- 235000001014 amino acid Nutrition 0.000 description 48
- 238000011282 treatment Methods 0.000 description 38
- 102000004229 RNA-binding protein EWS Human genes 0.000 description 30
- 108020001507 fusion proteins Proteins 0.000 description 30
- 102000037865 fusion proteins Human genes 0.000 description 30
- 230000035772 mutation Effects 0.000 description 30
- 108090000740 RNA-binding protein EWS Proteins 0.000 description 29
- 238000002255 vaccination Methods 0.000 description 27
- 239000003795 chemical substances by application Substances 0.000 description 24
- 102000003890 RNA-binding protein FUS Human genes 0.000 description 23
- 108090000292 RNA-binding protein FUS Proteins 0.000 description 23
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 22
- 238000004422 calculation algorithm Methods 0.000 description 21
- 102100029145 DNA damage-inducible transcript 3 protein Human genes 0.000 description 18
- 108010057666 Transcription Factor CHOP Proteins 0.000 description 18
- 201000010099 disease Diseases 0.000 description 18
- 238000003860 storage Methods 0.000 description 18
- 101000823316 Homo sapiens Tyrosine-protein kinase ABL1 Proteins 0.000 description 17
- 102100029983 Transcriptional regulator ERG Human genes 0.000 description 17
- 210000004027 cell Anatomy 0.000 description 17
- 239000008194 pharmaceutical composition Substances 0.000 description 17
- 230000000306 recurrent effect Effects 0.000 description 17
- 238000002560 therapeutic procedure Methods 0.000 description 17
- 241000699670 Mus sp. Species 0.000 description 16
- 108091007433 antigens Proteins 0.000 description 16
- 102000036639 antigens Human genes 0.000 description 16
- 230000000670 limiting effect Effects 0.000 description 16
- 229920001184 polypeptide Polymers 0.000 description 16
- 102210048100 A*31:01 Human genes 0.000 description 15
- 102100028971 HLA class I histocompatibility antigen, C alpha chain Human genes 0.000 description 15
- 108010052199 HLA-C Antigens Proteins 0.000 description 15
- 101000984753 Homo sapiens Serine/threonine-protein kinase B-raf Proteins 0.000 description 15
- 102000043129 MHC class I family Human genes 0.000 description 15
- 108091054437 MHC class I family Proteins 0.000 description 15
- 102100027103 Serine/threonine-protein kinase B-raf Human genes 0.000 description 15
- 238000001514 detection method Methods 0.000 description 15
- 102100022596 Tyrosine-protein kinase ABL1 Human genes 0.000 description 14
- 239000000427 antigen Substances 0.000 description 14
- 229940023041 peptide vaccine Drugs 0.000 description 14
- 238000012070 whole genome sequencing analysis Methods 0.000 description 14
- 238000004891 communication Methods 0.000 description 13
- 239000000243 solution Substances 0.000 description 13
- 108010020515 HLA-A*68 antigen Proteins 0.000 description 12
- 108700039143 HMGA2 Proteins 0.000 description 12
- 102100028999 High mobility group protein HMGI-C Human genes 0.000 description 12
- 101150073387 Hmga2 gene Proteins 0.000 description 12
- 101000686031 Homo sapiens Proto-oncogene tyrosine-protein kinase ROS Proteins 0.000 description 12
- 102100023347 Proto-oncogene tyrosine-protein kinase ROS Human genes 0.000 description 12
- 239000002246 antineoplastic agent Substances 0.000 description 12
- 238000013459 approach Methods 0.000 description 12
- 239000000463 material Substances 0.000 description 12
- 238000012163 sequencing technique Methods 0.000 description 12
- 102210047471 B*44:02 Human genes 0.000 description 11
- 102100030334 Friend leukemia integration 1 transcription factor Human genes 0.000 description 11
- 101001062996 Homo sapiens Friend leukemia integration 1 transcription factor Proteins 0.000 description 11
- -1 at least 2 Chemical class 0.000 description 11
- 239000003814 drug Substances 0.000 description 11
- 108020004999 messenger RNA Proteins 0.000 description 11
- 230000008569 process Effects 0.000 description 11
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 10
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 10
- 102210024055 HLA-C*03:03 Human genes 0.000 description 10
- 101000893493 Homo sapiens Protein flightless-1 homolog Proteins 0.000 description 10
- 238000011161 development Methods 0.000 description 10
- 230000028993 immune response Effects 0.000 description 10
- 239000000546 pharmaceutical excipient Substances 0.000 description 10
- 229940124597 therapeutic agent Drugs 0.000 description 10
- 102210042961 A*03:01 Human genes 0.000 description 9
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 9
- 239000000969 carrier Substances 0.000 description 9
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 9
- 230000018109 developmental process Effects 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 208000024891 symptom Diseases 0.000 description 9
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 8
- 101000813738 Homo sapiens Transcription factor ETV6 Proteins 0.000 description 8
- 101000638154 Homo sapiens Transmembrane protease serine 2 Proteins 0.000 description 8
- 102100039580 Transcription factor ETV6 Human genes 0.000 description 8
- 102100031989 Transmembrane protease serine 2 Human genes 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 8
- 238000001574 biopsy Methods 0.000 description 8
- 229940022399 cancer vaccine Drugs 0.000 description 8
- 201000003444 follicular lymphoma Diseases 0.000 description 8
- 101150101373 fus gene Proteins 0.000 description 8
- 238000012216 screening Methods 0.000 description 8
- 102210047283 C*07:01 Human genes 0.000 description 7
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 7
- 102220404671 HLA-A*11:01 Human genes 0.000 description 7
- 102210024051 HLA-B*15:01 Human genes 0.000 description 7
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 7
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 7
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 7
- JJWKPURADFRFRB-UHFFFAOYSA-N carbonyl sulfide Chemical compound O=C=S JJWKPURADFRFRB-UHFFFAOYSA-N 0.000 description 7
- 239000000839 emulsion Substances 0.000 description 7
- 239000012634 fragment Substances 0.000 description 7
- 230000037433 frameshift Effects 0.000 description 7
- 210000000987 immune system Anatomy 0.000 description 7
- 230000002163 immunogen Effects 0.000 description 7
- 238000000126 in silico method Methods 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- 102210047222 A*33:01 Human genes 0.000 description 6
- 102210047597 C*06:02 Human genes 0.000 description 6
- 102210042925 HLA-A*02:01 Human genes 0.000 description 6
- 102210024049 HLA-A*03:01 Human genes 0.000 description 6
- 101000613490 Homo sapiens Paired box protein Pax-3 Proteins 0.000 description 6
- 101000837845 Homo sapiens Transcription factor E3 Proteins 0.000 description 6
- 102100040891 Paired box protein Pax-3 Human genes 0.000 description 6
- 102100028507 Transcription factor E3 Human genes 0.000 description 6
- 238000009566 cancer vaccine Methods 0.000 description 6
- 238000002648 combination therapy Methods 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 238000009169 immunotherapy Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 238000004949 mass spectrometry Methods 0.000 description 6
- 150000003839 salts Chemical class 0.000 description 6
- 239000003826 tablet Substances 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 102210047469 A*02:01 Human genes 0.000 description 5
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 5
- 102210047218 B*07:02 Human genes 0.000 description 5
- 108010021727 HLA-A*24:02 antigen Proteins 0.000 description 5
- 102210041563 HLA-A*31:01 Human genes 0.000 description 5
- 102220404670 HLA-A*33:01 Human genes 0.000 description 5
- 108010034115 HLA-A29 antigen Proteins 0.000 description 5
- 102100035108 High affinity nerve growth factor receptor Human genes 0.000 description 5
- 101000596894 Homo sapiens High affinity nerve growth factor receptor Proteins 0.000 description 5
- 102100029166 NT-3 growth factor receptor Human genes 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 229960004679 doxorubicin Drugs 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 238000001914 filtration Methods 0.000 description 5
- 238000001415 gene therapy Methods 0.000 description 5
- 238000003205 genotyping method Methods 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 108010064892 trkC Receptor Proteins 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- 102210047473 B*57:01 Human genes 0.000 description 4
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 102100035427 Forkhead box protein O1 Human genes 0.000 description 4
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 4
- 102210009883 HLA-B*07:02 Human genes 0.000 description 4
- 102210039566 HLA-B*39:01 Human genes 0.000 description 4
- 101000575639 Homo sapiens Ribonucleoside-diphosphate reductase subunit M2 Proteins 0.000 description 4
- 101000850794 Homo sapiens Tropomyosin alpha-3 chain Proteins 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 230000005867 T cell response Effects 0.000 description 4
- 102100033080 Tropomyosin alpha-3 chain Human genes 0.000 description 4
- 239000013543 active substance Substances 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 4
- 230000005975 antitumor immune response Effects 0.000 description 4
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 4
- 238000000205 computational method Methods 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 239000002552 dosage form Substances 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 231100000221 frame shift mutation induction Toxicity 0.000 description 4
- 230000005847 immunogenicity Effects 0.000 description 4
- 238000001802 infusion Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 230000015654 memory Effects 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 239000006187 pill Substances 0.000 description 4
- 102000040430 polynucleotide Human genes 0.000 description 4
- 108091033319 polynucleotide Proteins 0.000 description 4
- 239000002157 polynucleotide Substances 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000003449 preventive effect Effects 0.000 description 4
- 238000001959 radiotherapy Methods 0.000 description 4
- 230000008707 rearrangement Effects 0.000 description 4
- 238000007920 subcutaneous administration Methods 0.000 description 4
- 230000008093 supporting effect Effects 0.000 description 4
- 239000000725 suspension Substances 0.000 description 4
- 230000005945 translocation Effects 0.000 description 4
- 230000005740 tumor formation Effects 0.000 description 4
- 230000004614 tumor growth Effects 0.000 description 4
- 238000010200 validation analysis Methods 0.000 description 4
- 230000003612 virological effect Effects 0.000 description 4
- 108010080691 Alcohol O-acetyltransferase Proteins 0.000 description 3
- 102210048102 B*08:01 Human genes 0.000 description 3
- 102210048103 B*18:01 Human genes 0.000 description 3
- 102210048104 B*27:05 Human genes 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 102210047220 C*07:02 Human genes 0.000 description 3
- ZEOWTGPWHLSLOG-UHFFFAOYSA-N Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F Chemical compound Cc1ccc(cc1-c1ccc2c(n[nH]c2c1)-c1cnn(c1)C1CC1)C(=O)Nc1cccc(c1)C(F)(F)F ZEOWTGPWHLSLOG-UHFFFAOYSA-N 0.000 description 3
- 102100033934 DNA repair protein RAD51 homolog 2 Human genes 0.000 description 3
- 102100039563 ETS translocation variant 1 Human genes 0.000 description 3
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 3
- 101710182386 Fibroblast growth factor receptor 1 Proteins 0.000 description 3
- 108010009306 Forkhead Box Protein O1 Proteins 0.000 description 3
- 102100033295 Glial cell line-derived neurotrophic factor Human genes 0.000 description 3
- 102100029966 HLA class II histocompatibility antigen, DP alpha 1 chain Human genes 0.000 description 3
- 102210042926 HLA-B*44:02 Human genes 0.000 description 3
- 102210024052 HLA-B*57:01 Human genes 0.000 description 3
- 102210009879 HLA-C*06:02 Human genes 0.000 description 3
- 102210009881 HLA-C*07:01 Human genes 0.000 description 3
- 101000813729 Homo sapiens ETS translocation variant 1 Proteins 0.000 description 3
- 101001064542 Homo sapiens Liprin-beta-1 Proteins 0.000 description 3
- 101000581507 Homo sapiens Methyl-CpG-binding domain protein 1 Proteins 0.000 description 3
- 101001109689 Homo sapiens Nuclear receptor subfamily 4 group A member 3 Proteins 0.000 description 3
- 101001071233 Homo sapiens PHD finger protein 1 Proteins 0.000 description 3
- 101001134861 Homo sapiens Pericentriolar material 1 protein Proteins 0.000 description 3
- 101000883798 Homo sapiens Probable ATP-dependent RNA helicase DDX53 Proteins 0.000 description 3
- 101000880769 Homo sapiens Protein SSX1 Proteins 0.000 description 3
- 101000691578 Homo sapiens Zinc finger protein PLAG1 Proteins 0.000 description 3
- 102100031961 Liprin-beta-1 Human genes 0.000 description 3
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 3
- 102100027383 Methyl-CpG-binding domain protein 1 Human genes 0.000 description 3
- 101100366887 Mus musculus Stat6 gene Proteins 0.000 description 3
- 101150052527 Nab2 gene Proteins 0.000 description 3
- 102100022673 Nuclear receptor subfamily 4 group A member 3 Human genes 0.000 description 3
- 102100036879 PHD finger protein 1 Human genes 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 102100038236 Probable ATP-dependent RNA helicase DDX53 Human genes 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 102100037687 Protein SSX1 Human genes 0.000 description 3
- 101710018890 RAD51B Proteins 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 102100026200 Zinc finger protein PLAG1 Human genes 0.000 description 3
- 238000011374 additional therapy Methods 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 210000000481 breast Anatomy 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 101150029652 fli-1 gene Proteins 0.000 description 3
- 238000001476 gene delivery Methods 0.000 description 3
- 238000012252 genetic analysis Methods 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 239000004615 ingredient Substances 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 229940038309 personalized vaccine Drugs 0.000 description 3
- 150000003904 phospholipids Chemical class 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000004094 surface-active agent Substances 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 238000013268 sustained release Methods 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- QYAPHLRPFNSDNH-MRFRVZCGSA-N (4s,4as,5as,6s,12ar)-7-chloro-4-(dimethylamino)-1,6,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4,4a,5,5a-tetrahydrotetracene-2-carboxamide;hydrochloride Chemical compound Cl.C1=CC(Cl)=C2[C@](O)(C)[C@H]3C[C@H]4[C@H](N(C)C)C(=O)C(C(N)=O)=C(O)[C@@]4(O)C(=O)C3=C(O)C2=C1O QYAPHLRPFNSDNH-MRFRVZCGSA-N 0.000 description 2
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 2
- 102100025007 14-3-3 protein epsilon Human genes 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- 102100022528 5'-AMP-activated protein kinase catalytic subunit alpha-1 Human genes 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- 102210048101 A*01:01 Human genes 0.000 description 2
- 102100040084 A-kinase anchor protein 9 Human genes 0.000 description 2
- 102100034540 Adenomatous polyposis coli protein Human genes 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 102100037586 B-cell receptor-associated protein 29 Human genes 0.000 description 2
- 102100035080 BDNF/NT-3 growth factors receptor Human genes 0.000 description 2
- 101150049556 Bcr gene Proteins 0.000 description 2
- 102100037674 Bis(5'-adenosyl)-triphosphatase Human genes 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 210000004366 CD4-positive T-lymphocyte Anatomy 0.000 description 2
- 241000282472 Canis lupus familiaris Species 0.000 description 2
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 2
- 102100026127 Clathrin heavy chain 1 Human genes 0.000 description 2
- 102100023774 Cold-inducible RNA-binding protein Human genes 0.000 description 2
- 102100033601 Collagen alpha-1(I) chain Human genes 0.000 description 2
- 102100039299 Cyclic AMP-responsive element-binding protein 3-like protein 2 Human genes 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 101150112524 EWSR1 gene Proteins 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 2
- 101710182396 Fibroblast growth factor receptor 3 Proteins 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- 102100030708 GTPase KRas Human genes 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102100041032 Golgin subfamily A member 5 Human genes 0.000 description 2
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 102100036242 HLA class II histocompatibility antigen, DQ alpha 2 chain Human genes 0.000 description 2
- 102210009880 HLA-B*27:05 Human genes 0.000 description 2
- 108010050568 HLA-DM antigens Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000760079 Homo sapiens 14-3-3 protein epsilon Proteins 0.000 description 2
- 101000677993 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-1 Proteins 0.000 description 2
- 101000890598 Homo sapiens A-kinase anchor protein 9 Proteins 0.000 description 2
- 101100268646 Homo sapiens ABL1 gene Proteins 0.000 description 2
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 2
- 101000740057 Homo sapiens B-cell receptor-associated protein 29 Proteins 0.000 description 2
- 101000596896 Homo sapiens BDNF/NT-3 growth factors receptor Proteins 0.000 description 2
- 101000912851 Homo sapiens Clathrin heavy chain 1 Proteins 0.000 description 2
- 101000906744 Homo sapiens Cold-inducible RNA-binding protein Proteins 0.000 description 2
- 101000745624 Homo sapiens Cyclic AMP-responsive element-binding protein 3-like protein 2 Proteins 0.000 description 2
- 101100172782 Homo sapiens EWSR1 gene Proteins 0.000 description 2
- 101000967216 Homo sapiens Eosinophil cationic protein Proteins 0.000 description 2
- 101000877727 Homo sapiens Forkhead box protein O1 Proteins 0.000 description 2
- 101001039330 Homo sapiens Golgin subfamily A member 5 Proteins 0.000 description 2
- 101000864089 Homo sapiens HLA class II histocompatibility antigen, DP alpha 1 chain Proteins 0.000 description 2
- 101000930802 Homo sapiens HLA class II histocompatibility antigen, DQ alpha 1 chain Proteins 0.000 description 2
- 101000968032 Homo sapiens HLA class II histocompatibility antigen, DR beta 3 chain Proteins 0.000 description 2
- 101001056560 Homo sapiens Juxtaposed with another zinc finger protein 1 Proteins 0.000 description 2
- 101001132841 Homo sapiens Mitochondrial ribosome-associated GTPase 1 Proteins 0.000 description 2
- 101000583057 Homo sapiens NGFI-A-binding protein 2 Proteins 0.000 description 2
- 101000973211 Homo sapiens Nuclear factor 1 B-type Proteins 0.000 description 2
- 101000602930 Homo sapiens Nuclear receptor coactivator 2 Proteins 0.000 description 2
- 101000823451 Homo sapiens Protein FAM174C Proteins 0.000 description 2
- 101000642815 Homo sapiens Protein SSXT Proteins 0.000 description 2
- 101000822459 Homo sapiens Protein transport protein Sec31A Proteins 0.000 description 2
- 101000712530 Homo sapiens RAF proto-oncogene serine/threonine-protein kinase Proteins 0.000 description 2
- 101000728490 Homo sapiens Tether containing UBX domain for GLUT4 Proteins 0.000 description 2
- 101000612746 Homo sapiens Tetratricopeptide repeat protein 33 Proteins 0.000 description 2
- 101001057626 Homo sapiens tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Proteins 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 102100025727 Juxtaposed with another zinc finger protein 1 Human genes 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 108010000817 Leuprolide Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 102100033815 Mitochondrial ribosome-associated GTPase 1 Human genes 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 206010073137 Myxoid liposarcoma Diseases 0.000 description 2
- CZSLEMCYYGEGKP-UHFFFAOYSA-N N-(2-chlorobenzyl)-1-(2,5-dimethylphenyl)benzimidazole-5-carboxamide Chemical compound CC1=CC=C(C)C(N2C3=CC=C(C=C3N=C2)C(=O)NCC=2C(=CC=CC=2)Cl)=C1 CZSLEMCYYGEGKP-UHFFFAOYSA-N 0.000 description 2
- 108010018525 NFATC Transcription Factors Proteins 0.000 description 2
- 102000002673 NFATC Transcription Factors Human genes 0.000 description 2
- 102100030391 NGFI-A-binding protein 2 Human genes 0.000 description 2
- 108091061960 Naked DNA Proteins 0.000 description 2
- 102100022165 Nuclear factor 1 B-type Human genes 0.000 description 2
- 102100037226 Nuclear receptor coactivator 2 Human genes 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Natural products OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 102100022628 Protein FAM174C Human genes 0.000 description 2
- 102100035586 Protein SSXT Human genes 0.000 description 2
- 102100022484 Protein transport protein Sec31A Human genes 0.000 description 2
- 102100029919 Putative uncharacterized protein C2orf48 Human genes 0.000 description 2
- 102100033479 RAF proto-oncogene serine/threonine-protein kinase Human genes 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 102100026006 Ribonucleoside-diphosphate reductase subunit M2 Human genes 0.000 description 2
- 206010073139 Round cell liposarcoma Diseases 0.000 description 2
- 108010011005 STAT6 Transcription Factor Proteins 0.000 description 2
- 102100023980 Signal transducer and activator of transcription 6 Human genes 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- 102100029773 Tether containing UBX domain for GLUT4 Human genes 0.000 description 2
- 102100040943 Tetratricopeptide repeat protein 33 Human genes 0.000 description 2
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 2
- 102000040856 WT1 Human genes 0.000 description 2
- 108700020467 WT1 Proteins 0.000 description 2
- 108010016200 Zinc Finger Protein GLI1 Proteins 0.000 description 2
- 102100035535 Zinc finger protein GLI1 Human genes 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 108010029483 alpha 1 Chain Collagen Type I Proteins 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 206010065867 alveolar rhabdomyosarcoma Diseases 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 108010005713 bis(5'-adenosyl)triphosphatase Proteins 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 229940098773 bovine serum albumin Drugs 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 201000010882 cellular myxoid liposarcoma Diseases 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 230000001934 delay Effects 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 229940056913 eftilagimod alfa Drugs 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 239000012055 enteric layer Substances 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- LZCLXQDLBQLTDK-UHFFFAOYSA-N ethyl 2-hydroxypropanoate Chemical compound CCOC(=O)C(C)O LZCLXQDLBQLTDK-UHFFFAOYSA-N 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 238000011134 hematopoietic stem cell transplantation Methods 0.000 description 2
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 2
- 230000005746 immune checkpoint blockade Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000010348 incorporation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 2
- 239000002960 lipid emulsion Substances 0.000 description 2
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 229960004961 mechlorethamine Drugs 0.000 description 2
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 239000004005 microsphere Substances 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 229960003301 nivolumab Drugs 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 229960002621 pembrolizumab Drugs 0.000 description 2
- 229960005079 pemetrexed Drugs 0.000 description 2
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920000139 polyethylene terephthalate Polymers 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 238000007480 sanger sequencing Methods 0.000 description 2
- 238000009589 serological test Methods 0.000 description 2
- 239000008247 solid mixture Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 239000003549 soybean oil Substances 0.000 description 2
- 235000012424 soybean oil Nutrition 0.000 description 2
- 230000002269 spontaneous effect Effects 0.000 description 2
- 230000007480 spreading Effects 0.000 description 2
- 238000003892 spreading Methods 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 210000002784 stomach Anatomy 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 102100027091 tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like Human genes 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 229940021747 therapeutic vaccine Drugs 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 238000007482 whole exome sequencing Methods 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- OEDPHAKKZGDBEV-GFPBKZJXSA-N (2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-2-[[(2r)-3-[2,3-di(hexadecanoyloxy)propylsulfanyl]-2-(hexadecanoylamino)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoic acid Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)CCCCCCCCCCCCCCC)CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC OEDPHAKKZGDBEV-GFPBKZJXSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- 108010017836 1,3-alpha-D-glucan synthase Proteins 0.000 description 1
- 102100026152 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon Human genes 0.000 description 1
- JLPULHDHAOZNQI-ZTIMHPMXSA-N 1-hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCC\C=C/C\C=C/CCCCC JLPULHDHAOZNQI-ZTIMHPMXSA-N 0.000 description 1
- 108010058566 130-nm albumin-bound paclitaxel Proteins 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- HIQIXEFWDLTDED-UHFFFAOYSA-N 4-hydroxy-1-piperidin-4-ylpyrrolidin-2-one Chemical compound O=C1CC(O)CN1C1CCNCC1 HIQIXEFWDLTDED-UHFFFAOYSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- 102100036630 60S ribosomal protein L7a Human genes 0.000 description 1
- FJHBVJOVLFPMQE-QFIPXVFZSA-N 7-Ethyl-10-Hydroxy-Camptothecin Chemical compound C1=C(O)C=C2C(CC)=C(CN3C(C4=C([C@@](C(=O)OC4)(O)CC)C=C33)=O)C3=NC2=C1 FJHBVJOVLFPMQE-QFIPXVFZSA-N 0.000 description 1
- 102100024381 AF4/FMR2 family member 4 Human genes 0.000 description 1
- 102100035623 ATP-citrate synthase Human genes 0.000 description 1
- 102100022094 Acid-sensing ion channel 2 Human genes 0.000 description 1
- 206010000830 Acute leukaemia Diseases 0.000 description 1
- 102100033568 Acyl-CoA-binding domain-containing protein 6 Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 235000019489 Almond oil Nutrition 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 208000025324 B-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000025321 B-lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 102100021247 BCL-6 corepressor Human genes 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 229920002799 BoPET Polymers 0.000 description 1
- 102100028265 Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 Human genes 0.000 description 1
- 102100033642 Bromodomain-containing protein 3 Human genes 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102210048098 C*05:01 Human genes 0.000 description 1
- 102210048099 C*08:02 Human genes 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 102100028737 CAP-Gly domain-containing linker protein 1 Human genes 0.000 description 1
- 102100040755 CREB-regulated transcription coactivator 3 Human genes 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- FVLVBPDQNARYJU-XAHDHGMMSA-N C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O Chemical compound C[C@H]1CCC(CC1)NC(=O)N(CCCl)N=O FVLVBPDQNARYJU-XAHDHGMMSA-N 0.000 description 1
- 102100038700 Calcium-responsive transactivator Human genes 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- SHHKQEUPHAENFK-UHFFFAOYSA-N Carboquone Chemical compound O=C1C(C)=C(N2CC2)C(=O)C(C(COC(N)=O)OC)=C1N1CC1 SHHKQEUPHAENFK-UHFFFAOYSA-N 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102100034794 Centrosomal protein of 89 kDa Human genes 0.000 description 1
- 101710192994 Centrosomal protein of 89 kDa Proteins 0.000 description 1
- 102100040509 Chromatin modification-related protein MEAF6 Human genes 0.000 description 1
- 102100040901 Circadian clock protein PASD1 Human genes 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 102100031048 Coiled-coil domain-containing protein 6 Human genes 0.000 description 1
- 102100036213 Collagen alpha-2(I) chain Human genes 0.000 description 1
- 206010010356 Congenital anomaly Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 1
- 102100026359 Cyclic AMP-responsive element-binding protein 1 Human genes 0.000 description 1
- 102000009506 Cyclin-Dependent Kinase Inhibitor p19 Human genes 0.000 description 1
- 108010009361 Cyclin-Dependent Kinase Inhibitor p19 Proteins 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 102100021902 Cysteine protease ATG4C Human genes 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102100028202 Cytochrome c oxidase subunit 6C Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 229940123780 DNA topoisomerase I inhibitor Drugs 0.000 description 1
- 229940124087 DNA topoisomerase II inhibitor Drugs 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- 102100033672 Deleted in azoospermia-like Human genes 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 1
- 101100322030 Drosophila melanogaster Abl gene Proteins 0.000 description 1
- 102100036654 Dynactin subunit 1 Human genes 0.000 description 1
- 102100038912 E3 SUMO-protein ligase RanBP2 Human genes 0.000 description 1
- 102100037038 E3 ubiquitin-protein ligase CCNB1IP1 Human genes 0.000 description 1
- 102100021183 E3 ubiquitin-protein ligase RNF130 Human genes 0.000 description 1
- 102100034830 E3 ubiquitin-protein ligase RNF216 Human genes 0.000 description 1
- 102100029505 E3 ubiquitin-protein ligase TRIM33 Human genes 0.000 description 1
- 102100033594 E3 ubiquitin-protein ligase makorin-1 Human genes 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 101150039757 EIF3E gene Proteins 0.000 description 1
- 101150029838 ERG gene Proteins 0.000 description 1
- 102100029994 ERO1-like protein alpha Human genes 0.000 description 1
- 102100023792 ETS domain-containing protein Elk-4 Human genes 0.000 description 1
- 102100038969 EZH inhibitory protein Human genes 0.000 description 1
- 102100027100 Echinoderm microtubule-associated protein-like 4 Human genes 0.000 description 1
- 238000011510 Elispot assay Methods 0.000 description 1
- 102100031948 Enhancer of polycomb homolog 1 Human genes 0.000 description 1
- 206010066919 Epidemic polyarthritis Diseases 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 102100033132 Eukaryotic translation initiation factor 3 subunit E Human genes 0.000 description 1
- 102100040651 F-BAR and double SH3 domains protein 1 Human genes 0.000 description 1
- 102100027728 F-box/LRR-repeat protein 18 Human genes 0.000 description 1
- 102100040684 Fermitin family homolog 2 Human genes 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 208000000666 Fowlpox Diseases 0.000 description 1
- 108010062427 GDP-mannose 4,6-dehydratase Proteins 0.000 description 1
- 102000002312 GDPmannose 4,6-dehydratase Human genes 0.000 description 1
- 102100037759 GRB2-associated-binding protein 2 Human genes 0.000 description 1
- 102100039788 GTPase NRas Human genes 0.000 description 1
- 102100035924 Gamma-aminobutyric acid type B receptor subunit 2 Human genes 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102100040870 Glycine amidinotransferase, mitochondrial Human genes 0.000 description 1
- 102100036675 Golgi-associated PDZ and coiled-coil motif-containing protein Human genes 0.000 description 1
- 102100034155 Guanine nucleotide-binding protein G(i) subunit alpha-1 Human genes 0.000 description 1
- 102100034473 H(+)/Cl(-) exchange transporter 6 Human genes 0.000 description 1
- 102100028970 HLA class I histocompatibility antigen, alpha chain E Human genes 0.000 description 1
- 102100028966 HLA class I histocompatibility antigen, alpha chain F Human genes 0.000 description 1
- 102100028967 HLA class I histocompatibility antigen, alpha chain G Human genes 0.000 description 1
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 description 1
- 102100033079 HLA class II histocompatibility antigen, DM alpha chain Human genes 0.000 description 1
- 102100031258 HLA class II histocompatibility antigen, DM beta chain Human genes 0.000 description 1
- 102100031547 HLA class II histocompatibility antigen, DO alpha chain Human genes 0.000 description 1
- 102100031546 HLA class II histocompatibility antigen, DO beta chain Human genes 0.000 description 1
- 102100031618 HLA class II histocompatibility antigen, DP beta 1 chain Human genes 0.000 description 1
- 102100036241 HLA class II histocompatibility antigen, DQ beta 1 chain Human genes 0.000 description 1
- 102100036117 HLA class II histocompatibility antigen, DQ beta 2 chain Human genes 0.000 description 1
- 108010088729 HLA-A*02:01 antigen Proteins 0.000 description 1
- 102210024050 HLA-B*08:01 Human genes 0.000 description 1
- 102210009882 HLA-C*07:02 Human genes 0.000 description 1
- 108010093061 HLA-DPA1 antigen Proteins 0.000 description 1
- 108010045483 HLA-DPB1 antigen Proteins 0.000 description 1
- 108010086786 HLA-DQA1 antigen Proteins 0.000 description 1
- 108010081606 HLA-DQA2 antigen Proteins 0.000 description 1
- 108010065026 HLA-DQB1 antigen Proteins 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010024164 HLA-G Antigens Proteins 0.000 description 1
- 108010081348 HRT1 protein Hairy Proteins 0.000 description 1
- 102100021881 Hairy/enhancer-of-split related with YRPW motif protein 1 Human genes 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 208000029433 Herpesviridae infectious disease Diseases 0.000 description 1
- 102100035616 Heterogeneous nuclear ribonucleoproteins A2/B1 Human genes 0.000 description 1
- 102100024229 High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B Human genes 0.000 description 1
- 101710145025 High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B Proteins 0.000 description 1
- 101000691569 Homo sapiens 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon Proteins 0.000 description 1
- 101000853243 Homo sapiens 60S ribosomal protein L7a Proteins 0.000 description 1
- 101000833170 Homo sapiens AF4/FMR2 family member 4 Proteins 0.000 description 1
- 101000782969 Homo sapiens ATP-citrate synthase Proteins 0.000 description 1
- 101000901079 Homo sapiens Acid-sensing ion channel 2 Proteins 0.000 description 1
- 101000801610 Homo sapiens Acyl-CoA-binding domain-containing protein 6 Proteins 0.000 description 1
- 101100165236 Homo sapiens BCOR gene Proteins 0.000 description 1
- 101000935886 Homo sapiens Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1 Proteins 0.000 description 1
- 101000871851 Homo sapiens Bromodomain-containing protein 3 Proteins 0.000 description 1
- 101000767052 Homo sapiens CAP-Gly domain-containing linker protein 1 Proteins 0.000 description 1
- 101000891906 Homo sapiens CREB-regulated transcription coactivator 3 Proteins 0.000 description 1
- 101000957728 Homo sapiens Calcium-responsive transactivator Proteins 0.000 description 1
- 101000817406 Homo sapiens Chromatin modification-related protein MEAF6 Proteins 0.000 description 1
- 101000613559 Homo sapiens Circadian clock protein PASD1 Proteins 0.000 description 1
- 101000777370 Homo sapiens Coiled-coil domain-containing protein 6 Proteins 0.000 description 1
- 101000875067 Homo sapiens Collagen alpha-2(I) chain Proteins 0.000 description 1
- 101000855516 Homo sapiens Cyclic AMP-responsive element-binding protein 1 Proteins 0.000 description 1
- 101000753453 Homo sapiens Cysteine protease ATG4C Proteins 0.000 description 1
- 101000861049 Homo sapiens Cytochrome c oxidase subunit 6C Proteins 0.000 description 1
- 101000871280 Homo sapiens Deleted in azoospermia-like Proteins 0.000 description 1
- 101000929626 Homo sapiens Dynactin subunit 1 Proteins 0.000 description 1
- 101000737896 Homo sapiens E3 ubiquitin-protein ligase CCNB1IP1 Proteins 0.000 description 1
- 101000734278 Homo sapiens E3 ubiquitin-protein ligase RNF216 Proteins 0.000 description 1
- 101000634991 Homo sapiens E3 ubiquitin-protein ligase TRIM33 Proteins 0.000 description 1
- 101001018965 Homo sapiens E3 ubiquitin-protein ligase makorin-1 Proteins 0.000 description 1
- 101001010853 Homo sapiens ERO1-like protein alpha Proteins 0.000 description 1
- 101001048716 Homo sapiens ETS domain-containing protein Elk-4 Proteins 0.000 description 1
- 101000882130 Homo sapiens EZH inhibitory protein Proteins 0.000 description 1
- 101001057929 Homo sapiens Echinoderm microtubule-associated protein-like 4 Proteins 0.000 description 1
- 101000920634 Homo sapiens Enhancer of polycomb homolog 1 Proteins 0.000 description 1
- 101000892423 Homo sapiens F-BAR and double SH3 domains protein 1 Proteins 0.000 description 1
- 101000862204 Homo sapiens F-box/LRR-repeat protein 18 Proteins 0.000 description 1
- 101000892677 Homo sapiens Fermitin family homolog 2 Proteins 0.000 description 1
- 101001024902 Homo sapiens GRB2-associated-binding protein 2 Proteins 0.000 description 1
- 101000584612 Homo sapiens GTPase KRas Proteins 0.000 description 1
- 101000744505 Homo sapiens GTPase NRas Proteins 0.000 description 1
- 101001000703 Homo sapiens Gamma-aminobutyric acid type B receptor subunit 2 Proteins 0.000 description 1
- 101000926140 Homo sapiens Gem-associated protein 2 Proteins 0.000 description 1
- 101000893303 Homo sapiens Glycine amidinotransferase, mitochondrial Proteins 0.000 description 1
- 101001072499 Homo sapiens Golgi-associated PDZ and coiled-coil motif-containing protein Proteins 0.000 description 1
- 101001070526 Homo sapiens Guanine nucleotide-binding protein G(i) subunit alpha-1 Proteins 0.000 description 1
- 101000710240 Homo sapiens H(+)/Cl(-) exchange transporter 6 Proteins 0.000 description 1
- 101000986085 Homo sapiens HLA class I histocompatibility antigen, alpha chain E Proteins 0.000 description 1
- 101000986080 Homo sapiens HLA class I histocompatibility antigen, alpha chain F Proteins 0.000 description 1
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 description 1
- 101000866278 Homo sapiens HLA class II histocompatibility antigen, DO alpha chain Proteins 0.000 description 1
- 101000866281 Homo sapiens HLA class II histocompatibility antigen, DO beta chain Proteins 0.000 description 1
- 101000930799 Homo sapiens HLA class II histocompatibility antigen, DQ beta 2 chain Proteins 0.000 description 1
- 101000854026 Homo sapiens Heterogeneous nuclear ribonucleoproteins A2/B1 Proteins 0.000 description 1
- 101001021527 Homo sapiens Huntingtin-interacting protein 1 Proteins 0.000 description 1
- 101000975421 Homo sapiens Inositol 1,4,5-trisphosphate receptor type 2 Proteins 0.000 description 1
- 101001033770 Homo sapiens Integrator complex subunit 4 Proteins 0.000 description 1
- 101000599048 Homo sapiens Interleukin-6 receptor subunit alpha Proteins 0.000 description 1
- 101000605496 Homo sapiens Kinesin light chain 1 Proteins 0.000 description 1
- 101001050559 Homo sapiens Kinesin-1 heavy chain Proteins 0.000 description 1
- 101000981546 Homo sapiens LHFPL tetraspan subfamily member 6 protein Proteins 0.000 description 1
- 101001063456 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 5 Proteins 0.000 description 1
- 101001017855 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 3 Proteins 0.000 description 1
- 101000957316 Homo sapiens Lysophospholipid acyltransferase 2 Proteins 0.000 description 1
- 101000615509 Homo sapiens MBT domain-containing protein 1 Proteins 0.000 description 1
- 101001005667 Homo sapiens Mastermind-like protein 2 Proteins 0.000 description 1
- 101001012669 Homo sapiens Melanoma inhibitory activity protein 2 Proteins 0.000 description 1
- 101001122114 Homo sapiens NUT family member 1 Proteins 0.000 description 1
- 101000604452 Homo sapiens NUT family member 2A Proteins 0.000 description 1
- 101000604453 Homo sapiens NUT family member 2B Proteins 0.000 description 1
- 101001107586 Homo sapiens Nuclear pore complex protein Nup107 Proteins 0.000 description 1
- 101000602926 Homo sapiens Nuclear receptor coactivator 1 Proteins 0.000 description 1
- 101001109719 Homo sapiens Nucleophosmin Proteins 0.000 description 1
- 101000958669 Homo sapiens Nucleus accumbens-associated protein 2 Proteins 0.000 description 1
- 101000586632 Homo sapiens PWWP domain-containing protein 2A Proteins 0.000 description 1
- 101000601661 Homo sapiens Paired box protein Pax-7 Proteins 0.000 description 1
- 101000601664 Homo sapiens Paired box protein Pax-8 Proteins 0.000 description 1
- 101000741790 Homo sapiens Peroxisome proliferator-activated receptor gamma Proteins 0.000 description 1
- 101000605639 Homo sapiens Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Proteins 0.000 description 1
- 101001133640 Homo sapiens Phosphofurin acidic cluster sorting protein 1 Proteins 0.000 description 1
- 101000701522 Homo sapiens Phospholipid-transporting ATPase ID Proteins 0.000 description 1
- 101001094868 Homo sapiens Plexin-D1 Proteins 0.000 description 1
- 101000584499 Homo sapiens Polycomb protein SUZ12 Proteins 0.000 description 1
- 101000730580 Homo sapiens Polycystic kidney disease protein 1-like 1 Proteins 0.000 description 1
- 101000610107 Homo sapiens Pre-B-cell leukemia transcription factor 1 Proteins 0.000 description 1
- 101001003584 Homo sapiens Prelamin-A/C Proteins 0.000 description 1
- 101000611614 Homo sapiens Proline-rich protein PRCC Proteins 0.000 description 1
- 101000882133 Homo sapiens Protein FAM131B Proteins 0.000 description 1
- 101000866633 Homo sapiens Protein Hook homolog 3 Proteins 0.000 description 1
- 101000579580 Homo sapiens Protein LSM14 homolog A Proteins 0.000 description 1
- 101000979748 Homo sapiens Protein NDRG1 Proteins 0.000 description 1
- 101000716750 Homo sapiens Protein SCAF11 Proteins 0.000 description 1
- 101001026852 Homo sapiens Protein kinase C epsilon type Proteins 0.000 description 1
- 101000825949 Homo sapiens R-spondin-2 Proteins 0.000 description 1
- 101000825960 Homo sapiens R-spondin-3 Proteins 0.000 description 1
- 101001062098 Homo sapiens RNA-binding protein 14 Proteins 0.000 description 1
- 101000683518 Homo sapiens RRP15-like protein Proteins 0.000 description 1
- 101000591201 Homo sapiens Receptor-type tyrosine-protein phosphatase kappa Proteins 0.000 description 1
- 101000702544 Homo sapiens SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 Proteins 0.000 description 1
- 101000632054 Homo sapiens Septin-8 Proteins 0.000 description 1
- 101000826125 Homo sapiens Single-stranded DNA-binding protein 2 Proteins 0.000 description 1
- 101000617805 Homo sapiens Staphylococcal nuclease domain-containing protein 1 Proteins 0.000 description 1
- 101000648196 Homo sapiens Striatin Proteins 0.000 description 1
- 101000648543 Homo sapiens Sushi domain-containing protein 1 Proteins 0.000 description 1
- 101000643620 Homo sapiens Synaptonemal complex protein 1 Proteins 0.000 description 1
- 101000740519 Homo sapiens Syndecan-4 Proteins 0.000 description 1
- 101000835720 Homo sapiens Transcription elongation factor A protein 1 Proteins 0.000 description 1
- 101001041525 Homo sapiens Transcription factor 12 Proteins 0.000 description 1
- 101000596771 Homo sapiens Transcription factor 7-like 2 Proteins 0.000 description 1
- 101000909637 Homo sapiens Transcription factor COE1 Proteins 0.000 description 1
- 101000836154 Homo sapiens Transforming acidic coiled-coil-containing protein 1 Proteins 0.000 description 1
- 101000836150 Homo sapiens Transforming acidic coiled-coil-containing protein 3 Proteins 0.000 description 1
- 101000663031 Homo sapiens Transmembrane and coiled-coil domains protein 1 Proteins 0.000 description 1
- 101000652492 Homo sapiens Tubulin-specific chaperone cofactor E-like protein Proteins 0.000 description 1
- 101000643895 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 6 Proteins 0.000 description 1
- 101000761737 Homo sapiens Ubiquitin-conjugating enzyme E2 L3 Proteins 0.000 description 1
- 101000583031 Homo sapiens Unconventional myosin-Va Proteins 0.000 description 1
- 101000621459 Homo sapiens Vesicle transport through interaction with t-SNAREs homolog 1A Proteins 0.000 description 1
- 101000771664 Homo sapiens WD repeat and FYVE domain-containing protein 2 Proteins 0.000 description 1
- 101000665937 Homo sapiens Wnt inhibitory factor 1 Proteins 0.000 description 1
- 101000781865 Homo sapiens Zinc finger CCCH domain-containing protein 7B Proteins 0.000 description 1
- 101000723833 Homo sapiens Zinc finger E-box-binding homeobox 2 Proteins 0.000 description 1
- 101000785562 Homo sapiens Zinc finger and SCAN domain-containing protein 30 Proteins 0.000 description 1
- 101000782464 Homo sapiens Zinc finger protein 444 Proteins 0.000 description 1
- 101000723661 Homo sapiens Zinc finger protein 703 Proteins 0.000 description 1
- 101001026573 Homo sapiens cAMP-dependent protein kinase type I-alpha regulatory subunit Proteins 0.000 description 1
- 101000614798 Homo sapiens cAMP-dependent protein kinase type II-alpha regulatory subunit Proteins 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 102100035957 Huntingtin-interacting protein 1 Human genes 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 108010007666 IMP cyclohydrolase Proteins 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical class C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 206010062717 Increased upper airway secretion Diseases 0.000 description 1
- 102100020796 Inosine 5'-monophosphate cyclohydrolase Human genes 0.000 description 1
- 102100024037 Inositol 1,4,5-trisphosphate receptor type 2 Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 102100039134 Integrator complex subunit 4 Human genes 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102100038306 Kinesin light chain 1 Human genes 0.000 description 1
- 102100023422 Kinesin-1 heavy chain Human genes 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 102100024116 LHFPL tetraspan subfamily member 6 protein Human genes 0.000 description 1
- 102100031036 Leucine-rich repeat-containing G-protein coupled receptor 5 Human genes 0.000 description 1
- 102100033284 Leucine-rich repeats and immunoglobulin-like domains protein 3 Human genes 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 102100038805 Lysophospholipid acyltransferase 2 Human genes 0.000 description 1
- 102100021282 MBT domain-containing protein 1 Human genes 0.000 description 1
- 108700005092 MHC Class II Genes Proteins 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- 102100025130 Mastermind-like protein 2 Human genes 0.000 description 1
- 102100029778 Melanoma inhibitory activity protein 2 Human genes 0.000 description 1
- 206010070665 Mesoblastic nephroma Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- PPQNQXQZIWHJRB-UHFFFAOYSA-N Methylcholanthrene Chemical compound C1=CC=C2C3=CC4=CC=C(C)C(CC5)=C4C5=C3C=CC2=C1 PPQNQXQZIWHJRB-UHFFFAOYSA-N 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 102000009645 Mitochondrial Aldehyde Dehydrogenase Human genes 0.000 description 1
- 108010009513 Mitochondrial Aldehyde Dehydrogenase Proteins 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 239000005041 Mylar™ Substances 0.000 description 1
- FXHOOIRPVKKKFG-UHFFFAOYSA-N N,N-Dimethylacetamide Chemical compound CN(C)C(C)=O FXHOOIRPVKKKFG-UHFFFAOYSA-N 0.000 description 1
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 1
- GUVMFDICMFQHSZ-UHFFFAOYSA-N N-(1-aminoethenyl)-1-[4-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[hydroxy-[[3-[hydroxy-[[3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(2-amino-6-oxo-1H-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(2-amino-6-oxo-1H-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-[[[2-[[[2-[[[5-(2-amino-6-oxo-1H-purin-9-yl)-2-[[[5-(4-amino-2-oxopyrimidin-1-yl)-2-[[hydroxy-[2-(hydroxymethyl)-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxyphosphinothioyl]oxymethyl]oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]oxolan-2-yl]-5-methylimidazole-4-carboxamide Chemical compound CC1=C(C(=O)NC(N)=C)N=CN1C1OC(COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)CO)C(OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)O)C1 GUVMFDICMFQHSZ-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 108010084333 N-palmitoyl-S-(2,3-bis(palmitoyloxy)propyl)cysteinyl-seryl-lysyl-lysyl-lysyl-lysine Proteins 0.000 description 1
- 102100027086 NUT family member 1 Human genes 0.000 description 1
- 102100038690 NUT family member 2A Human genes 0.000 description 1
- 102100038709 NUT family member 2B Human genes 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 102000009065 Netrin-1 Human genes 0.000 description 1
- 108010074223 Netrin-1 Proteins 0.000 description 1
- 244000061176 Nicotiana tabacum Species 0.000 description 1
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 1
- 102100021976 Nuclear pore complex protein Nup107 Human genes 0.000 description 1
- 102100037223 Nuclear receptor coactivator 1 Human genes 0.000 description 1
- 102100022678 Nucleophosmin Human genes 0.000 description 1
- 102100038140 Nucleus accumbens-associated protein 2 Human genes 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 239000012270 PD-1 inhibitor Substances 0.000 description 1
- 239000012668 PD-1-inhibitor Substances 0.000 description 1
- 239000012271 PD-L1 inhibitor Substances 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 239000012648 POLY-ICLC Substances 0.000 description 1
- 108010047613 PTB-Associated Splicing Factor Proteins 0.000 description 1
- 102100029733 PWWP domain-containing protein 2A Human genes 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 102100037503 Paired box protein Pax-7 Human genes 0.000 description 1
- 102100037502 Paired box protein Pax-8 Human genes 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 102100038825 Peroxisome proliferator-activated receptor gamma Human genes 0.000 description 1
- 102100038332 Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform Human genes 0.000 description 1
- 102100034078 Phosphofurin acidic cluster sorting protein 1 Human genes 0.000 description 1
- 102100030474 Phospholipid-transporting ATPase ID Human genes 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 102100040990 Platelet-derived growth factor subunit B Human genes 0.000 description 1
- 102100035380 Plexin-D1 Human genes 0.000 description 1
- 102100030702 Polycomb protein SUZ12 Human genes 0.000 description 1
- 102100032580 Polycystic kidney disease protein 1-like 1 Human genes 0.000 description 1
- 102100031243 Polypyrimidine tract-binding protein 3 Human genes 0.000 description 1
- 101710132760 Polypyrimidine tract-binding protein 3 Proteins 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 102100040171 Pre-B-cell leukemia transcription factor 1 Human genes 0.000 description 1
- 208000009052 Precursor T-Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 208000017414 Precursor T-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 102100026531 Prelamin-A/C Human genes 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 102100040829 Proline-rich protein PRCC Human genes 0.000 description 1
- 102100038972 Protein FAM131B Human genes 0.000 description 1
- 102100031717 Protein Hook homolog 3 Human genes 0.000 description 1
- 102100028259 Protein LSM14 homolog A Human genes 0.000 description 1
- 102100024980 Protein NDRG1 Human genes 0.000 description 1
- 102100020876 Protein SCAF11 Human genes 0.000 description 1
- 102100037339 Protein kinase C epsilon type Human genes 0.000 description 1
- 108010026552 Proteome Proteins 0.000 description 1
- 108010019674 Proto-Oncogene Proteins c-sis Proteins 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 102100022763 R-spondin-2 Human genes 0.000 description 1
- 102100022766 R-spondin-3 Human genes 0.000 description 1
- 102100029250 RNA-binding protein 14 Human genes 0.000 description 1
- 108091007333 RNF130 Proteins 0.000 description 1
- 102100023534 RRP15-like protein Human genes 0.000 description 1
- AHHFEZNOXOZZQA-ZEBDFXRSSA-N Ranimustine Chemical compound CO[C@H]1O[C@H](CNC(=O)N(CCCl)N=O)[C@@H](O)[C@H](O)[C@H]1O AHHFEZNOXOZZQA-ZEBDFXRSSA-N 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102100034089 Receptor-type tyrosine-protein phosphatase kappa Human genes 0.000 description 1
- 102100021280 Regulator of G-protein signaling 22 Human genes 0.000 description 1
- 101710148116 Regulator of G-protein signaling 22 Proteins 0.000 description 1
- 241000710942 Ross River virus Species 0.000 description 1
- 108091006517 SLC26A6 Proteins 0.000 description 1
- 108091006576 SLC34A2 Proteins 0.000 description 1
- 108091007568 SLC45A3 Proteins 0.000 description 1
- 102100037375 SLIT-ROBO Rho GTPase-activating protein 3 Human genes 0.000 description 1
- 101150083405 SRGAP3 gene Proteins 0.000 description 1
- 102100031028 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 Human genes 0.000 description 1
- 235000019485 Safflower oil Nutrition 0.000 description 1
- 190014017285 Satraplatin Chemical compound 0.000 description 1
- 101100279491 Schizosaccharomyces pombe (strain 972 / ATCC 24843) int6 gene Proteins 0.000 description 1
- 241000710961 Semliki Forest virus Species 0.000 description 1
- 102100028025 Septin-8 Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 102100023007 Single-stranded DNA-binding protein 2 Human genes 0.000 description 1
- 102100038437 Sodium-dependent phosphate transport protein 2B Human genes 0.000 description 1
- 102100035281 Solute carrier family 26 member 6 Human genes 0.000 description 1
- 102100037253 Solute carrier family 45 member 3 Human genes 0.000 description 1
- 102100027780 Splicing factor, proline- and glutamine-rich Human genes 0.000 description 1
- 102100021996 Staphylococcal nuclease domain-containing protein 1 Human genes 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 102100028898 Striatin Human genes 0.000 description 1
- 108091027544 Subgenomic mRNA Proteins 0.000 description 1
- 102100028856 Sushi domain-containing protein 1 Human genes 0.000 description 1
- 102100036234 Synaptonemal complex protein 1 Human genes 0.000 description 1
- 102100037220 Syndecan-4 Human genes 0.000 description 1
- 208000029052 T-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 108091007283 TRIM24 Proteins 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 208000033781 Thyroid carcinoma Diseases 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 239000000317 Topoisomerase II Inhibitor Substances 0.000 description 1
- 102100026430 Transcription elongation factor A protein 1 Human genes 0.000 description 1
- 102100021123 Transcription factor 12 Human genes 0.000 description 1
- 102100035101 Transcription factor 7-like 2 Human genes 0.000 description 1
- 102100024207 Transcription factor COE1 Human genes 0.000 description 1
- 102100022011 Transcription intermediary factor 1-alpha Human genes 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 102100027049 Transforming acidic coiled-coil-containing protein 1 Human genes 0.000 description 1
- 102100027048 Transforming acidic coiled-coil-containing protein 3 Human genes 0.000 description 1
- 102100037718 Transmembrane and coiled-coil domains protein 1 Human genes 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- YCPOZVAOBBQLRI-WDSKDSINSA-N Treosulfan Chemical compound CS(=O)(=O)OC[C@H](O)[C@@H](O)COS(C)(=O)=O YCPOZVAOBBQLRI-WDSKDSINSA-N 0.000 description 1
- 102100030286 Tubulin-specific chaperone cofactor E-like protein Human genes 0.000 description 1
- 102100021015 Ubiquitin carboxyl-terminal hydrolase 6 Human genes 0.000 description 1
- 102100024861 Ubiquitin-conjugating enzyme E2 L3 Human genes 0.000 description 1
- 102100030409 Unconventional myosin-Va Human genes 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- 102100023019 Vesicle transport through interaction with t-SNAREs homolog 1A Human genes 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 102100029471 WD repeat and FYVE domain-containing protein 2 Human genes 0.000 description 1
- 108700025700 Wilms Tumor Genes Proteins 0.000 description 1
- 102100038258 Wnt inhibitory factor 1 Human genes 0.000 description 1
- 102100036643 Zinc finger CCCH domain-containing protein 7B Human genes 0.000 description 1
- 102100026582 Zinc finger and SCAN domain-containing protein 30 Human genes 0.000 description 1
- 102100035868 Zinc finger protein 444 Human genes 0.000 description 1
- 102100028376 Zinc finger protein 703 Human genes 0.000 description 1
- XSMVECZRZBFTIZ-UHFFFAOYSA-M [2-(aminomethyl)cyclobutyl]methanamine;2-oxidopropanoate;platinum(4+) Chemical compound [Pt+4].CC([O-])C([O-])=O.NCC1CCC1CN XSMVECZRZBFTIZ-UHFFFAOYSA-M 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 229940081735 acetylcellulose Drugs 0.000 description 1
- USZYSDMBJDPRIF-SVEJIMAYSA-N aclacinomycin A Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1CCC(=O)[C@H](C)O1 USZYSDMBJDPRIF-SVEJIMAYSA-N 0.000 description 1
- 229960004176 aclarubicin Drugs 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 239000008168 almond oil Substances 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 159000000013 aluminium salts Chemical class 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 229960002550 amrubicin Drugs 0.000 description 1
- VJZITPJGSQKZMX-XDPRQOKASA-N amrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC=C4C(=O)C=3C(O)=C21)(N)C(=O)C)[C@H]1C[C@H](O)[C@H](O)CO1 VJZITPJGSQKZMX-XDPRQOKASA-N 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- RGHILYZRVFRRNK-UHFFFAOYSA-N anthracene-1,2-dione Chemical class C1=CC=C2C=C(C(C(=O)C=C3)=O)C3=CC2=C1 RGHILYZRVFRRNK-UHFFFAOYSA-N 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 238000013528 artificial neural network Methods 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 238000011952 auditory verbal learning test Methods 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- KLNFSAOEKUDMFA-UHFFFAOYSA-N azanide;2-hydroxyacetic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OCC(O)=O KLNFSAOEKUDMFA-UHFFFAOYSA-N 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- LNHWXBUNXOXMRL-VWLOTQADSA-N belotecan Chemical compound C1=CC=C2C(CCNC(C)C)=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 LNHWXBUNXOXMRL-VWLOTQADSA-N 0.000 description 1
- 229950011276 belotecan Drugs 0.000 description 1
- 229960002707 bendamustine Drugs 0.000 description 1
- YTKUWDBFDASYHO-UHFFFAOYSA-N bendamustine Chemical compound ClCCN(CCCl)C1=CC=C2N(C)C(CCCC(O)=O)=NC2=C1 YTKUWDBFDASYHO-UHFFFAOYSA-N 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 238000010256 biochemical assay Methods 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 238000002725 brachytherapy Methods 0.000 description 1
- 201000007452 breast secretory carcinoma Diseases 0.000 description 1
- 239000008366 buffered solution Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 102100037490 cAMP-dependent protein kinase type I-alpha regulatory subunit Human genes 0.000 description 1
- 102100021204 cAMP-dependent protein kinase type II-alpha regulatory subunit Human genes 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229960002115 carboquone Drugs 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229960000541 cetyl alcohol Drugs 0.000 description 1
- 230000005591 charge neutralization Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 229960000928 clofarabine Drugs 0.000 description 1
- WDDPHFBMKLOVOX-AYQXTPAHSA-N clofarabine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1F WDDPHFBMKLOVOX-AYQXTPAHSA-N 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 235000005687 corn oil Nutrition 0.000 description 1
- 239000002285 corn oil Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 239000002385 cottonseed oil Substances 0.000 description 1
- 238000011498 curative surgery Methods 0.000 description 1
- PZAQDVNYNJBUTM-UHFFFAOYSA-L cyclohexane-1,2-diamine;7,7-dimethyloctanoate;platinum(2+) Chemical compound [Pt+2].NC1CCCCC1N.CC(C)(C)CCCCCC([O-])=O.CC(C)(C)CCCCCC([O-])=O PZAQDVNYNJBUTM-UHFFFAOYSA-L 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 108010017271 denileukin diftitox Proteins 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 1
- 229940038472 dicalcium phosphate Drugs 0.000 description 1
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229960003983 diphtheria toxoid Drugs 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 230000037437 driver mutation Effects 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 210000001198 duodenum Anatomy 0.000 description 1
- 229950009791 durvalumab Drugs 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 238000010894 electron beam technology Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 229940116333 ethyl lactate Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 206010016256 fatigue Diseases 0.000 description 1
- 238000009459 flexible packaging Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000012268 genome sequencing Methods 0.000 description 1
- 230000008826 genomic mutation Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 239000008240 homogeneous mixture Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 108700010900 influenza virus proteins Proteins 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 239000007972 injectable composition Substances 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000009533 lab test Methods 0.000 description 1
- 238000002357 laparoscopic surgery Methods 0.000 description 1
- 238000002430 laser surgery Methods 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 229950008991 lobaplatin Drugs 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 208000001602 mammary analogue secretory carcinoma Diseases 0.000 description 1
- 229960000733 mannosulfan Drugs 0.000 description 1
- UUVIQYKKKBJYJT-ZYUZMQFOSA-N mannosulfan Chemical compound CS(=O)(=O)OC[C@@H](OS(C)(=O)=O)[C@@H](O)[C@H](O)[C@H](OS(C)(=O)=O)COS(C)(=O)=O UUVIQYKKKBJYJT-ZYUZMQFOSA-N 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Chemical class 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 101150011281 mpl1 gene Proteins 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 229950007221 nedaplatin Drugs 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000013546 non-drug therapy Methods 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 229940100027 ontak Drugs 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 229940127084 other anti-cancer agent Drugs 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940121655 pd-1 inhibitor Drugs 0.000 description 1
- 229940121656 pd-l1 inhibitor Drugs 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 210000004214 philadelphia chromosome Anatomy 0.000 description 1
- 208000026435 phlegm Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- IIMIOEBMYPRQGU-UHFFFAOYSA-L picoplatin Chemical compound N.[Cl-].[Cl-].[Pt+2].CC1=CC=CC=N1 IIMIOEBMYPRQGU-UHFFFAOYSA-L 0.000 description 1
- 229950005566 picoplatin Drugs 0.000 description 1
- 229950010773 pidilizumab Drugs 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 108700002563 poly ICLC Proteins 0.000 description 1
- 229940115270 poly iclc Drugs 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000005020 polyethylene terephthalate Substances 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229950008882 polysorbate Drugs 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 208000017426 precursor B-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 229940030749 prostate cancer vaccine Drugs 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000002661 proton therapy Methods 0.000 description 1
- 229940034080 provenge Drugs 0.000 description 1
- 239000000649 purine antagonist Substances 0.000 description 1
- 239000003790 pyrimidine antagonist Substances 0.000 description 1
- 238000012175 pyrosequencing Methods 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 108010062219 ran-binding protein 2 Proteins 0.000 description 1
- 229960002185 ranimustine Drugs 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 229950009213 rubitecan Drugs 0.000 description 1
- 235000005713 safflower oil Nutrition 0.000 description 1
- 239000003813 safflower oil Substances 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 210000003079 salivary gland Anatomy 0.000 description 1
- 229960005399 satraplatin Drugs 0.000 description 1
- 229960003440 semustine Drugs 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 238000004088 simulation Methods 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000003381 solubilizing effect Effects 0.000 description 1
- 229940083466 soybean lecithin Drugs 0.000 description 1
- 239000008347 soybean phospholipid Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 230000037436 splice-site mutation Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 239000001797 sucrose acetate isobutyrate Substances 0.000 description 1
- 235000010983 sucrose acetate isobutyrate Nutrition 0.000 description 1
- UVGUPMLLGBCFEJ-SWTLDUCYSA-N sucrose acetate isobutyrate Chemical compound CC(C)C(=O)O[C@H]1[C@H](OC(=O)C(C)C)[C@@H](COC(=O)C(C)C)O[C@@]1(COC(C)=O)O[C@@H]1[C@H](OC(=O)C(C)C)[C@@H](OC(=O)C(C)C)[C@H](OC(=O)C(C)C)[C@@H](COC(C)=O)O1 UVGUPMLLGBCFEJ-SWTLDUCYSA-N 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960000814 tetanus toxoid Drugs 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 208000013077 thyroid gland carcinoma Diseases 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 229950007217 tremelimumab Drugs 0.000 description 1
- 229960003181 treosulfan Drugs 0.000 description 1
- 150000004654 triazenes Chemical class 0.000 description 1
- 229960004560 triaziquone Drugs 0.000 description 1
- PXSOHRWMIRDKMP-UHFFFAOYSA-N triaziquone Chemical compound O=C1C(N2CC2)=C(N2CC2)C(=O)C=C1N1CC1 PXSOHRWMIRDKMP-UHFFFAOYSA-N 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 230000037455 tumor specific immune response Effects 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 229960000653 valrubicin Drugs 0.000 description 1
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 208000016261 weight loss Diseases 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 229940055760 yervoy Drugs 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/19—Dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/24—Antigen-presenting cells [APC]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4201—Neoantigens
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55522—Cytokines; Lymphokines; Interferons
- A61K2039/55527—Interleukins
- A61K2039/55533—IL-2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/10—Libraries containing peptides or polypeptides, or derivatives thereof
Definitions
- the methods described herein are directed toward the field of immunotherapy for cancer patients.
- Recent advances in personalized genomic sequencing and cancer genomic sequencing technologies have made it possible to obtain patient-specific information.
- This information can be used to prepare patient-specific medicines including patient-specific cancer vaccines that are developed based on the genome of the patient and the mutation information gathered from the patient's biological sample.
- fusion-specific vaccine libraries are methods for constructing therapeutic fusion-specific vaccine libraries, selecting a therapeutic fusion-specific vaccine for a cancer patient, and/or constructing a de novo therapeutic fusion-specific vaccine for patients having a gene fusion that is absent from a fusion-specific vaccine library.
- the method provides compositions for providing therapeutic fusion-specific vaccine libraries that can be used as sources of vaccines for many cancer patients.
- the specification provides a method for constructing a therapeutic fusion-specific vaccine library for a cancer patient, the method comprising (a) identifying one or more tumor-specific gene fusions from publicly available data, (b) identifying one or more fusion junction sequences, wherein the fusion junction sequences comprise nucleic acid sequences and/or amino acid sequences corresponding to one or more tumor-specific gene fusions, (c) obtaining information relating to interaction between fusion junction sequences with one or more HLA alleles, and (d) selecting at least one fusion junction sequence for the therapeutic fusion-specific vaccine library.
- the specification provides a method for selecting a therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) analyzing a library of fusion-specific vaccines, wherein each fusion-specific vaccine in the library comprises one or more fusion junction sequences having a nucleic acid sequences and/or an amino acid sequence corresponding to one or more tumor-specific gene fusions, and (d) selecting at least one fusion-specific vaccine in the library as the therapeutic fusion-specific vaccine for the cancer patient by selecting the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- the specification provides a method for constructing a de novo therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) determining that the cancer patient's fusion junction sequence is not present in the library of fusion-specific vaccines, and (d) constructing at least one fusion-specific vaccine as the de novo therapeutic fusion-specific vaccine for the cancer patient by constructing the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- the method further comprises administering the therapeutic fusion-specific vaccine to the cancer patient.
- the biological sample is a tissue sample or fluid sample taken from the cancer patient.
- the biological sample is analyzed by DNA sequencing, RNA sequencing, and/or protein sequencing.
- one or more tumor-specific gene fusions are identified in the biological sample.
- information relating to one or more HLA alleles of the cancer patient are obtained by analysis of the biological sample.
- the fusion-specific vaccine comprises one or more nucleic acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides having amino acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides selected from Table A.
- the fusion-specific vaccine comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 peptides corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises 20 or more peptides corresponding to one or more tumor-specific gene fusions.
- the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC 50 less than 500 nM. In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC 50 less than 250 nM. In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC 50 less than 100 nM. In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC 50 less than 50 nM.
- the library of fusion-specific vaccines comprises at least 2-10 fusion-specific vaccines having distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises at least 5-10 fusion-specific vaccines corresponding to distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises at least 10-50 fusion-specific vaccines corresponding to distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises at least 50-100 fusion-specific vaccines corresponding to distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises 100 or more fusion-specific vaccines corresponding to distinct fusion junction sequences.
- the fusion-specific vaccine comprises one or more peptides having 8-10 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 10-25 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 25-50 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 50-100 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 100 or more amino acids. In some embodiments, the fusion-specific vaccine comprises a combination of two or more peptides having numbers of amino acids described herein.
- the fusion-specific vaccine comprises one or more peptides having an amino acid sequence corresponding to a one or more tumor-specific gene fusions and one or more addition amino acid sequences. In some embodiments, the fusion-specific vaccine comprises two or more peptides having an amino acid sequence corresponding to two or more tumor-specific gene fusions and one or more addition amino acid sequences.
- the fusion-specific vaccine comprises one or more peptides having a modification. In some embodiments, the fusion-specific vaccine comprises one or more adjuvants. In some embodiments, the fusion-specific vaccine comprises the peptide having a concentration of 100 ng-10 mg.
- the fusion-specific vaccine is administered once to the cancer patient. In some embodiments, the cancer patient is treated with two or more doses of the fusion-specific vaccine.
- the library of fusion-specific vaccines comprises peptides having an amino acid sequence corresponding to gene fusions that are present in a type of cancer.
- the type of cancer is melanoma, skin cancer, head and neck cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, thyroid cancer, kidney cancer, liver cancer, pancreatic cancer, gastric cancer, testicular cancer, brain tumor, glioma, glioblastoma, solitary fibrous tumor, bladder cancer, colorectal cancer, renal cell carcinoma, sarcoma, myeloma, leukemia, and/or lymphoma.
- the type of cancer is a metastatic tumor. In some embodiments, the type of cancer is any tumor type.
- the cancer patient is administered dendritic cells or other antigen presenting cells that have been pulsed with at least one fusion junction peptide having a sequence from the fusion-specific vaccine library.
- the cancer patient is administered dendritic cells or other antigen presenting cells comprising at least one fusion junction peptide having a sequence from the fusion-specific vaccine library.
- autologous T-cells can be collected from the cancer patient, stimulated ex vivo with fusion junction sequences, and stimulated autologous T-cells are transfused into the cancer patient.
- FIG. 1 illustrates a non-limiting example of a typical strategy for generating personalized neoantigenic vaccines including 3 steps: (1) detection of mutations from sequencing data and mutation calling; (2) identification of personal neoantigens; and (3) vaccine composition.
- FIG. 2 illustrates a non-limiting example of a strategy for constructing a vaccine library comprising (1) screening of publicly available databases containing cancer sample sequences, information relating to genomic aberrations in cancer, and/or information relating to gene fusions in cancer; (2) extracting gene fusion incidence data; (3) analyzing fusion breakpoint peptides and MHC interaction; (4) selecting fusion breakpoint peptides based on affinity for MHC proteins; (5) calculating population coverage of selected peptides; and (6) incorporation of selected peptides into vaccine library.
- FIG. 3 illustrates a non-limiting scheme for selecting patients for treatment with a vaccine library comprising (1) examining patient's cancer genome for gene fusions; (2) determining patient's HLA genotype; (3) matching vaccine library to patient's gene fusion and HLA type, and (4) administering a vaccine from the vaccine library to the patient or de novo vaccine construction from the patient's tumor specific mutations or selection of another treatment.
- FIG. 4 shows a non-limiting example of a therapeutic cancer vaccine comprising BCR/ABL1 fusion peptides.
- the method described in the specification is applied to identification of BCR/ABL1 fusion peptides for the treatment of CML.
- Three breakpoints in BCR and ABL1 genes are marked with arrows (1). Fusion at these breakpoints yields two BCR/ABL1 gene fusions that are present in 90% of CML patients which comprises 45,000 patients in the U.S. and 950,00 patients worldwide (2).
- the method discloses two BCR/ABL1 fusion peptides selected based on allele coverage and patient coverage that are present in 68% of CML patients which means that 30,000 patients in the U.S. and 650,000 patients worldwide are eligible for treatment with a cancer vaccine comprising these two peptides (3).
- the sequences correspond to SEQ ID NOs: 610 to 611 from top to bottom, respectively.
- FIG. 5 shows a non-limiting example of an environment in which embodiments of the present methods may operate.
- FIG. 6 shows a non-limiting example of a data structure for storing data associated with one or more patients, in accordance with some embodiments of the present methods.
- FIG. 7 shows flow chart of an illustrative process for matching patient data and library data, in accordance with some embodiments of the present methods.
- FIG. 8 shows a block diagram of an illustrative computer system that may be used in implementing aspects of the present methods.
- Applicant has recognized that patient-specific medicines, such as patient-specific vaccines, although effective, can be very expensive. As illustrated in FIG. 1 , generating a patient specific vaccine typically involves a series of steps that are tailored for each individual patient, including detecting mutations from patient sequence data, identifying patient-specific neoantigens, and designing and synthesizing a patient-specific vaccine composition. In contrast, Applicant has developed methods and compositions for providing simple vaccine libraries that can be used as sources of vaccines for many cancer patients. Applicant has recognized that many cancers involve gene fusions, regardless of whether the cancers also include point mutations or other genetic rearrangements.
- Applicant has developed a method involving a vaccine library comprising a plurality of fusion junction sequences corresponding to the protein products of gene fusions associated with cancers in many patients. Aspects of the application are based, at least in part, on the recognition that gene fusions are present in many cancers and that a library of fusion-specific vaccines can be generated to represent a significant percentage of cancers without requiring de novo construction of personalized cancer vaccines for patients having cancers associated with these gene fusions.
- aspects of the application relate to methods and compositions for providing fusion-specific cancer vaccines to patients without resorting to personalized vaccine development for each patient.
- a library of fusion-specific vaccines is provided and a patient is evaluated to determine whether the patient will be responsive to at least one of the vaccines in the library.
- the presence of one or more cancer-associated gene fusions is identified in the patient.
- the HLA genotype of the patient is evaluated to determine whether the patient will be responsive to one or more fusion-specific vaccines corresponding to a cancer-associated gene fusion identified in the patient.
- the patient is determined to be responsive to at least one fusion-specific vaccine in the library, then one or more of the vaccines is administered to the patient.
- a personalized vaccine can be prepared de novo for the patient.
- the specification provides a method for constructing a therapeutic fusion-specific vaccine library for a cancer patient, including (a) identifying one or more tumor-specific gene fusions from publicly available data, (b) identifying one or more fusion junction sequences, wherein the fusion junction sequences comprise nucleic acid sequences and/or amino acid sequences corresponding to one or more tumor-specific gene fusions, (c) obtaining information relating to interaction between fusion junction sequences with one or more HLA alleles, and (d) selecting at least one fusion junction sequence for the therapeutic fusion-specific vaccine library.
- sequence and related information can be obtained from any suitable source including public, private, customized, or other libraries containing cancer-related sequence information.
- a library can be designed by i) selecting fusion peptides of interest (e.g., based on one or more criteria, for example the types of cancer to be covered, the target patient population, the geographic region, the size and range of peptides to be included in the library, etc., or any combination thereof), and ii) obtaining or calculating MHC interaction information for those peptides.
- the library can by synthesized or assembled using any suitable synthetic techniques (e.g., any suitable peptide chemistry, recombinant expression techniques, or any combination thereof).
- the specification provides a method for selecting a therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) analyzing a library of fusion-specific vaccines, wherein each fusion-specific vaccine in the library comprises one or more fusion junction sequences having a nucleic acid sequences and/or an amino acid sequence corresponding to one or more tumor-specific gene fusions, and (d) selecting at least one fusion-specific vaccine in the library as the therapeutic fusion-specific vaccine for the cancer patient by selecting the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- FIG. 3 illustrates a non-limiting example of a method of selecting a vaccine for a patient from a vaccine library described in this application.
- a patient's cancer genome e.g., the genome of a cancer in the patient, for example obtained from a biopsy or other sample obtained from cancer tissue in the patient
- the patient's HLA genotype is determined (e.g., by sequencing one or more HLA loci of the patient, or obtained from whole genome sequence data for the patient, and iii) the library and the patient's HLA genotype are evaluated to determine with the library contains one or more peptides that match the patient's HLA genotype (e.g., based on one or more matching criteria that can be selected by the user, for example by a physician or a healthcare organization).
- the library contains one or more peptides that are suitable for the patient (e.g., that correspond to one or more tumor specific mutations/neoantigens and that are HLA matched, for example based on specified HLA match criteria), then a vaccine containing one or more of those peptides can be selected from the library and administered to the patient.
- a de novo vaccine can be designed and synthesized for the patient (e.g., based on the patient's tumor specific mutations/neoantigens and/or HLA type) and/or a different therapy can be selected for the patient.
- the specification provides a method for constructing a de novo therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) determining that the cancer patient's fusion junction sequence is not present in the library of fusion-specific vaccines, and (d) constructing at least one fusion-specific vaccine as the de novo therapeutic fusion-specific vaccine for the cancer patient by constructing the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- the fusion-specific vaccine comprises one or more nucleic acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides having amino acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides selected from Table A. In some embodiments, one or more of the peptides listed in Table A is included in a peptide vaccine library. In some embodiments, one or more peptides in a peptide vaccine library consists of or includes a fragment of a peptide listed in Table A.
- a fragment includes at least one amino acid (e.g., at least 2, 3, 4, 5 or more amino acids) from the N-terminal portion of a fusion peptide and at least one amino acid (e.g., at least 2, 3, 4, 5 or more amino acids) from the C-terminal portion of a fusion peptide.
- a vaccine library can include a plurality separate receptacles each containing a different peptide or a different combination of two or more peptides.
- a library can be a collection of receptacles, for example, wells, vials, tubes, or other containers capable of storing one or more different peptides, for example in the form of dry preparations (e.g., powder or crystalline form), liquid preparations (e.g., aqueous, organic, or other solutions), suspensions, or a combination thereof in different containers.
- the receptacles are separate.
- the receptacles are connected (e.g., in the form of an array, for example a 2D array).
- Receptacles can be made of any suitable material (e.g., glass, plastic, polymer, or other suitable material).
- different peptides may be provided in different solutions (e.g., different salt concentrations, different pHs, etc.) depending on their solubility properties.
- Peptides in receptacles in a library can be provided at any suitable concentration (for example, nanomolar (e.g., from 1-1,000 nM), micromolar (e.g., from 1-1,000 ⁇ M), millimolar (e.g., 1-1,000 mM), or molar (e.g., 1M or higher)).
- Different peptides may be provided at different concentrations.
- a peptide in a library is in a solution without an adjuvant or other agent, and an adjuvant or other agent may be added when the vaccine is prepared.
- a peptide preparation in a library may also contain an adjuvant and/or other agent (e.g., a solubilizing or stabilizing agent, a therapeutic agent, or other agent).
- a vaccine can be prepared for the patient by retrieving (e.g., using a pipette or other suitable device for transferring the peptide(s)) from the appropriate library receptacles an appropriate amount of the one or more peptides that were identified to be suitable for that patient.
- the resulting combination of peptide(s) can be transferred to one or more suitable containers (e.g., syringes, infusion pumps, etc.) for administration to the patient.
- a peptide solution from the library may be diluted (e.g., around 5 ⁇ , 10 ⁇ , 100 ⁇ , or other dilution) in a physiologically acceptable buffer for administration to a patient.
- An adjuvant also may be added at this stage. This procedure can be followed for a plurality of patients, for example at a hospital or other medical center.
- a library can include a plurality (e.g., all, or a subset of) the peptides in Table A and a vaccine can be selected from that library based on the criteria described in this application.
- other libraries can be used (e.g., containing one or more of the peptides listed in Table A, and/or one or more other neoantigenic peptides) as described in this application.
- the fusion-specific vaccine library comprises 2 or more (e.g., 2-5, 5-10, 10-25, 25-50, 50-100, 100-500, 500-1,000 or more) different fusion junction sequences that can be used as therapeutic vaccines for treating cancer.
- a method was developed for constructing a fusion-specific vaccine library from publicly available data such as but not limited to whole genome sequencing (WGS) data and/or RNA-sequencing data.
- sources of publicly available data are databases such as but not limited to COSMIC (cancer.sanger.ac.uk/cosmic/), TCGA Fusion Gene Data Portal (54.84.12.177/PanCanFusV2/), and/or FusionCancer Database (donglab.ecnu.edu.cn/databases/FusionCancer/).
- neoantigenic peptides having amino acid sequences corresponding to the gene fusion junction can be generated.
- a library of recurrent fusion-derived neoantigenic peptide vaccines can be constructed containing all cancer-associated neoantigenic peptides or subsets thereof.
- a library can contain 2 or more different fusion peptides (e.g., 2-5, 5-10, 10-25, 25-50, 50-100, 100-500, 500-1,000 or more different fusion peptides).
- methods are disclosed for construction of a fusion-derived neoantigenic vaccine library, selection of patients and/or peptides for vaccination, and subsequent treating of patients with neoantigenic vaccines.
- methods for identifying recurrent fusion derived neoepitopes and constructing a vaccine library include several steps ( FIG. 2 ).
- methods comprise screening publicly available databases containing information regarding tumor whole genome sequencing (WGS) and/or RNA-sequencing data.
- WGS tumor whole genome sequencing
- fusion genes and fusion transcripts can be de novo discovered using WGS and/or RNA-sequencing data.
- methods integrate publicly available fusion-detection algorithms followed by heuristic filtering.
- methods comprise screening one or more publicly available databases containing information relating to annotated fusion genes, fusion transcripts, breakpoint coordinates of tumor-specific fusion genes, fusion proteins, and/or any resources containing information about recurrent fusions and their presence in tumor(s).
- methods comprise screening peer-review articles.
- methods comprise screening proprietary databases and/or patient sequence information.
- methods comprise further validation of fusion genes detected by screening publicly available databases containing WGS and/or RNA-sequencing data.
- methods comprise extracting fusion incidence data in cancer(s) from public data sources (e.g., cancer.org and/or cancer.net), proprietary information resources (e.g., uptodate.com) and/or peer-reviewed literature.
- public data sources e.g., cancer.org and/or cancer.net
- proprietary information resources e.g., uptodate.com
- peer-reviewed literature e.g., peer-reviewed literature
- methods comprise translating recurrent fusions to chimeric proteins, identifying long peptides at fusion breakpoints, and predicting peptide binding affinity to MHC class I proteins and/or MHC class II proteins using bioinformatics algorithms. In some embodiments, methods comprise determining peptide binding affinity to MHC proteins using biochemical techniques in vitro.
- methods comprise generating a set of T-cell epitopes by selection of fusion-derived neoepitopes having an IC 50 less than 500 nM.
- the epitopes can bind HLA proteins and be recognized by T-cells.
- IC 50 thresholds for MHC class I-peptide interaction are used for selecting peptides.
- MHC class II-peptide interaction are used for selecting peptides.
- methods comprise determining a binding affinity of peptide-HLA class I major genes comprising HLA-A, HLA-B, and/or HLA-C. In some embodiments, methods comprise determining a binding affinity of peptide-HLA class I minor genes comprising HLA-E, HLA-F, and/or HLA-G. In some embodiments, methods comprise determining a binding affinity of peptide-HLA class II genes comprising HLA-DMA, HLA-DMB, HLA-DOA, HLA-DOB, HLA-DPA1, HLA-DPB1, HLA-DQA1, HLA-DQA2, HLA-DQB1, HLA-DQB2, and/or HLA-DR. In some embodiments, methods comprise determining a binding affinity of the peptide to any antigen presenting protein.
- population coverage for each long peptide is calculated based on HLA allele frequency, wherein the HLA protein can bind to the fusion-derived neoepitopes with IC 50 ⁇ 500 nM.
- patient coverage is calculated based on HLA allele frequency and gene fusion incidence rates in tumors.
- the patient coverage is the percentage of patients having a particular tumor or tumors comprising a fusion-derived neoantigen included in the library.
- patients having a particular tumor or tumors comprising a fusion-derived neoantigen included in the library are vaccinated with one or more fusion-specific vaccines from the library.
- fusion-specific vaccines from the library comprise fusion-derived long peptides having 25-30 amino acids. In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides having 30-50 amino acids. In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides having 50-100 amino acids. In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides encompassing the entire fusion protein.
- fusion-derived neoantigens can be modified by anchor residues, with additional amino acid sequences like T-helper epitopes that can be included in polypeptide for enhancing of in vivo processing, binding to MHC, and/or immunogenicity.
- fusion-derived long peptides in the library are characterized by their association with particular fusion genes from which peptides are derived. In some embodiments, fusion-derived long peptides in the library are characterized by listing the HLA proteins that can effectively present neoepitopes derived from the fusion-derived long peptide. In some embodiments, fusion-derived long peptides in the library are characterized by the population coverage of the fusion-derived long peptide.
- a vaccine library contains fusion-derived long peptides or polypeptides constructed of fusion-derived neoepitopes at the fusion breakpoint.
- fusion-derived long peptides or polypeptides in the library are described by cancer types.
- fusion-derived long peptides or polypeptides in the library are described by short peptides derived from long peptides, wherein the short peptides interact with MHC class I and/or MHC class II proteins.
- fusion-derived long peptides or polypeptides in the library are described by the population coverage.
- the interactions between short peptides and MHC proteins are characterized by an IC 50 , wherein the short peptides bind to MHC proteins with an IC 50 ⁇ 500 nM.
- fusion-derived peptides are formulated with an appropriate carrier or adjuvant.
- fusion-derived neoantigens are DNA and/or RNA.
- a single vaccine can contain one or more long peptides.
- a fusion-derived long peptide can produce several shorter peptides that bind to MHC proteins.
- a vaccine targets one or more neoantigens.
- a vaccine library targets more neoantigens than the number of vaccines in the library.
- a fusion-derived peptide in a vaccine has a length of 7-11 amino acids. In some embodiments, the peptide has a length of 7 amino acids. In some embodiments, the peptide has a length of 8 amino acids. In some embodiments, the peptide has a length of 9 amino acids. In some embodiments, the peptide has a length of 10 amino acids. In some embodiments, the peptide has a length of 11 amino acids. In some embodiments the peptide length is 25 or more amino acids, 50 or more amino acids, 75 or more amino acids, or 100 or more amino acids. In some embodiments, the peptides are processed to a shorter length intracellularly.
- the neoantigenic fusion-derived peptides in the library can include, but are not limited to, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 60, 70, 80, 90, 100 or more amino acids.
- long peptides in the library correspond to shorter peptides that bind to MHC proteins.
- a peptide in a vaccine can be of any suitable length that is sufficient to be immunogenic in a patient.
- fusion-derived peptides are in neutral (uncharged) forms or in forms that are salts.
- Methods for synthesizing peptides are well known in the art.
- the peptides provided herein are synthesized using an appropriate solid-state synthetic procedure (see for example, Steward and Young, Solid Phase Peptide Synthesis, Freemantle, San Francisco, Calif. (1968); Merrifield (1967) Recent Progress in Hormone Res 23: 451). However, any other suitable synthetic technique may be used.
- one or more peptides provided herein are synthesized by expressing the peptides through standard molecular biological techniques.
- one or more peptides provided herein are isolated from natural sources.
- fusion-derived peptides are modified. Modifications should not reduce biological activity of peptides and their ability to induce tumor-specific immune responses. Modifications include but are not limited to phosphorylation, glycosylation, and oxidation.
- peptides described herein are linked to one or more additional moieties (e.g., that help promote or stimulate an immune response, stabilize or solubilize the peptide, etc., or any combination thereof).
- fusion-derived peptides are modified for enhancing their in vivo processing, binding to MHC, and/or immunogenicity.
- fusion-derived peptide modifications include modification to anchor residues.
- anchor residues are position 2 and position 8 in peptides comprising 9-10 amino acid residues.
- peptide modifications comprise adding amino acid sequences like T-helper epitopes upstream or downstream.
- fusion-derived neoantigens comprise polypeptides consisting of repeating fusion-derived neoantigenic short peptides.
- a patient is eligible for treatment with one or more fusion-specific vaccines from the library when the patient's tumor biopsy comprises one or more gene fusions corresponding to fusion-derived peptides or fusion-derived neoantigens present in the library.
- a patient is eligible for treatment with fusion-specific vaccines from the library when the long peptide in the library can bind to the HLA alleles of the patient and be presented to the patient's immune system.
- long peptides in the library are characterized by the HLA alleles which can bind the long peptide derivatives and present them to the immune system.
- the long peptide or polypeptide at the point of junction must be able to produce neoantigens for a particular patient.
- the patient is eligible for vaccination if at least one HLA allele of the patient matches the HLA allele of the particular fusion-derived neoantigen. In some embodiments, up to six HLA alleles of the patient match the HLA alleles of the particular fusion-derived neoantigen.
- a method of selecting a patient for vaccination with a therapeutic fusion-specific vaccine from a fusion-specific vaccine library is based on one or more factors (e.g., as illustrated in FIG. 3 ).
- selecting a patient for vaccination with a therapeutic peptide vaccine from a fusion-specific vaccine library is based on genetic analysis of a patient's tumor sample (e.g., biopsy) and normal tissue sample.
- genetic analysis is performed using one or more techniques that detects fusion genes, fusion transcripts, and/or fusion proteins in a patient's tumor.
- genetic analysis is performed with whole genome sequencing, RNA sequencing, proteome sequencing, fluorescence in situ hybridization, pyrosequencing, qPCR, Sanger sequencing, or any known analysis method that allows identification of fusion genes or/and transcripts presented in a tumor sample and absent in a normal tissue sample.
- one or more gene fusions found with WGS and/or RNA sequencing are validated with in vitro techniques.
- fusions identified by screening public and proprietary databases for information about the presence of a particular fusion in a particular cancer type are validated with in vitro techniques.
- selecting a patient for vaccination with a therapeutic peptide vaccine from a fusion-specific vaccine library is based on measuring the expression level of the fusion gene or transcript.
- the expression level of the fusion gene or transcript is measured by RNA sequencing and/or any technique that measures the expression level of the fusion transcript(s) and/or the corresponding chimeric protein(s).
- the fusion is expressed.
- selecting a patient for vaccination with a therapeutic fusion-specific vaccine from a fusion-specific vaccine library is based on the patient's HLA genotype.
- the patient is HLA genotyped using one or more serological tests, PCR, WGS, WES, RNA sequencing, and/or any other technique that determines the patient's HLA genes and/or HLA proteins.
- the patient's HLA genotyping can be performed in silico with patient's tumor sequencing data comprising transcriptome, exome, and/or genome sequencing data.
- HLA genotyping should have at least a 4-digit resolution for matching a patient's HLA alleles to vaccines in the library. However, other thresholds can be used for HLA matching.
- selecting a patient for vaccination with a therapeutic fusion-specific vaccine from fusion-specific vaccine library is based on matching of patient's HLA alleles with HLA alleles that bind to fusion-derived long peptides in the vaccine library.
- HLA proteins can bind to peptides derived from the fusion gene detected in a patient's tumor and bind to short peptides derived from long peptides presented in the library.
- the patient is eligible for vaccination if at least one HLA allele of the patient matches the HLA allele of the particular fusion-derived peptide. In some embodiments, up to six HLA alleles of the patient matches the HLA alleles of the particular fusion-derived peptide.
- a patient is selected for vaccination with a therapeutic fusion-specific vaccine from the fusion-specific vaccine library if one or more of the fusion-derived long peptide(s) in library are found in the patient's tumor biopsy as part of the expressed fusion protein (e.g., a fusion gene or fusion transcript) and not found in normal tissue(s).
- a patient is selected for vaccination with a therapeutic fusion-specific vaccine from the fusion-specific vaccine library if the patient has one or more HLA proteins that can effectively bind and present to the immune system one or more fusion-derived neoantigens that are present in the library.
- at least one HLA allele of the patient must match one of the HLA alleles that bind to the fusion-derived neoantigens in the vaccine library.
- long peptides in a library might not bind to a patient's HLA proteins, whereas shorter peptides may bind to one or more of the patient's HLA proteins, and the patient is eligible for vaccination.
- 30-mer peptides peptides that are 30 amino acids long
- derivatives of the 30-mer peptides, such as 8-mer, 9-mer, 10-mer, and/or 11-mer peptides will bind to the patient's HLA proteins and can be used to vaccinate the patient.
- a patient may have multiple HLA proteins that match multiple tumor-specific recurrent fusion-derived long peptides present in the library.
- protein mass spectrometry can be used for identifying fusion-derived peptides bound to a patient's HLA proteins.
- peptides are eluted from HLA molecules on cancer cells and then analyzed with mass spectrometry and matched with peptides in the vaccine library.
- no appropriate vaccine in the library matches a particular patient and a “de novo” method for identifying tumor-specific chimeric protein-derived neoepitopes in a patient can be used and a patient-specific personalized vaccine composition can be generated.
- patient tumor-specific chimeric protein-derived neoepitopes can be determined by sequencing RNA and/or DNA isolated from the patient's tumor biopsy sample(s) and/or normal tissue sample(s).
- fusion transcripts which are present in a tumor sample and absent from normal tissue are identified using established bioinformatical algorithms.
- false positive fusion transcripts are filtered out using WGS data, homology of fused genes at RNA level, or other available approaches.
- false positive fusion transcripts identified with in silico fusion detection are filtered out using publicly available fusion genes and fusion transcripts and chimeric proteins databases.
- in vitro validation of in silico detected fusion transcripts is performed using qPCR and/or Sanger sequencing with DNA and/or RNA isolated from patient's tumor sample(s) and normal tissue sample(s).
- a set of patient tumor-specific fusion-derived peptides corresponding to a chimeric protein's breakpoint is generated.
- a peptide represents one or more novel tumor-specific sequences that are not presented in normal tissues and contains at least one amino acid of one fusion partner, for example from the N-terminal side or from the C-terminal side of the breakpoint, and several amino acids of the other fusion partner (e.g., from the C-terminal side or from the N-terminal side of the breakpoint).
- the patient is HLA genotyped using one or more in vitro techniques such as serological tests or in silico techniques based on WGS, WES or RNA sequencing data.
- in vitro techniques such as serological tests or in silico techniques based on WGS, WES or RNA sequencing data.
- binding affinity (or any other parameter characterizing peptide—MHC interaction process) is predicted by means of highly validated bioinformatical algorithms that can be found elsewhere including iedb.org, or cbs.dtu.dk/services/.
- the expression level of all identified fusion transcripts corresponding to the patient's tumor-specific fusion-derived peptides are measured using RNA sequencing data or any available technique for measuring expression level of fusion transcript and/or corresponding chimeric protein.
- the patient's tumor-specific fusion-derived neoepitopes are expression products of the fusion gene transcript and have IC 50 to patient's HLA proteins less than 500, less than 250, less than 150,or less than 50 nM.
- a patient's tumor-specific vaccine composition comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or any appropriate number of patient tumor-specific fusion-derived peptides, wherein the composition optionally comprises one or more DNA or RNA constructs encoding such peptides.
- a variety of bioinformatical algorithms and pipelines have been established for identifying tumor-specific fusions and generating corresponding neoepitopes.
- gene fusion peptides are selected based on IC 50 for HLA proteins. In some embodiments, gene fusion peptides having an IC 50 of more than 500 nM are considered non-binding. In some embodiments, peptides with an IC 50 of less than 500 nM are considered binding.
- peptide vaccine compositions comprise gene fusion peptides having IC 50 less than 500 nM, less than 450 nM, less than 400 nM, less than 350 nM, less than 300 nM, less than 250 nM, less than 200 nM, less than 150 nM, less than 100 nM, less than 50 nM, less than 25 nM, less than 10 nM, or less than 1 nM for one or more HLA proteins of a patient are selected for a vaccine for that patient (e.g., one or more of these concentration thresholds can be used for determining peptide matches for a patient).
- concentration thresholds can be used for determining peptide matches for a patient.
- other IC 50 thresholds e.g., higher, lower, or intermediate concentrations
- a gene fusion peptide IC 50 is predicted using established computational methods.
- computational methods include NetMHC (e.g., cbs.dtu.dk/services/NetMHC/) and NetMHCpan (e.g., cbs.dtu.dk/services/NetMHCpan/).
- a gene fusion peptide IC 50 is determined in vitro using one or more biochemical assays. Methods described herein are not limited by the techniques used to identify the gene fusion peptide IC 50 .
- binding of gene fusion peptides to HLA proteins is determined from biological samples by eluting peptides from HLA proteins and analyzing them using mass spectrometry.
- gene fusion peptides are selected based on patient coverage. In some embodiments, gene fusion peptides having patient coverage greater than 5%, greater than 10%, greater than 20%, greater than 30%, greater than 40%, greater than 50%, greater than 60%, greater than 70%, greater than 80%, or greater than 90% are selected.
- the vaccine library can be expanded with the same methods described herein to incorporate new recurrent fusion data as it emerges.
- Bio samples refer to samples taken or derived from a patient. These samples may be tissue samples or they may be fluid samples (e.g., a bodily fluid). Examples of biological fluid samples are whole blood, plasma, serum, urine, sputum, phlegm, saliva, tears, and other bodily fluids.
- the biological sample is a whole blood sample, or a sample of white blood cells from a subject.
- the biological sample is a tumor, a fragment of a tumor, a tumor biopsy, or a tumor cell(s).
- Cancer includes, but is not limited to: melanoma, skin cancer, head and neck cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, thyroid cancer, kidney cancer, liver cancer, pancreatic cancer, gastric cancer, testicular cancer, brain tumor, glioma, glioblastoma, solitary fibrous tumor, bladder cancer, colorectal cancer, renal cell carcinoma, sarcoma, myeloma, leukemia, and/or lymphoma.
- the treatment is regimented to modulate the patient's immune system to induce a response against a tumor comprising a gene fusion.
- treatment comprises administering a peptide vaccine one or more times to a patient.
- an initial vaccine can be administered followed by one or more booster administrations.
- a vaccine can be administered once or more daily, weekly, monthly, or at other time intervals or other frequencies.
- the frequency of administration and the duration of a treatment can depend on the severity of the disease, the effectiveness of the vaccine, and/or the health of the patient.
- treatment comprises administering a peptide vaccine at day 1, 4, 8, 15, and 21 and at week 12, 20, 30, and 40.
- vaccines can be administered intravenously (i.v.), intradermally (i.d.), parenterally, intraperitoneally (i.p.), subcutaneously (s.c.), intramuscularly (i.m.), orally, sublingually, intranasally, rectally, or intravaginally.
- the treatment is not limited to the method of vaccine administration.
- treatment comprises therapeutic or prophylactic vaccination of a patient with a tumor or at risk of developing cancer, and inducing antitumor immune responses in the patient.
- treatment comprises preventive vaccination of the patient against a tumor by one or more peptides from the library or vaccine composition identified with methods described herein.
- treatment comprises treating a patient with a fusion-derived peptide or vaccine composition in combination with one or more additional therapies.
- an additional therapy is an FDA approved therapy.
- an additional therapy is an experimental therapy that is not yet approved.
- vaccination of a patient is combined with one or more targeted therapies, chemotherapies, radiation, immunotherapy, or with hematopoietic stem cell transplantation.
- any other suitable therapy for a particular tumor and patient may be combined with vaccination.
- suitable therapies that can be combined with vaccination include but are not limited to immunotherapies, for example checkpoint blockade therapies, for example, but not limited to, anti-PD1 (e.g., nivolumab (Opdivo®), pembrolizumab (Keytruda®), pidilizumab etc), anti-CTLA4 (e.g., ipilimumab (Yervoy®), tremelimumab), or other checkpoint inhibitors such as BMS-936559, MPDL3280A, MEDI4736, MSB0010718C, IMP321, MGA271.
- anti-PD1 e.g., nivolumab (Opdivo®), pembrolizumab (Keytruda®), pidilizumab etc
- anti-CTLA4 e.g., ipilimumab (Yervoy®), tremelimumab
- checkpoint inhibitors such as BMS-936559, MPDL3280
- One aspect of the specification provides methods for treating a patient having a tumor and eliciting an antitumor immune response in the patient by administering dendritic cells (or other antigen presenting cells) that have been pulsed with at least one fusion-derived peptide (or coding mRNA or DNA) from the vaccine library.
- dendritic cells (or other antigen presenting cells) pulsed in this manner comprise at least one fusion-derived peptide (or coding mRNA or DNA) from the vaccine library.
- the vaccine composition comprises at least two distinct peptides wherein each peptide corresponds to the amino acid sequence at the point of junction and each peptide is equal to or less than 50 amino acids in length.
- peptides or vaccine compositions are administered at concentrations sufficient to induce an antitumor immune response in the patient. Concentrations of peptides and vaccine components and dosing regimens can be easily determined by anyone skilled in the art.
- treatment comprises administering a vaccine having a peptide concentration of 1-10 mg per injection.
- peptide doses per patient for one vaccination are 100 ng or more (e.g., 100-500 ng, 500-1,000 ng, or more), 1 ⁇ g or more (e.g., 1-10 ⁇ g, 10-100 ⁇ g, 100-500 ⁇ g, 500-1,000 ⁇ g, or more), 1 mg or more (e.g., 1-10 mg, 10-50 mg, 50-100 mg, or more), or 100 mg or more.
- peptide doses per patient are adjusted depending on patient condition, patient weight, cancer stage and severity.
- peptide doses and treatment regimen can vary depending on a patient's response to therapy.
- peptide doses and treatment regimen can vary depending on a patient's condition.
- concentration of peptides provided in the pharmaceutical formulations can vary widely, e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected primarily by fluid volumes, viscosities, etc., in accordance with the particular mode of administration selected.
- the peptide concentration in the vaccine (e.g., for each peptide, or the combined total peptide concentration) is around 1 nM, around 250 nM, around 500 nM, around 750 nM, around 1 around 250 around 500 around 750 around 1 mM, around 250 mM, around 500 mM, around 750 mM, or around 1M, or more or an intermediate concentration.
- the peptide dose per patient is around 1 ng, around 250 ng, around 500 ng, around 750 ng, around 1 ⁇ g, around 250 ⁇ g, around 500 ⁇ g, around 750 ⁇ g, around 1 mg, around 250 mg, around 500 mg, around 750 mg, around 1,000 mg, or more or an intermediate amount.
- an initial dose is (e.g., for therapeutic or prophylactic administration) from about 1.0m to about 50,000m of peptide for a 70 kg patient, followed by subsequent doses (e.g., boosting doses) of from about 1.0m to about 10,000m of peptide pursuant to a regimen (e.g., a boosting regimen) over weeks to months depending upon the patient's response and condition.
- subsequent doses can be the same as the initial dose. It should be appreciated that equivalent dosages for patients in different weight ranges can be calculated.
- a typical dose is at least 0.1 ⁇ g/kg, at least 1 ⁇ g/kg, at least 10 ⁇ g/kg, at least 25 ⁇ g/kg, at least 50 ⁇ g/kg, at least 100 ⁇ g/kg, at least 250 ⁇ g/kg, at least 500 ⁇ g/kg, at least 750 ⁇ g/kg, at least 1 mg/kg, at least 10 mg/kg, or more or an intermediate range between any of these values.
- DNA or mRNA encoding a fusion-derived peptide or polypeptide is administered to a patient.
- DNA or mRNA encoding a fusion-derived peptide or polypeptide is incorporated into a vector.
- DNA or mRNA comprises additional sequences including but not limited to a T-helper sequence.
- DNA or mRNA comprises standard regulatory sequences that ensure expression in a particular cell type.
- DNA or mRNA comprises additional sequences encoding proteins such as IL-2 or GM-CSF that can increase a patient's immune response.
- DNA or mRNA is transfected into mammalian cells with techniques including but not limited to electroporation.
- autologous T-cells can be collected from a patient and stimulated ex vivo with fusion-derived peptides and/or DNA or RNA encoding the fusion-derived peptides. In some embodiments, autologous T-cells can be collected from a patient and stimulated ex vivo with fusion-derived peptides and/or DNA or RNA encoding the fusion-derived peptides and the stimulated T-cells are infused into the patient.
- DNA or RNA encoding the fusion-derived peptides comprises attenuated viral vectors.
- viral vectors comprise BCG, vaccinia, and/or fowlpox.
- the library can be used for treating subjects diagnosed with cancer, wherein the subject is human.
- the subject can be a mouse, cat, dog, horse, primate, or any animal.
- an effective amount of the pharmaceutical composition (e.g., vaccine) described herein can be administered to a subject (e.g., a human) in need of the treatment via a suitable route (e.g., intravenous administration, subcutaneous, intradermal, or other route).
- a suitable route e.g., intravenous administration, subcutaneous, intradermal, or other route.
- the subject to be treated by the methods described herein can be a human patient having cancer.
- cancer includes, but is not limited to, melanoma, skin cancer, head and neck cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, thyroid cancer, kidney cancer, liver cancer, pancreatic cancer, gastric cancer testicular cancer, brain tumor, glioma, glioblastoma, solitary fibrous tumor, bladder cancer, colorectal cancer, renal cell carcinoma, sarcoma, myeloma, leukemia, and/or lymphoma.
- the subject to be treated by the methods described herein can be a mammal, more preferably a human.
- Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats.
- a human subject who needs the treatment may be a human patient having a cancer.
- a subject having a cancer can be identified by routine medical examination, e.g., laboratory tests, PET scan, biopsy, PET scans, CT scans, or ultrasounds.
- a subject having a cancer might show one or more symptoms of the disorder, e.g., unexplained weight loss, fever, fatigue, pain, skin changes, unusual bleeding or discharge, and/or thickening or lumps in parts of the body.
- a subject at risk for a cancer can be a subject having one or more of the risk factors for that disorder.
- risk factors associated with cancer include (a) viral infection (e.g., herpes virus infection), (b) age, (c) family history, (d) heavy alcohol consumption, (e) obesity, and (f) tobacco use.
- an effective amount refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment. It will be understood by those of ordinary skill in the art, however, that a patient may insist upon a lower dose or tolerable dose for medical reasons, psychological reasons or for virtually any other reasons.
- Empirical considerations such as the half-life, generally will contribute to the determination of the dosage.
- antibodies that are compatible with the human immune system such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the peptide and to prevent the peptide being attacked by the host's immune system.
- Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a cancer.
- sustained continuous release formulations of a fusion-specific vaccine may be appropriate.
- Various formulations and devices for achieving sustained release are known in the art.
- dosages for a fusion-specific vaccine as described herein may be determined empirically in individuals who have been given one or more administration(s) of a fusion-specific vaccine. Individuals are given incremental dosages of the fusion-specific vaccine.
- an indicator of a cancer such as tumor formation or tumor growth
- dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer.
- the progress of this therapy is easily monitored by conventional techniques and assays.
- the dosing regimen (including the fusion-specific vaccine used) can vary over time. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate a cancer, or a symptom thereof.
- the appropriate dosage of a fusion-specific vaccine will depend on the specific fusion-specific vaccine(s) (or compositions thereof) employed, the type and severity of cancer, whether the fusion-specific vaccine is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antagonist, and the discretion of the attending physician.
- the clinician will administer a fusion-specific vaccine, until a dosage is reached that achieves the desired result.
- Administration of a fusion-specific vaccine can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners.
- the administration of a fusion-specific vaccine may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing cancer.
- treating refers to the application or administration of a composition including one or more active agents to a subject, who has a cancer, a symptom of a cancer, or a predisposition toward a cancer, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward a cancer.
- Alleviating a cancer includes delaying the development or progression of the disease, or reducing disease severity. Alleviating the disease does not necessarily require curative results.
- “delaying” the development of a disease means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated.
- a method that “delays” or alleviates the development of a disease, or delays the onset of the disease is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.
- “Development” or “progression” of a disease means initial manifestations and/or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein “onset” or “occurrence” of a cancer includes initial onset and/or recurrence.
- the fusion-specific vaccine described herein is administered to a subject in need of the treatment at an amount sufficient to induce a immunological response against a tumor by at least 5% (e.g., 15%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater).
- the fusion-specific vaccine is administered in an amount effective in reducing tumor metastasis.
- the fusion-specific vaccine is administered in an amount effective in reducing tumor formation or tumor growth.
- compositions can also be administered via other conventional routes, e.g., administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, and intracranial injection or infusion techniques.
- injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.
- Injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like).
- water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipients is infused.
- Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients.
- Intramuscular preparations e.g., a sterile formulation of a suitable soluble salt form of the antibody
- a pharmaceutical excipient such as Water-for-Injection, 0.9% saline, or 5% glucose solution.
- a fusion-specific vaccine is administered via site-specific or targeted local delivery techniques.
- site-specific or targeted local delivery techniques include various implantable depot sources of the fusion-specific vaccine or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 00/53211 and U.S. Pat. No. 5,981,568.
- Targeted delivery of therapeutic compositions containing a polynucleotide, expression vector, or subgenomic polynucleotides can also be used.
- Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol. (1993) 11:202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J. A. Wolff, ed.) (1994); Wu et al., J. Biol. Chem. (1988) 263:621; Wu et al., J. Biol. Chem. (1994) 269:542; Zenke et al., Proc. Natl. Acad. Sci.
- compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol.
- concentration ranges of about 500 ng to about 50 mg, about 1 ⁇ g to about 2 mg, about 5 ⁇ g to about 500 ⁇ g, and about 20 ⁇ g to about 100 ⁇ g of DNA or more can also be used during a gene therapy protocol.
- the therapeutic polynucleotides and polypeptides described herein can be delivered using gene delivery vehicles.
- the gene delivery vehicle can be of viral or non-viral origin (see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5:845; Connelly, Human Gene Therapy (1995) 1:185; and Kaplitt, Nature Genetics (1994) 6:148).
- Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters and/or enhancers. Expression of the coding sequence can be either constitutive or regulated.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
- Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos. 5,219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No.
- alphavirus-based vectors e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)
- AAV adeno-associated virus
- Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther. (1992) 3:147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem. (1989) 264:16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Pat. No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed.
- Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859.
- Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP Patent No. 0524968. Additional approaches are described in Philip, Mol. Cell. Biol. (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci. (1994) 91:1581.
- an expression vector can be used to direct expression of any of the fusion-specific vaccines described herein.
- the particular dosage regimen, i.e., dose, timing and repetition, used in the method described herein will depend on the particular subject and that subject's medical history.
- more than one fusion-specific vaccine may be administered to a subject in need of the treatment.
- the fusion-specific vaccine can correspond to the same tumor junction sequence or different tumor junction sequences. At least one, at least two, at least three, at least four, at least five different fusion-specific vaccines can be co-administered. Generally, those fusion-specific vaccines have complementary activities that do not adversely affect each other. Fusion-specific vaccines can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
- Treatment efficacy can be assessed by methods well-known in the art, e.g., monitoring tumor growth or formation in a patient subjected to the treatment.
- combination therapy embraces administration of these agents (e.g., a fusion-specific vaccine and an anti-cancer therapeutic agent) in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the agents, in a substantially simultaneous manner.
- combination therapies include two or more therapeutic agents (e.g., vaccines or other agents) combined in the same composition. However, in many embodiments, different therapeutic agents are provided in separate compositions.
- Sequential or substantially simultaneous administration of each agent can be affected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular, subcutaneous routes, and direct absorption through mucous membrane tissues.
- the agents can be administered by the same route or by different routes.
- a first agent e.g., a fusion-specific vaccine
- a second agent e.g., an anti-cancer agent
- the term “sequential” means, unless otherwise specified, characterized by a regular sequence or order, e.g., if a dosage regimen includes the administration of a fusion-specific vaccine and an anti-cancer agent, a sequential dosage regimen could include administration of the fusion-specific vaccine before, simultaneously, substantially simultaneously, or after administration of the anti-cancer agent, but both agents will be administered in a regular sequence or order.
- the term “separate” means, unless otherwise specified, to keep apart one from the other.
- the term “simultaneously” means, unless otherwise specified, happening or done at the same time, i.e., the agents of the invention are administered at the same time.
- substantially simultaneously means that the agents are administered within minutes of each other (e.g., within 10 minutes of each other) and intends to embrace joint administration as well as consecutive administration, but if the administration is consecutive it is separated in time for only a short period (e.g., the time it would take a medical practitioner to administer two agents separately).
- concurrent administration and substantially simultaneous administration are used interchangeably.
- Sequential administration refers to temporally separated administration of the agents described herein.
- Combination therapy can also embrace the administration of the agents described herein (e.g., a fusion-specific vaccine and an anti-cancer agent) in further combination with other biologically active ingredients (e.g., a different anti-cancer agent) and non-drug therapies (e.g., surgery).
- agents described herein e.g., a fusion-specific vaccine and an anti-cancer agent
- other biologically active ingredients e.g., a different anti-cancer agent
- non-drug therapies e.g., surgery.
- any combination of a fusion-specific vaccine and another anti-cancer agent may be used in any sequence for treating a cancer.
- the combinations described herein may be selected on the basis of a number of factors, which include but are not limited to the effectiveness of inducing an immune response, reducing tumor formation or tumor growth, and/or alleviating at least one symptom associated with the cancer, or the effectiveness for mitigating the side effects of another agent of the combination.
- a combined therapy described herein may reduce any of the side effects associated with each individual members of the combination, for example, a side effect associated with the anti-cancer agent.
- another anti-cancer therapeutic agent is a chemotherapy, a radiation therapy, a surgical therapy and/or an immunotherapy.
- chemotherapeutic agents include, but are not limited to, Carboplatin or Cisplatin, Docetaxel, Gemcitabine, Nab-Paclitaxel, Paclitaxel, Pemetrexed, and Vinorelbine.
- radiation therapy include, but are not limited to, ionizing radiation, gamma-radiation, neutron beam radiotherapy, electron beam radiotherapy, proton therapy, brachytherapy, and systemic radioactive isotopes and radiosensitizers.
- Examples of a surgical therapy include, but are not limited to, a curative surgery (e.g., tumor removal surgery), a preventive surgery, a laparoscopic surgery, and a laser surgery.
- Examples of an immunotherapy include, but are not limited to, a PD-1 inhibitor or a PD-L1 inhibitor, adoptive cell transfer, and therapeutic cancer vaccines.
- Additional examples of chemotherapy include, but are not limited to, Platinating agents, such as Carboplatin, Oxaliplatin, Cisplatin, Nedaplatin, Satraplatin, Lobaplatin, Triplatin, Tetranitrate, Picoplatin, Prolindac, Aroplatin and other derivatives; Topoisomerase I inhibitors, such as Camptothecin, Topotecan, irinotecan/SN38, rubitecan, Belotecan, and other derivatives; Topoisomerase II inhibitors, such as Etoposide (VP-16), Daunorubicin, a doxorubicin agent (e.g., doxorubicin, doxorubicin HCl, doxorubicin analogs, or doxorubicin and salts or analogs thereof in liposomes), Mitoxantrone, Aclarubicin, Epirubicin, Idarubicin, Amrubicin, Amsacrine, Pirarubicin, Valrubicin
- methods are provided for constructing a fusion-derived vaccine library which can be used for treating a patient having cancer and eliciting an immune response in the patient.
- the vaccine comprises fusion-derived long peptides or polypeptides comprising neoantigens peptides matched to patients HLA and which can induce an antitumor immune response in the patient.
- the immune response can be detected by analyzing IFN- ⁇ production or tumor killing activity of T-cells in vitro.
- the vaccine comprises one fusion-derived long peptide at a breakpoint or several shorter derivatives of the long peptide.
- the vaccine comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 neoantigenic peptides that can be bound by the patient's HLA class I and/or class II proteins. It should be appreciated that the vaccine comprising one or more neoantigenic peptides may further comprise one or more additional therapeutic agents. Alternatively, or in addition, on or more additional therapeutic agents may be administered separately
- a vaccine comprises two or more different peptides that are selected for a patient, wherein the peptide are mixed together in a single vaccine composition for administration to the patient.
- two or more different peptides can be administered separately to a patient.
- a vaccine can contain any suitable concentration of each of the two or more peptides.
- the concentration of each peptide in the vaccine is identical or similar.
- different peptides can be provided at different concentrations.
- the vaccine comprises fusion-derived long peptides or polypeptides that are processed into shorter neoantigenic peptides which can be bound to at least one HLA class I protein of the patient. In some embodiments, the vaccine comprises fusion-derived long peptides or polypeptides that are processed into shorter neoantigenic peptides which can be bound to one or more, two or more, three or more, four or more, five or more, or six HLA class I protein of the patient. In some embodiments, peptides can bind to HLA class II proteins and induce helper T-cell response.
- a vaccine comprises several different fusion-derived long peptides or polypeptides corresponding to several different fusion genes present in the patient's tumor.
- compositions comprises one or more, or two or more neoantigenic fusion-derived peptides.
- vaccine compositions comprises any adjuvant that can be used to activate an immune response in a patient.
- an adjuvant can be any substance or any compound incorporated into a vaccine composition that increases the immune response of the patient to the fusion-derived peptides.
- adjuvants include, but are not limited to, poly-ICLC, Poly (I:C), GM-CSF, BCG, monophosphoryl lipid A, MF59, Freund's adjuvants, Montanide IMS, Montanide ISA 206, Montanide ISA-51, Montanide ISA 50V, Aluminium salts, Alhydrogel, Rehydrogel HPA, PLGA, MPL1, AS04, AS01B, AS02A, P3CSK4, CpG-ODN, Imiquimod ISS, ONTAK, LipoVac, Amplivax, CpG7909, dSLIM, IC30, IC31, SRL172, virus particles, YF-17D, AS15, OK-432, IMP321, OM-174, cytokines, and other adjuvants that can be found in the field using any source (e.g., peer-reviewed literature or medical guidelines).
- any source e.g., peer-reviewed literature or medical guidelines.
- fusion-derived peptides are administered separately from one or more adjuvant(s). In some embodiments, fusion-derived peptides are administered along with one or more adjuvant(s). In some embodiments, vaccine compositions comprise one or more adjuvants and one or more fusion-derived peptides.
- vaccine compositions comprise different carriers such as polysaccharides, polypeptides, proteins, liposomes, or antigen presenting cells.
- peptides might be combined with carriers that increase their immunogenicity, biological activity, and/or stability.
- carriers include, but are not limited to, proteins such as bovine serum albumin (BSA), human serum albumin, immunoglobulins, transferrin, insulin; and/or carbohydrates such as lactose, cellulose, starch.
- carriers are proteins such as diphtheria toxoid, tetanus toxoid, influenza virus proteins, and/or herpes virus proteins.
- vaccine compositions comprise any carriers that are safe and acceptable for patients.
- vaccine compositions comprise at least one or more autologous antigen presenting cells (APC) pulsed with respective fusion-derived peptides from library.
- APC autologous antigen presenting cells
- Pulsing APC cells may be performed in any manner known in the field. See, for example, Boczkowski et al, J Exp. Med. 1996 Aug. 1; 184(2): 465-72; see also: O'Neill and Bhardwaj, Adoptive Immunotherapy: Methods and Protocols, 2005, Volume 109 pp 97-112, which are incorporated by reference herein for this purpose.
- vaccine compositions comprise at least one or more autologous antigen presenting cells (APC) comprising fusion-derived peptides from library.
- APCs can be dendritic cells, macrophages, B-cells, or any professional antigen presenting cell.
- APCs can be loaded with DNA or mRNA encoding respective fusion-derived peptide(s) of a vaccine library.
- vaccine compositions comprise autologous peripheral blood mononuclear cells (PBMC).
- vaccine compositions comprise components directed to the personal needs of a particular patient.
- the personal needs of a particular patient include but are not limited to allergies, previous treatments, and/or comorbidities.
- fusion-derived peptides from a library can be combined with any other tumor-specific neoantigens for a particular patient that are not included in the vaccine library. In some embodiments, fusion-derived peptides from a library can be combined with tumor-specific neoantigens for a particular patient that have been identified de novo from WGS, WES, or RNA sequencing data.
- vaccine compositions can be prepared in sterilized water. In some embodiments, vaccine compositions can be prepared in buffered solutions such as but not limited to 0.9% saline.
- One or more of the fusion-specific vaccines provided herein can be mixed with a pharmaceutically acceptable carrier (excipient), including buffer, to form a pharmaceutical composition for use in treating cancer.
- a pharmaceutically acceptable carrier excipient
- “Acceptable” means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated.
- Pharmaceutically acceptable excipients (carriers) including buffers which are well known in the art. See, e.g., Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.
- a pharmaceutical composition described herein contains one or more fusion-specific vaccines that correspond to one or more tumor-specific gene fusions.
- a pharmaceutical composition described herein contains more than one fusion-specific vaccines that recognize a tumor-specific gene fusion.
- the pharmaceutical composition comprises at least two fusion-specific vaccines that correspond to different tumor-specific gene fusions.
- the pharmaceutical composition comprises one or more peptide vaccines or other anticancer agents. It should be appreciated that any of the pharmaceutical compositions provided herein may be administered alone, separately or in a combination.
- compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions.
- pharmaceutically acceptable carriers excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
- the pharmaceutical composition described herein comprises liposomes containing the fusion-specific vaccine, which can be prepared by methods known in the art, such as described in Epstein, et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.
- Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- PEG-PE PEG-derivatized phosphatidylethanolamine
- the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules.
- sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No.
- copolymers of L-glutamic acid and 7 ethyl-L-glutamate copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-( ⁇ )-3-hydroxybutyric acid.
- LUPRON DEPOTTM injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate
- sucrose acetate isobutyrate sucrose acetate isobutyrate
- poly-D-( ⁇ )-3-hydroxybutyric acid poly-D-( ⁇ )-3-hydroxybutyric acid.
- compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. However, other sterilization techniques, including but not limited to heat, chemical, and/or radiation based sterilization techniques may be used.
- Therapeutic vaccine compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- compositions described herein can be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.
- the principal active ingredient can be mixed with a pharmaceutical carrier, e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof.
- a pharmaceutical carrier e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water
- a pharmaceutical carrier e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalc
- This solid preformulation composition is then subdivided into unit dosage forms of the type described herein containing from 0.1 to about 500 mg of the active ingredient of the present invention.
- the tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action.
- the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former.
- the two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release.
- enteric layers or coatings such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
- Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g., TweenTM 20, 40, 60, 80 or 85) and other sorbitans (e.g., SpanTM 20, 40, 60, 80 or 85).
- Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
- Suitable emulsions may be prepared using commercially available fat emulsions, such as IntralipidTM, LiposynTM, InfonutrolTM, LipofundinTM and LipiphysanTM.
- the active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g., egg phospholipids, soybean phospholipids or soybean lecithin) and water.
- an oil e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil
- a phospholipid e.g., egg phospholipids, soybean phospholipids or soybean lecithin
- other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emul
- Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%.
- the fat emulsion can comprise fat droplets between 0.1 and 1.0 .im, particularly 0.1 and 0.5 .im, and have a pH in the range of 5.5 to 8.0.
- the emulsion compositions can be those prepared by mixing a fusion-specific vaccine with IntralipidTM (a lipid emulsion) or the components thereof (soybean oil, egg phospholipids, glycerol and water).
- IntralipidTM a lipid emulsion
- components thereof soybean oil, egg phospholipids, glycerol and water.
- compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders.
- the liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above.
- the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
- compositions in preferably sterile pharmaceutically acceptable solvents may be nebulised by use of gases. Nebulised solutions may be breathed directly from the nebulising device or the nebulising device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.
- kits for use in alleviating cancer can include one or more containers comprising a fusion-specific vaccine.
- the kit can comprise instructions for use in accordance with any of the methods described herein.
- the included instructions can comprise a description of administration of the fusion-specific vaccine to treat, delay the onset, or alleviate a cancer according to any of the methods described herein.
- the kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has cancer.
- the instructions comprise a description of administering a fusion-specific vaccine to an individual having, suspected of having, or at risk for a cancer.
- the instructions relating to the use of a fusion-specific vaccine generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
- Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- the label or package insert indicates that the composition is used for treating, delaying the onset and/or alleviating a cancer. Instructions may be provided for practicing any of the methods described herein.
- kits of this invention are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
- a kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- a sterile access port for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle.
- At least one active agent in the composition is a fusion-specific vaccine.
- Kits may optionally provide additional components such as buffers and interpretive information.
- the kit comprises a container and a label or package insert(s) on or associated with the container.
- the invention provides articles of manufacture comprising contents of the kits described herein.
- FIG. 5 shows a non-limiting illustrative environment 500 in which embodiments of the present methods may operate.
- healthcare provider 502 may use any device 504 to obtain information from system 510 .
- Healthcare provider 502 may obtain information from system 510 one time or multiple times.
- Information between healthcare provider 502 and system 510 may be initiated in any suitable way.
- device 504 may be any suitable device that healthcare provider 502 may use to obtain information from system 510 .
- device 504 may be a dedicated mobile phone (e.g., a cellular phone), a mobile smart phone, a personal digital assistant (PDA), a laptop computer, a tablet computer, or any other mobile device capable of supporting an exchange of information through a communications medium (e.g., a wired or wireless communications medium).
- a communications medium e.g., a wired or wireless communications medium.
- healthcare provider 502 is not limited to obtaining information by using a mobile device and may use any device capable of obtaining information.
- healthcare provider 502 may obtain information from 510 by using a telephone connected to landline, a desktop computer connected to a network such as the Internet, or using any other device capable of communicating with system 510 . It should also be recognized that if healthcare provider 502 obtains information from system 510 , healthcare provider 502 is not limited to using the same device. Thus, healthcare provider 502 may obtain information using one or a plurality of different devices, each of which may be any suitable device capable of obtaining information.
- Information may be any suitable information relating to patient data and/or library data. Information is not limited by the type of communications infrastructure or communications medium used to obtain the information. For example, information may be patient information such as but not limited to a patient's identity, cancer type, gene fusion, and/or HLA allele information. As another example, information may be library information such as but not limited to peptide sequence information, peptide-HLA affinities, sequences of DNA and/or RNA encoding peptide sequence information, and/or gene fusion information.
- Communication medium 508 may be any suitable network or other type of communication medium.
- communication medium 508 may be a cellular network, a local area network, a circuit-switched telephone network, a public-switched telephone network, the Internet, some combination of any of the foregoing, or any other communication medium capable of supporting telecommunications.
- device 504 is communicatively coupled to communication medium 508 via wireless connection 506 and system 510 is communicatively coupled to communication medium 508 using a wired connection 516 .
- system 510 each may be communicatively coupled to communication medium 508 in any suitable way including wired and/or wireless connections.
- System 510 comprises one or more computers (e.g., servers) each configured to perform processing related to supporting matching patient data and library data.
- system 510 comprises a single server 512 , though in other embodiments any suitable number of servers may be used and distributed in any manner.
- system 510 may comprise at least ten, at least one hundred, at least one thousand, or at least ten thousand servers.
- the servers need not be located in the same physical location and may be distributed across multiple physical locations.
- Each server such as server 512 , may be configured (alone or in combination with one or more other servers) to support one or more applications and may be configured to execute any other programs.
- one or more of the servers may be configured to execute programs for supporting functionality related to patient data, library data, patient and library matching, and/or any other functions used in embodiments of the present methods.
- a healthcare provider may conduct one or multiple analyses with system 510 . Multiple analyses may take place over any suitable time period of any suitable length.
- system 510 calculates HLA-peptide affinities.
- system 510 calculates HLA-peptide matching and a healthcare provider obtains this information.
- a healthcare provider receives matched HLA-peptide information from system 510 .
- system 510 may obtain any suitable data associated with one or more healthcare providers (e.g., information identifying healthcare provider 502 , patient information, library information, patient and library matching information, etc.).
- System 510 may obtain any of the above-described data, associated with one or more healthcare providers, in any suitable way. For example, system 510 may extract this data from information collected from healthcare provider 502 .
- system 510 may store at least a portion of the obtained data on one or more storage devices 516 so that it may be retrieved from the one or more storage devices for subsequent use as discussed herein.
- Storage device(s) 516 may be any suitable storage device(s) or article(s) of manufacture capable of storing information.
- storage device(s) 516 may be any non-transitory computer readable storage medium or media such as a computer memory (RAM and/or ROM), one or more hard disk drives, one or more optical disks (CDs and/or DVDs), one or more magnetic tapes, one or more flash memories, one or more circuit configurations in Field Programmable Gate Arrays and/or any other suitable device(s).
- storage device(s) 516 are shown as being part of system 510 and as being connected to server 512 by wired connection 514 . It should be appreciated that all embodiments are not limited in this respect. For example, in other embodiments, storage device(s) 516 may be connected to server 512 using any suitable type of connection or communication medium, and may be internal or external to system 510 . When storage device(s) 516 are external to system 510 , the system may be communicatively coupled to storage device(s) 516 to obtain information from them in any suitable manner.
- FIG. 5 shows only a single healthcare provider using a single device 504 , it should be recognized that embodiments of the present method are not limited in this respect and that system 510 may be configured to service any number of healthcare providers (e.g., hundreds, thousands, or greater) who may be using any number of devices (e.g., hundreds, thousands, or greater). Data associated with one or more patients made by each healthcare provider may be stored on at least one storage device (e.g., storage device 516 and/or on devices that the healthcare provider(s) use).
- storage device 516 e.g., storage device 516 and/or on devices that the healthcare provider(s) use.
- FIG. 6 shows a non-limiting example of a data structure 600 that may be used to store data associated with one or more patients in accordance with one embodiment. While in the illustrated embodiment data structure 600 is shown in the form of a table, this is not a limitation of the present method, as any suitable data structure may be used to store the data.
- Data structure 600 may store any suitable data associated with one or more patients between any of one or more healthcare providers and system 510 .
- data structure 600 may store patient identification data 602 , patient data 604 , library data 606 , and/or data matching 608 .
- patient identification data 602 comprises information relating to patient identification such as name and date of birth.
- patient data 604 comprises information relating to a patient's cancer type, gene fusion information, and/or HLA allele information.
- library data 606 comprises information relating to peptide sequence, peptide-HLA affinity, sequences of DNA and/or RNA encoding peptides, gene fusion sequences, gene fusion cancer types, and IC 50 .
- data matching 608 comprises information relating to peptide population coverage, allele coverage, and information matching peptides to HLA alleles, peptides to gene fusions, and/or peptides to cancer types.
- data structure 600 may store any other data associated with one or more patients.
- data structure 600 may store one or more data records.
- a data record may store any suitable data associated with a patient and may store such data in any suitable format (e.g., in one or more fields).
- Each field may store any suitable amount of data and any suitable type of data and, for example, may store alphanumeric data representing the data directly, or a pointer to another location where data may be stored.
- data structure 600 may store the same type of data record for each patient, but this is not a limitation on the data structure or other aspects of the methods described herein, as in other embodiments, data structure 600 may store one type of data record for one patient and another type of data record for another patient. For example, a data record for one patient may store a different amount of data than another data record for another patient.
- Data structure 600 may store any suitable number of data records. In FIG. 6 , data structure 600 is shown as storing four data records, but it should be appreciated that the data structure may store many more (e.g., hundreds, thousands, millions, etc.) data records.
- Each data record in data structure 600 is shown as having four fields; however, this is for purposes of illustration only and is not a limitation of the present methods as any suitable number of fields may be used. For instance, any suitable number of fields may be used to store information identifying the patient, and any suitable number of fields may be used to store data associated with the patient.
- FIG. 7 shows a flow chart of an illustrative process for matching patient data and library data, in accordance with some embodiments of the present method.
- Process 700 begins in act 702 , where patient data may be received from a healthcare provider.
- the patient data may be received by a system, such as system 510 , and may be received in any suitable way.
- process 700 proceeds to act 704 , where library information is obtained.
- process 700 proceeds to decision block 706 , where it is determined whether patient information obtained in act 702 matches library information obtained in act 704 . For example, it may be determined, in decision block 706 , whether the patient is a candidate for treatment with one or more peptide vaccines from the library. As disclosed herein, such data may include patient allele data, peptide sequence information, and/or any of the other types of data described herein.
- process 700 proceeds to act 712 , where a patient may be identified as a candidate for de novo vaccine generation and treatment or a candidate for alternative treatment.
- process 700 proceeds to act 708 , where at least a portion of the library data may be retrieved.
- the data to retrieve may be any suitable data and may be determined in any suitable way.
- process 700 proceeds to act 710 , where peptide information is sent to the healthcare provider.
- the computer system 800 may include one or more processors 810 and one or more articles of manufacture that comprise non-transitory computer-readable storage media (e.g., memory 820 and one or more non-volatile storage media 830 ).
- Processor 810 may control writing data to and reading data from memory 820 and non-volatile storage device 830 in any suitable manner, as the aspects of the method described herein are not limited in this respect.
- processor 810 may execute one or more processor-executable instructions stored in one or more non-transitory computer-readable storage media (e.g., memory 820 ), which may serve as non-transitory computer-readable storage media storing processor-executable instructions for execution by processor 810 .
- non-transitory computer-readable storage media e.g., memory 820
- program or “software” are used herein in a generic sense to refer to any type of computer code or set of processor-executable instructions that can be employed to program a computer or other processor to implement various aspects of embodiments as discussed herein. Additionally, it should be appreciated that according to one aspect, one or more computer programs that when executed perform methods described herein need not reside on a single computer or processor, but may be distributed in a modular fashion among different computers or processors to implement various aspects of the present method.
- any one of the more than 30 publicly available programs for fusion detection can be used (programs available at omicstools (omictools.com/gene-fusion-detection-category).
- more than one program for fusion detection is used.
- the results from different fusion detection programs may significantly diverge.
- fusion detection programs are alignment-based programs that map reads to a reference and infer breakpoint positions from discordantly aligned reads.
- the majority of existing programs are alignment-based programs.
- alignment-based programs may differ in references (genome, transcriptome or both) or aligners, e.g., STAR (ncbi.nlm.nih.gov/pmc/articles/PMC3530905/), TopHat2 (ncbi.nlm.nih.gov/pmc/articles/PMC4053844/) or bowtie2 (ncbi.nlm.nih.gov/pmc/articles/PMC3322381/) and therefore give very diverse results.
- de novo assembly-based programs perform transcriptome assembly and align obtained sequences to a reference transcriptome and thus find chimeric transcripts.
- the de novo assembly-based program JAFFA genemedicine.biomedcentral.com/articles/10.1186/s13073-015-0167-x
- JAFFA genemedicine.biomedcentral.com/articles/10.1186/s13073-015-0167-x
- fusion detection programs are a hybrid of alignment-based and de-novo assembly-based approaches.
- the hybrid approach first aligns reads to known transcriptome similar to the alignment-based approach.
- the hybrid approach re-assembles unaligned reads and fragments spanning a breakpoint to new sequences.
- the hybrid approach re-assembles unaligned reads and fragments spanning a breakpoint to new sequences using TRUP (ncbi.nlm.nih.gov/pmc/articles/PMC4300615/).
- fusion callers may be used for de novo assembly. In some embodiments, fusion callers consume a lot of resources and time. In some embodiments, fusion callers and alignment-based tools gave the same results.
- a program has filters that influence the results produced by the program. In some embodiments, a program has its own set of filters with specific default values. In some embodiments, a program has a filter for low fusion coverage that filters out low frequency junction or spanning reads. In some embodiments, a program has a filter for homology that filters out fusion partners with long homological regions. In some embodiments, a program has a filter for minimal distance between fusion partners that filters out potential read through transcripts. In some embodiments, a program has a promiscuity filter that filters out fusions containing partner transcripts which are presented in many other fusions. In some embodiments, a program generates a program-specific list of frequent false-positives.
- multiple fusion detection programs are used to determine a gene fusion recurrence rate.
- four fusion detection programs are used to identify gene fusions.
- a gene fusion is detected by two out of four fusion detection programs.
- the fusion detection programs used are ChimeraScan (ncbi.nlm.nih.gov/pmc/articles/PMC3187648/), SOAP-fuse (ncbi.nlm.nih.gov/pmc/articles/PMC4054009/), and Integrate (genome.cshlp.org/content/early/2015/11/10/gr.186114.114.abstract).
- fusion-derived peptide lengths are calculated from gene fusions.
- computational algorithm (1) is used for calculating fusion-derived peptide lengths
- X is a fusion of genes A and B
- SA 1 is a transcript sequence of A to the left of the fusion breakpoint
- SA 2 is a transcript sequence of A to the right of the fusion breakpoint
- SB 1 is a transcript sequences of B to the left of the fusion breakpoint
- SB 2 is a transcript sequence of B to the right of the fusion breakpoint
- SA 1 ⁇ SB 2 is a fusion transcript sequence
- SA 1 ⁇ SA 2 is a transcript sequence of gene A
- SB 1 ⁇ SB 2 is a transcript sequence of gene B
- L is the peptide length, Right and Left return a given number of bases to rightmost or leftmost, Shift skips a given number of bases on the left
- RF is a position of a base in open reading frame
- LRF is the length of ORF.
- HLA genotyping is calculated in silico from genome, exome, transcriptome, and/or HLA sequencing data.
- a set of predicted HLA alleles that a patient may have is generated using computation algorithm (2),
- H i is a HLA genotyping algorithm
- a ij is a set of HLA alleles predicted by algorithm H i
- CA is a set of HLA alleles.
- a ij should have 4-digit precision (e.g., HLA-A0201).
- the set of HLA alleles CA is used for matching patient and vaccine.
- Algorithms are available for predicting MHC-peptide binding affinity and (algorithms available at cancerimmunity.org/resources/webtools/or cbs.dtu.dk/services/).
- MHC-peptide binding was predicted with NetMHC and NetMHCpan programs (NetMHC (ncbi.nlm.nih.gov/pubmed/26258412, NetMHCpan ncbi.nlm.nih.gov/pubmed/25588790).
- MHC molecules of class I consist of a heavy chain and a light chain and bind to peptides comprising 8 to 11 amino acids. In some embodiments, MHC molecule of class I bind to peptides comprising 9 or 10 amino acids. In some embodiments, long peptides or entire proteins are degraded in the cell, bound to MHC proteins, and presented to cytotoxic T-cells.
- HLA proteins bind peptides comprising 8 to 14 amino acids.
- peptides with predicted IC 50 ⁇ 500 nM are considered to bind to HLA proteins.
- peptides with predicted IC 50 ⁇ 50 nM are considered as strong binders to HLA proteins.
- peptides with predicted IC 50 >500 nM are considered as non-binders to HLA proteins.
- non-binding peptides are filtered out from a list of peptides.
- a population coverage for each long peptide is calculated using only those HLA proteins that can bind its short derivatives.
- a long peptide comprising 30 amino acids can be shortened into peptides comprising 9 amino acids for predicting binding to HLA proteins.
- mutant peptides are compared to wild type counterparts for binding affinity.
- a population coverage of fusion-derived peptides is calculated. In some embodiments, a population coverage of fusion-derived peptides is an estimate of how many patients will be eligible candidates for vaccination with the fusion-derived peptide. In some embodiments, a population coverage of fusion-derived peptides is calculated from the incidence of the corresponding gene fusion. In some embodiments, a population coverage of fusion-derived peptides is calculated from the allele frequency of HLA proteins that bind to the fusion-derived peptide. In some embodiments, a population coverage of fusion-derived peptides is calculated using computation algorithm (3),
- a ij ′ ⁇ k (A jjk ), A ij′ is a set of alleles matching peptides yielded by fusion F i , F i is a set of fusions yielding a set of peptides D ij comprising the given peptide vaccine, A ijk is the HLA alleles that can bind peptide D ij , Q(A ijk ) is the allele frequency of allele A ijk , Q(F i ) is the incidence rate of fusion F i , and P is the probability that a patient will be a candidate for treatment with the peptide vaccine.
- Fusion transcript refers to a product of fusion gene. Fusion transcript and chimeric transcript are used interchangeably.
- Fusion protein or “chimeric protein” refers to a product of a fusion transcript and may emerge from genomic rearrangement, read through transcript, or trans-splicing. Fusion protein and chimeric protein are used interchangeably.
- Fusion variant refers to a variant at particular breakpoints in fusion partner genes.
- Fusion exonic variant refers to a variant at breakpoints leading to fusion of the same partner gene exons.
- Point of junction and breakpoint refer to the point at which two genes, transcripts, or proteins are fused together.
- administering means providing a material to a subject in a manner that is pharmacologically useful.
- “At risk” patients are patients that a health practitioner believes has a chance of having a disease, disorder or condition as provided herein.
- HLA proteins refers to human leukocyte antigen (HLA) proteins that bind peptides resulting from proteolytic cleavage of protein antigens and representing potential T-cell epitopes, transporting them to the cell surface and presenting them there to specific cells, in particular cytotoxic T-lymphocytes or T-helper cells.
- HLA proteins are products of HLA genes that are classified into two gene groups coding for different proteins, namely proteins of HLA class I and proteins of HLA class II.
- HLA class I proteins and HLA class II proteins are specialized for different antigen sources.
- HLA class I proteins present endogenously synthesized antigens, for example viral proteins and tumor antigens.
- HLA class II proteins present protein antigens originating from exogenous sources, for example bacterial products.
- HLA protein” and “MHC protein” are used interchangeably.
- Vaccine refers to a composition for generating immunity for the prophylaxis and/or treatment of diseases. Vaccines are compositions comprising antigens and are intended to be used in humans or animals for generating specific defense and protective substance by vaccination.
- Peptide refers to a series of residues, typically L-amino acids, connected one to the other, typically by peptide bonds between the ⁇ —amino and carboxyl groups of adjacent amino acids. Peptides can be a variety of lengths, either in neutral (uncharged) forms or in forms which are salts, and either free of modifications or containing modifications, subject to the condition that the modification not destroy the biological activity of the peptide as described herein. It should be appreciated that a “peptide sequence” or “sequence” may be used to refer to a “peptide” having a particular sequence in the present disclosure in some contexts.
- a “long peptide” refers to a peptide comprising about 11-30 amino acid residues corresponding to the fusion breakpoint. In some embodiments, the long peptide is processed into a neoantigenic peptide comprising about 8-11 amino acid residues.
- Neoantigen refers to a tumor antigen which is produced from tumor-specific mutations in expressed genes. “Fusion-derived”, “fusion-specific”, and “neoantigen” are used interchangeably. “Neoantigenic peptides” refers to peptides that comprise tumor-specific amino acid sequences (e.g., that contain a fusion junction that is only found in cancer cells due to the genetic rearrangement that is only present in the cancer cells). “Fusion-derived peptide”, “fusion-specific peptide”, and “neoantigenic peptide” are used interchangeably.
- IC 50 refers to the concentration of gene fusion peptide necessary for inhibiting binding of a standard peptide to the HLA protein by fifty percent.
- Patient coverage refers to the percentage of patients (e.g., in a population, for example in a population that is being treated or evaluated) that have a gene fusion corresponding to a fusion-specific neoantigen present in the vaccine library and that have HLA proteins capable of binding the fusion-specific neoantigen.
- “Pulsing” refers to the process of antigen loading onto a cell, wherein the antigen may be a nucleic acid or a peptide.
- a therapeutic cancer vaccine should guide the immune response and be readily combine with other therapies.
- Therapeutic cancer vaccines can be composed of processed tumor cells, peptides, whole proteins, DNA, or mRNA.
- Vaccine antigens include tumor-associated antigens (TAA), differentiation antigens, or cancer-testis antigens.
- TAA tumor-associated antigens
- cancer-testis antigens include tumor-associated antigens (TAA), differentiation antigens, or cancer-testis antigens.
- TAA tumor-associated antigens
- Many antigens that are present in cancer cells are also present in peripheral organs, thus specifically targeting cancer cells is difficult.
- the first and only FDA approved therapeutic cancer vaccine called “Provenge” showed modest efficacy in prostate cancer (ncbi.nlm.nih.gov/pubmed/16809734).
- Fusion genes have a higher reoccurrence rate than the reoccurrence rates of missense mutations or frameshift mutations. Highly mutated genes including TP53, PIK3CA, EGFR, KRAS, BRAF, and NRAS can be found across different tumor types, yet the reoccurrence rate of mutations in these genes is low. Moreover, recurrent fusion genes and recurrent driver mutations are often mutually exclusive. Thus, recurrent fusions are attractive as a source of neoantigens for the construction of “off-the-shelf” vaccine libraries for at least two reasons: high recurrence rate and the ability to drive cancer (ncbi.nlm.nih.gov/pubmed/25500544). The following examples provide a background for the construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines.
- neoantigenic peptides were identified and used for vaccination of mice.
- the study showed that two 3-methylcholanthrene-induced sarcoma cell lines d42m1-T3 and F244 were effectively rejected with anti-PD-1 and/or anti-CTLA-4 therapies.
- the immunological nature of the rejection was confirmed with multiple experimental approaches including depleting CD4+ and CD8+ T-cells with mouse antibodies, performing experiments in mice lacking T, B, natural killer T-cells or dendritic cells, and generating immunological memory in the mice.
- the study identified neoantigens responsible for the checkpoint blockade therapy-mediated tumor rejection using a genomic approach.
- the approach was initially established for identifying TSA responsible for spontaneous rejection of d42m1 sarcomas (ncbi.nlm.nih.gov/pubmed/22318521).
- the study included features including mutation calling from exome sequencing data, translating mutations to corresponding protein sequences, predicting peptide-MHC class I binding affinity for each epitope, prioritizing epitopes, and filtering out epitopes with lower expression level and lower binding affinity in comparison to the wild-type peptides.
- ITYTWTRL SEQ ID NO: 612
- A506T mutation in alpha-1,3-glucosyltransferase and VGFNFRTL (SEQ ID NO: 613) (G1254V mutation in laminin alpha subunit 4).
- Both epitopes were shown to be targets of CD8+ T-cells generated as a consequence of anti-PD1 treatment by experiments including MHC tetramer-binding assays, mass spectrometry detection of epitopes, and ELISPOT assays. Mice were vaccinated with two peptide vaccines based on the identified mutant epitopes and 9/10 mice rejected their tumors and survived.
- mice were vaccinated with human papillomavirus 28-mer peptides and only 1/10 mice survived.
- the survival rate for mice vaccinated with therapeutic neoantigenic vaccines was 85% while the survival rate of mice vaccinated with human papillomavirus peptides was only 10%.
- neoepitopes were identified using whole-exome and transcriptome sequencing analysis with mass spectrometry. This approach identified neoepitopes in MC-38 and TRAMP-C1 mouse tumor cell lines using mutation calling from sequencing data, identification of expressed neoantigens using RNA-sequencing data, prediction of MHC class I binding interactions, and filtering of immunogenic epitopes. Six epitopes were predicted to bind with an IC 50 less than 500 nM.
- bioinformatics pipelines for detecting and prioritizing neoantigens in whole cancer exomes and/or transcriptomes have made it possible to select targets for vaccination using solely in silico simulation steps.
- Computational pipelines validated in mice models have improved mouse survival rates and inspired confidence in the potential success of vaccination with personalized neoantigenic vaccines in humans.
- the following two examples illustrate a non-limiting schematic pipeline used for neoantigen generation from sequencing data ( FIG. 1 ).
- epitope-MHC class I binding prediction algorithms were applied to a large set of neoantigens which had been known to induce strong anti-tumor activity or long-term cancer control.
- the study analyzed 40 epitopes previously identified as cytotoxic T-cell targets in the literature including 35 epitopes resulting from missense mutations and 5 epitopes resulting from frame-shift mutations.
- All epitopes were restricted by HLA class I alleles and were present in non-small cell lung cancer, melanoma, renal cell carcinoma, bladder cancer, B-cell acute lymphoblastic leukemia, multiple myeloma, and chronic lymphocytic leukemia. All epitopes were neoantigens that had been identified from cloning, mass spectrometry experiments, genomic mutations, and epitope-binding predictions. Using artificial neural network based prediction algorithms, 27 of 31 of the epitopes recognized by T-cells were predicted to have binding affinity of less than 500 nM to MHC class I proteins. Two-thirds of the patients experienced spontaneous complete tumor regression or tumor regression following therapy. Thus, in silico peptide-MHC class I binding predictions provided a reliable tool to identify neoantigens from exome and/or transcriptome data, and inclusion of such neoantigens in vaccine formulations provided tumor regression in patients.
- neoantigens in human cancer genomes were identified using bioinformatics.
- a bioinformatics pipeline was applied to 91 whole exomes obtained from chronic lymphocytic leukemias (CLL) biopsies from a group of patients who developed durable remission after allo-HSCT.
- CLL chronic lymphocytic leukemias
- 20 neoantigens derived from 16 missense mutations were predicted to bind HLA class I proteins and more than 50% of all neoantigen were confirmed to bind HLA proteins with biochemical studies.
- the general steps of the computational pipeline were DNA sequencing, mutation calling, peptide-MHC class I predictions, and experimental validation of binding peptides.
- WT1 Wilms tumor gene 1
- AML acute myeloid leukemia
- WT1-positive patients with AML were treated with synthetic analogs of WT1 protein fragments in combination with adjuvants.
- Synthetic peptide analogs of WT1 protein fragments were designed to bind HLA molecules better than wild-type counterparts and were shown to more effectively induce a WT1-specific T-cell response compared to wild-type counterparts.
- Anchor-modified peptides derived from PASD1 were shown to induce a cytotoxic T-cell response against tumor cells in AML patients. Interestingly, their non-modified wild-type analogs demonstrated no detectable binding to HLA proteins. These two examples demonstrate that neoantigenic peptide modifications can lead to an increase in peptide immunogenicity.
- the Philadelphia chromosome is the result of a translocation between chromosomes 22 and 9. This translocation is present in several cancers types and most notably the translocation is present in ⁇ 95% of chronic myelogenous leukemia (CML) cases.
- CML chronic myelogenous leukemia
- the translocation produces a fusion between BCR and ABL1 genes.
- the ABL1 kinase is constitutively active in the BCR/ABL1 fusion protein and this upregulation of activity leads to dysregulation of cell division and development of cancer.
- the sequence spanning the BCR/ABL1 breakpoint is absent in normal tissues and is present only in cancer cells, thus it may be recognized and attacked by the immune system.
- peptides spanning the BCR/ABL breakpoint were shown to stimulate the immune response.
- Cancer specific gene fusions have been used as neoantigens in several anti-cancer vaccines (Table 1).
- the EWS/FLI1 gene fusion is present in more than 85% of Ewing's sarcoma tumors (ncbi.nlm.nih.gov/pubmed/17250957) and the PAX-3/FKHR gene fusion is present in 55% of patients with alveolar rhabdomyosarcoma (ARMS) (ncbi.nlm.nih.gov/pubmed/12039929).
- Detection of recurrent chimeric transcripts was performed on 34 follicular lymphoma (FL) transcriptome samples from SRP048820 (ncbi.nlm.nih.gov/pubmed/25607463) and SRP056293 (ncbi.nlm.nih.gov/pmc/articles/PMC4676270/).
- Transcriptome samples included read through transcripts, products of trans-splicing, and chimeric transcripts formed as a result of genomic rearrangements. Chimeric transcripts were identified as recurrent if present in one or more of the FL transcriptome samples. Chimeric transcripts were identified as present in the sample if detected using two or more software programs, wherein the software programs were ChimeraScan, SOAPFuse, and Integrate.
- Neoantigenic peptides for each recurrent fusion protein having a predicted IC50 less than 500 nM to HLA class I proteins were selected.
- the prediction analysis can be performed using various length peptides, for example a peptide with 9 amino acids corresponding to 9 amino acids of the fusion junction.
- HLA class I alleles that bind to peptides with an IC 50 less than 500 nM are identified as binding (Table 3). All fusion-derived peptides were novel and could be placed into a vaccine library.
- Patients are eligible for vaccination if they have a gene fusion corresponding to a fusion-derived peptide in the library and if the patient has at least one MHC class I alleles capable of binding to the fusion-derived peptide in the library. Methods of selecting a patient for vaccination and vaccine compositions are described herein.
- HLA-A*02:01 HLA-A*02:02, HLA-A*02:03, HLA-A*02:06, BCAP29 AAV HLA-A*02:11, HLA-A*02:12, HLA-A*02:16, HLA-A*02:19, (SEQ ID NO.: 404) HLA-A*02:50, HLA-A*11:01, HLA-B*15:03, HLA-B*27:20, HLA-B*39:01 RRM2/ RLMLELGFSKVLGDREVQS 37 HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, C2orf48 RWSPGPRGDS
- Example 3 Fusion-Derived Peptides Having High Percentages of Patient Population Coverage
- Two fusion transcripts can be found in solitary fibrous tumors.
- the transcripts are formed from fusion of exon 4 of the Nab2 gene (5′ partner gene) with exon 2 of the Stat6 gene (3′ partner gene) and exon 6 of the Nab2 gene (5′ partner gene) with exon 16 of the Stat6 gene (3′ partner gene).
- the amino acid sequence of the Nab2/Stat6 fusion protein is shown below. A novel amino acid sequence is generated when exon 4 of Nab2 is fused with exon 2 of Stat6 because of the presence of an untranslated region at the beginning of exon 2 of Stat6. Exon 6 of the Nab2 gene is fused with exon 16 of the Stat6 gene in frame.
- Nab2/Stat6 Nab2/Stat6 (Nab2 exon 4 to Stat6 exon 2) fusion protein (COSF1547) (SEQ ID NO.: 408) MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQ RANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQ KALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGE KAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE EEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVE RIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV ARESTYLSSLKGSRLHPEELG
- neoantigenic peptides 8-11 amino acids
- MHC class I proteins MHC class I proteins
- a long peptide having a sequence PCVPAKPPLAGSPQIENIQP (SEQ ID NO: 614) was used for generating neoantigenic peptides having 8-11 amino acids for predicting peptide binding to MHC class I proteins.
- neoantigenic peptides comprising 8-11 amino acids was generated for all available MHC class I alleles using prediction algorithms described herein and filtering out of all epitopes with IC 50 >500 nM.
- Those MHC class I proteins that are able to effectively bind Nab/Stat6 fusion-derived neoepitopes are listed in the Table 4.
- the allele coverage was calculated to be 94% meaning that 94% of the population can effectively present neoantigenic peptides derived from the long peptide spanning the Nab2/Stat6 fusion breakpoint.
- the Nab2/Stat6 COSF1547 fusion incidence rate is around 34% in solitary fibrous tumors.
- the patient coverage of the fusion-derived long peptide from Nab2/Stat6 COSF1547 is around 32%.
- patient coverage of the fusion-derived long peptide is about 20%.
- Example 4 Prostate Cancer Vaccine Compositions Comprising TMPRSS2/ERG Fusion Peptides
- TMPRSS2/ERG fusion-derived neoantigens In total, 8 exonic variants of the TMPRSS2/ERG fusion from the COSMIC database were analyzed. The majority of the discovered antigenic peptides were not previously published. The TMPRSS2/ERG fusion is specific to prostate cancer and has quite a high incidence rate. The major protein coding exonic variant is estimated to be found in over 10% of cases. Further analysis showed that a vaccine based on TMPRSS2/ERG fusion-derived neoantigens can be used for about 20,000 prostate cancer patients a year in the USA.
- FUS/ERG fusion can be found, for example, in acute myeloid leukaemia and occurs due to fusion of exon 7 of the FUS gene with exon 11 of the ERG gene.
- the amino acid sequence of the FUS/ERG fusion protein is shown below.
- FUS/ERG Fus exon 7 to exon 11 of Erg fusion protein (COSF315) (SEQ ID NO.: 485) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQQSYSGYSQSTDTSGY GQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGY GQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQQSYGQQQSYN PPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQS GGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGG RGGMGGSDRGGFNKFGGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFK MTDPDEVARRWGERKSKPNM
- the fusion-derived long peptide having the sequence SDRGGFNKFGGSGQIQLWQF (SEQ ID NO: 615) was used for generating neoantigenic peptides (8-11 amino acids) for predicting peptide binding to MHC class I proteins. Results are shown in the Table 7. In the case of acute myeloid leukaemia, patient coverage of the fusion-derived long peptide is about 10%. Recurrent FUS/ERG fusion-derived long peptides are original and placed into the vaccine library.
- HLA class I Long peptide spanning neoantigenic peptides alleles that bind fusion breakpoint and (8-11 amino acids) neoantigens Fusion yielding neoantigens (SEQ ID NO.) (IC50 ⁇ 500 nM)
- FUS/ERG GPPLKKLKQE ATSKSQI MSLW GSGQIQLW (487) HLA-A*24:02 COSF315 GLVSKM KFGGSGQI (488) HLA-A*24:03 (SEQ ID NO.: 486)
- FGGSGQIQL 489) HLA-B*15:17 GGSGQIQLW (490) HLA-B*39:01 KFGGSGQIQL (491) HLA-B*57:01 KFGGSGQIQLW (492) HLA-B*58:01 NKFGGSGQIQL (493) HLA-C*
- Example 7 Peptides Corresponding to Multiple Gene Fusion Junctions Increase Patient Coverage
- FUS/DDIT3 fusions can be found, for example, in myxoid-round cell liposarcoma. The most frequent subtypes of this fusion are formed due to junction of exon 5 of Fus with exon 2 of DDIT3, exon 7 of Fus with exon 2 of DDIT3, and exon 8 of Fus with exon 2 of DDIT3.
- the amino acid sequences of the FUS/DDIT3 fusion proteins are shown below. In each fusion protein, a stop codon occurs soon after the breakpoint due to a frameshift. Neoantigens predictions were calculated using long peptides having 10 amino acids to the left and all amino acids to the right from the fusion junction.
- FUS/DDIT3 (Fus exon 5 to exon 2 of DDIT3) fusion protein (COSF300) (SEQ ID NO.: 494) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQQSYSGYSQSTDTSGY GQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGY GQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQQSYGQQQSYN PPQGYGQQNQYNSSSGGGGGGGGGVFKKEVYLHTSPHLKAD FUS/DDIT3 (Fus exon 7 to exon 2 of DDIT3) fusion protein (COSF302) (SEQ ID NO.: 495) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDT
- Fusion-derived long peptides that were used for generating neoantigenic peptides having 8-11 amino acids for predicting peptide binding to MHC class I are shown in Table 8.
- Patient coverage with three fusion-derived long peptides is around 50% for myxoid-round cell liposarcoma.
- Recurrent FUS/DDIT3 fusion-derived peptides spanning fusion breakpoints are original and placed into vaccine library.
- FUS/DDIT3 fusion-derived peptides predicted to bind HLA alleles.
- FUS/DDIT3 SGGGGGGGGGVFK HTSPHLKA (498) HLA-A*02:01, HLA-A*02:02, COSF300 KEVYLHTSPHLKAD KEVYLHTS (499) HLA-A*02:03, HLA-A*02:06, (SEQ ID NO.: 497) VFKKEVYL (500) HLA-A*02:11, HLA-A*02:17, VYLHTSPH (501) HLA-A*03:01, HLA-A*11:01, YLHTSPHL (502) HLA-A*23:01, HLA-
- the most comprehensive neoantigens were discovered by the disclosed method, namely two fusion peptides that are present in 68% of patients ( FIG. 4 ).
- the method described in the specification is applied to identification of BCR/ABL1 fusion peptides for the treatment of CML.
- Three breakpoints in BCR and ABL1 genes are marked with arrows in FIG. 4 . Fusion at these breakpoints yields two BCR/ABL1 gene fusions that are present in 90% of CML patients which comprises 45,000 patients in the U.S. and 950,00 patients worldwide (2).
- the method discloses two BCR/ABL1 fusion peptides selected based on allele coverage and patient coverage that are present in 68% of CML patients which means that 30,000 patients in the U.S. and 650,000 patients worldwide are eligible for treatment with a cancer vaccine comprising these two peptides shown in FIG. 4 .
- the sequences correspond to SEQ ID NOs: 610 to 611 from top to bottom, respectively.
- the COSMIC database contains over 18 exonic variants of the BCR/ABL1 fusion that were analyzed and yielded neoantigen peptides. Half of the fusion exonic variants yielded peptides that were not previously published. According to COSMIC, the fusion variants are found in CML and ALL (including T-ALL and B-ALL).
- EWSR1/FLI1 fusion can be found, for example, in Ewing's sarcoma. Two most frequent types of EWSR1/FLI1 fusions occur due to junction of exon 7 of the EWSR1 gene with exon 5 or exon 6 of the FLI1 gene. The amino acid sequences of the fusion proteins are shown below.
- EWSR1/FLI1 EWSR1 exon 7 to exon 6 of FLI1
- fusion protein COSF166
- SEQ ID NO.: 587 MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDV SYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDT TTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQ PQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQP TSYDQSSYSQQNTYGQPSSYGQQSSYGQQPSTSYPPQTGSYSQA PSQYSQQSSSYGQQNPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT EQRPQPDPYQILGP
- EWSR1/FLI1 fusion-derived peptides predicted to bind HLA alleles. Long peptide spanning HLA class I alleles fusion breakpoint and 8-11-mer neo- that bind neoantigens Fusion yielding neoantigens antigenic peptides (IC50 ⁇ 500 nM) EWSR1/FLI1 SQQSSSYGQQNPSYDSVRRG SSYGQQNPSY (591) HLA-A*11:01 COSF166 (SEQ ID NO.: 589) SYGQQNPSY (592) HLA-A*29:02 SSYGQQNPSY (593) HLA-A*31:01 YGQQNPSY (594) HLA-A*68:01 NPSYDSVR (595) HLA-B*15:01 QQNPSYDSV (596) HLA-B*35:01 NPSYDSVRR (597) HLA-C*12:03
- inventive embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed.
- inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein.
- a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
- the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
- This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified.
- “at least one of A and B” can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Mycology (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biochemistry (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- Hospice & Palliative Care (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
- This application claims the benefit under 35 U.S.C. § 119(e) of the filing date of U.S. provisional patent application Ser. No. 62/319,774, entitled “CONSTRUCTION AND METHODS OF USE OF A THERAPEUTIC CANCER VACCINE LIBRARY COMPRISING FUSION-SPECIFIC VACCINES,” filed Apr. 7, 2016, the entire contents of which are incorporated herein by reference.
- The methods described herein are directed toward the field of immunotherapy for cancer patients.
- Recent advances in personalized genomic sequencing and cancer genomic sequencing technologies have made it possible to obtain patient-specific information. This information can be used to prepare patient-specific medicines including patient-specific cancer vaccines that are developed based on the genome of the patient and the mutation information gathered from the patient's biological sample.
- Provided herein, inter alia, are methods for constructing therapeutic fusion-specific vaccine libraries, selecting a therapeutic fusion-specific vaccine for a cancer patient, and/or constructing a de novo therapeutic fusion-specific vaccine for patients having a gene fusion that is absent from a fusion-specific vaccine library.
- In some embodiments, the method provides compositions for providing therapeutic fusion-specific vaccine libraries that can be used as sources of vaccines for many cancer patients.
- In some aspects, the specification provides a method for constructing a therapeutic fusion-specific vaccine library for a cancer patient, the method comprising (a) identifying one or more tumor-specific gene fusions from publicly available data, (b) identifying one or more fusion junction sequences, wherein the fusion junction sequences comprise nucleic acid sequences and/or amino acid sequences corresponding to one or more tumor-specific gene fusions, (c) obtaining information relating to interaction between fusion junction sequences with one or more HLA alleles, and (d) selecting at least one fusion junction sequence for the therapeutic fusion-specific vaccine library.
- In some aspects, the specification provides a method for selecting a therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) analyzing a library of fusion-specific vaccines, wherein each fusion-specific vaccine in the library comprises one or more fusion junction sequences having a nucleic acid sequences and/or an amino acid sequence corresponding to one or more tumor-specific gene fusions, and (d) selecting at least one fusion-specific vaccine in the library as the therapeutic fusion-specific vaccine for the cancer patient by selecting the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- In some aspects, the specification provides a method for constructing a de novo therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) determining that the cancer patient's fusion junction sequence is not present in the library of fusion-specific vaccines, and (d) constructing at least one fusion-specific vaccine as the de novo therapeutic fusion-specific vaccine for the cancer patient by constructing the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- In some embodiments, the method further comprises administering the therapeutic fusion-specific vaccine to the cancer patient.
- In some embodiments, the biological sample is a tissue sample or fluid sample taken from the cancer patient. In some embodiments, the biological sample is analyzed by DNA sequencing, RNA sequencing, and/or protein sequencing. In some embodiments, one or more tumor-specific gene fusions are identified in the biological sample. In some embodiments, information relating to one or more HLA alleles of the cancer patient are obtained by analysis of the biological sample.
- In some embodiments, the fusion-specific vaccine comprises one or more nucleic acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides having amino acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides selected from Table A.
- In some embodiments, the fusion-specific vaccine comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 peptides corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises 20 or more peptides corresponding to one or more tumor-specific gene fusions.
- In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC50 less than 500 nM. In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC50 less than 250 nM. In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC50 less than 100 nM. In some embodiments, the fusion-specific vaccine comprises one or more peptides that bind to one or more HLA alleles of the cancer patient with an IC50 less than 50 nM.
- In some embodiments, the library of fusion-specific vaccines comprises at least 2-10 fusion-specific vaccines having distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises at least 5-10 fusion-specific vaccines corresponding to distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises at least 10-50 fusion-specific vaccines corresponding to distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises at least 50-100 fusion-specific vaccines corresponding to distinct fusion junction sequences. In some embodiments, the library of fusion-specific vaccines comprises 100 or more fusion-specific vaccines corresponding to distinct fusion junction sequences.
- In some embodiments, the fusion-specific vaccine comprises one or more peptides having 8-10 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 10-25 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 25-50 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 50-100 amino acids. In some embodiments, the fusion-specific vaccine comprises one or more peptides having 100 or more amino acids. In some embodiments, the fusion-specific vaccine comprises a combination of two or more peptides having numbers of amino acids described herein.
- In some embodiments, the fusion-specific vaccine comprises one or more peptides having an amino acid sequence corresponding to a one or more tumor-specific gene fusions and one or more addition amino acid sequences. In some embodiments, the fusion-specific vaccine comprises two or more peptides having an amino acid sequence corresponding to two or more tumor-specific gene fusions and one or more addition amino acid sequences.
- In some embodiments, the fusion-specific vaccine comprises one or more peptides having a modification. In some embodiments, the fusion-specific vaccine comprises one or more adjuvants. In some embodiments, the fusion-specific vaccine comprises the peptide having a concentration of 100 ng-10 mg.
- In some embodiments, the fusion-specific vaccine is administered once to the cancer patient. In some embodiments, the cancer patient is treated with two or more doses of the fusion-specific vaccine.
- In some embodiments, the library of fusion-specific vaccines comprises peptides having an amino acid sequence corresponding to gene fusions that are present in a type of cancer. In some embodiments, the type of cancer is melanoma, skin cancer, head and neck cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, thyroid cancer, kidney cancer, liver cancer, pancreatic cancer, gastric cancer, testicular cancer, brain tumor, glioma, glioblastoma, solitary fibrous tumor, bladder cancer, colorectal cancer, renal cell carcinoma, sarcoma, myeloma, leukemia, and/or lymphoma. In some embodiments, the type of cancer is a metastatic tumor. In some embodiments, the type of cancer is any tumor type.
- In some embodiments, the cancer patient is administered dendritic cells or other antigen presenting cells that have been pulsed with at least one fusion junction peptide having a sequence from the fusion-specific vaccine library. In some embodiments, the cancer patient is administered dendritic cells or other antigen presenting cells comprising at least one fusion junction peptide having a sequence from the fusion-specific vaccine library. In some embodiments, autologous T-cells can be collected from the cancer patient, stimulated ex vivo with fusion junction sequences, and stimulated autologous T-cells are transfused into the cancer patient.
- The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure, which can be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
-
FIG. 1 illustrates a non-limiting example of a typical strategy for generating personalized neoantigenic vaccines including 3 steps: (1) detection of mutations from sequencing data and mutation calling; (2) identification of personal neoantigens; and (3) vaccine composition. -
FIG. 2 illustrates a non-limiting example of a strategy for constructing a vaccine library comprising (1) screening of publicly available databases containing cancer sample sequences, information relating to genomic aberrations in cancer, and/or information relating to gene fusions in cancer; (2) extracting gene fusion incidence data; (3) analyzing fusion breakpoint peptides and MHC interaction; (4) selecting fusion breakpoint peptides based on affinity for MHC proteins; (5) calculating population coverage of selected peptides; and (6) incorporation of selected peptides into vaccine library. -
FIG. 3 illustrates a non-limiting scheme for selecting patients for treatment with a vaccine library comprising (1) examining patient's cancer genome for gene fusions; (2) determining patient's HLA genotype; (3) matching vaccine library to patient's gene fusion and HLA type, and (4) administering a vaccine from the vaccine library to the patient or de novo vaccine construction from the patient's tumor specific mutations or selection of another treatment. -
FIG. 4 shows a non-limiting example of a therapeutic cancer vaccine comprising BCR/ABL1 fusion peptides. The method described in the specification is applied to identification of BCR/ABL1 fusion peptides for the treatment of CML. Three breakpoints in BCR and ABL1 genes are marked with arrows (1). Fusion at these breakpoints yields two BCR/ABL1 gene fusions that are present in 90% of CML patients which comprises 45,000 patients in the U.S. and 950,00 patients worldwide (2). The method discloses two BCR/ABL1 fusion peptides selected based on allele coverage and patient coverage that are present in 68% of CML patients which means that 30,000 patients in the U.S. and 650,000 patients worldwide are eligible for treatment with a cancer vaccine comprising these two peptides (3). The sequences correspond to SEQ ID NOs: 610 to 611 from top to bottom, respectively. -
FIG. 5 shows a non-limiting example of an environment in which embodiments of the present methods may operate. -
FIG. 6 shows a non-limiting example of a data structure for storing data associated with one or more patients, in accordance with some embodiments of the present methods. -
FIG. 7 shows flow chart of an illustrative process for matching patient data and library data, in accordance with some embodiments of the present methods. -
FIG. 8 shows a block diagram of an illustrative computer system that may be used in implementing aspects of the present methods. - Applicant has recognized that patient-specific medicines, such as patient-specific vaccines, although effective, can be very expensive. As illustrated in
FIG. 1 , generating a patient specific vaccine typically involves a series of steps that are tailored for each individual patient, including detecting mutations from patient sequence data, identifying patient-specific neoantigens, and designing and synthesizing a patient-specific vaccine composition. In contrast, Applicant has developed methods and compositions for providing simple vaccine libraries that can be used as sources of vaccines for many cancer patients. Applicant has recognized that many cancers involve gene fusions, regardless of whether the cancers also include point mutations or other genetic rearrangements. Applicant has developed a method involving a vaccine library comprising a plurality of fusion junction sequences corresponding to the protein products of gene fusions associated with cancers in many patients. Aspects of the application are based, at least in part, on the recognition that gene fusions are present in many cancers and that a library of fusion-specific vaccines can be generated to represent a significant percentage of cancers without requiring de novo construction of personalized cancer vaccines for patients having cancers associated with these gene fusions. - Accordingly, aspects of the application relate to methods and compositions for providing fusion-specific cancer vaccines to patients without resorting to personalized vaccine development for each patient. In some embodiments, a library of fusion-specific vaccines is provided and a patient is evaluated to determine whether the patient will be responsive to at least one of the vaccines in the library. In some embodiments, the presence of one or more cancer-associated gene fusions is identified in the patient. In some embodiments, the HLA genotype of the patient is evaluated to determine whether the patient will be responsive to one or more fusion-specific vaccines corresponding to a cancer-associated gene fusion identified in the patient. In some embodiments, if the patient is determined to be responsive to at least one fusion-specific vaccine in the library, then one or more of the vaccines is administered to the patient. In some embodiments, if the patient is determined not to be responsive to at least one fusion-specific vaccine in the library, then a personalized vaccine can be prepared de novo for the patient.
- In some aspects, the specification provides a method for constructing a therapeutic fusion-specific vaccine library for a cancer patient, including (a) identifying one or more tumor-specific gene fusions from publicly available data, (b) identifying one or more fusion junction sequences, wherein the fusion junction sequences comprise nucleic acid sequences and/or amino acid sequences corresponding to one or more tumor-specific gene fusions, (c) obtaining information relating to interaction between fusion junction sequences with one or more HLA alleles, and (d) selecting at least one fusion junction sequence for the therapeutic fusion-specific vaccine library. For example,
FIG. 2 illustrates a non-limiting embodiment for constructing a vaccine library that includes screening publicly available databases containing cancer sample sequences, information relating to genomic aberrations in cancer, and/or information relating to gene fusions in cancer; extracting gene fusion incidence data; analyzing fusion breakpoint peptides and MHC interaction; selecting fusion breakpoint peptides based on affinity for MHC proteins; calculating population coverage of selected peptides; and incorporation of selected peptides into vaccine library. It should be appreciated that one or more of these steps may be omitted or modified depending on the vaccine library being developed. For example, sequence and related information can be obtained from any suitable source including public, private, customized, or other libraries containing cancer-related sequence information. In some embodiments, gene fusion incidence data does not need to be used. In some embodiments, population coverage does not need to be calculated. Accordingly, in some embodiments, a library can be designed by i) selecting fusion peptides of interest (e.g., based on one or more criteria, for example the types of cancer to be covered, the target patient population, the geographic region, the size and range of peptides to be included in the library, etc., or any combination thereof), and ii) obtaining or calculating MHC interaction information for those peptides. In some embodiments, the library can by synthesized or assembled using any suitable synthetic techniques (e.g., any suitable peptide chemistry, recombinant expression techniques, or any combination thereof). - In some aspects, the specification provides a method for selecting a therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) analyzing a library of fusion-specific vaccines, wherein each fusion-specific vaccine in the library comprises one or more fusion junction sequences having a nucleic acid sequences and/or an amino acid sequence corresponding to one or more tumor-specific gene fusions, and (d) selecting at least one fusion-specific vaccine in the library as the therapeutic fusion-specific vaccine for the cancer patient by selecting the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
FIG. 3 illustrates a non-limiting example of a method of selecting a vaccine for a patient from a vaccine library described in this application. In some embodiments, i) a patient's cancer genome (e.g., the genome of a cancer in the patient, for example obtained from a biopsy or other sample obtained from cancer tissue in the patient) is analyzed to detect the presence of one or more gene fusions, ii) the patient's HLA genotype is determined (e.g., by sequencing one or more HLA loci of the patient, or obtained from whole genome sequence data for the patient, and iii) the library and the patient's HLA genotype are evaluated to determine with the library contains one or more peptides that match the patient's HLA genotype (e.g., based on one or more matching criteria that can be selected by the user, for example by a physician or a healthcare organization). If the library contains one or more peptides that are suitable for the patient (e.g., that correspond to one or more tumor specific mutations/neoantigens and that are HLA matched, for example based on specified HLA match criteria), then a vaccine containing one or more of those peptides can be selected from the library and administered to the patient. In the event that the library does not contain any peptides that are suitable for the patient (e.g., based on the tumor specific mutations in the patient that are not represented in the library and/or based on a failure to meet the specified HLA match criteria) then a de novo vaccine can be designed and synthesized for the patient (e.g., based on the patient's tumor specific mutations/neoantigens and/or HLA type) and/or a different therapy can be selected for the patient. - In some aspects, the specification provides a method for constructing a de novo therapeutic fusion-specific vaccine for a cancer patient, the method comprising (a) determining the presence of one or more tumor-specific gene fusions in a biological sample from the cancer patient, (b) obtaining information relating to one or more HLA alleles of the cancer patient, (c) determining that the cancer patient's fusion junction sequence is not present in the library of fusion-specific vaccines, and (d) constructing at least one fusion-specific vaccine as the de novo therapeutic fusion-specific vaccine for the cancer patient by constructing the fusion-specific vaccine comprising (i) one or more fusion junction sequences corresponding to one or more tumor-specific gene fusions of the cancer patient, and (ii) one or more fusion junction sequences that bind one or more HLA alleles of the cancer patient.
- In some embodiments, the fusion-specific vaccine comprises one or more nucleic acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides having amino acid sequences corresponding to one or more tumor-specific gene fusions. In some embodiments, the fusion-specific vaccine comprises one or more peptides selected from Table A. In some embodiments, one or more of the peptides listed in Table A is included in a peptide vaccine library. In some embodiments, one or more peptides in a peptide vaccine library consists of or includes a fragment of a peptide listed in Table A. In some embodiments, a fragment includes at least one amino acid (e.g., at least 2, 3, 4, 5 or more amino acids) from the N-terminal portion of a fusion peptide and at least one amino acid (e.g., at least 2, 3, 4, 5 or more amino acids) from the C-terminal portion of a fusion peptide. A vaccine library can include a plurality separate receptacles each containing a different peptide or a different combination of two or more peptides. Accordingly, a library can be a collection of receptacles, for example, wells, vials, tubes, or other containers capable of storing one or more different peptides, for example in the form of dry preparations (e.g., powder or crystalline form), liquid preparations (e.g., aqueous, organic, or other solutions), suspensions, or a combination thereof in different containers. In some embodiments, the receptacles are separate. In some embodiments, the receptacles are connected (e.g., in the form of an array, for example a 2D array). Receptacles can be made of any suitable material (e.g., glass, plastic, polymer, or other suitable material). In some embodiments, different peptides may be provided in different solutions (e.g., different salt concentrations, different pHs, etc.) depending on their solubility properties. Peptides in receptacles in a library can be provided at any suitable concentration (for example, nanomolar (e.g., from 1-1,000 nM), micromolar (e.g., from 1-1,000 μM), millimolar (e.g., 1-1,000 mM), or molar (e.g., 1M or higher)). Different peptides may be provided at different concentrations. In some embodiments, a peptide in a library is in a solution without an adjuvant or other agent, and an adjuvant or other agent may be added when the vaccine is prepared. However, in some embodiments, a peptide preparation in a library may also contain an adjuvant and/or other agent (e.g., a solubilizing or stabilizing agent, a therapeutic agent, or other agent).
- Once a suitable combination of peptides has been determined or selected for a patient as described in this application, a vaccine can be prepared for the patient by retrieving (e.g., using a pipette or other suitable device for transferring the peptide(s)) from the appropriate library receptacles an appropriate amount of the one or more peptides that were identified to be suitable for that patient. The resulting combination of peptide(s) can be transferred to one or more suitable containers (e.g., syringes, infusion pumps, etc.) for administration to the patient. During this process, a peptide solution from the library may be diluted (e.g., around 5×, 10×, 100×, or other dilution) in a physiologically acceptable buffer for administration to a patient. An adjuvant also may be added at this stage. This procedure can be followed for a plurality of patients, for example at a hospital or other medical center.
- Accordingly, in some embodiments a library can include a plurality (e.g., all, or a subset of) the peptides in Table A and a vaccine can be selected from that library based on the criteria described in this application. However, other libraries can be used (e.g., containing one or more of the peptides listed in Table A, and/or one or more other neoantigenic peptides) as described in this application.
-
TABLE A Peptides for vaccine library. SEQ ID NO. Long peptide for vaccine Exons Fusion name 1 AIKSKNVDVNVKDEETEVKSEEGPGWTILR E5:E5 ACBD6/RRP15 2 EAPLNPKANREKMTQDPLLGMLDGREDLER E3:E7 ACTB/GLI1 3 EAPLNPKANREKMTQPISGIPSPDESPKRA E3:E5 4 EAPLNPKANREKMTQLKSELDMLVGKCREE E3:E6 5 PRAVFPSIVGRPRHQLKSELDMLVGKCREE E2:E6 6 QTKVLSASQAFAAQRDSITQHKVCAPENYL E5:E14 AGPAT5/MCPH1 7 NDKLQKELNVLKSEQDLIRDQGFRGDGGST E8:E9 AKAP9/BRAF 8 QERERDPQQEQERERIDDVIDEIISLESSY E7:E5 ASPSCR1/TFE3 9 QERERDPQQEQERERLPVSGNLLDVYSSQG E7:E6 10 SSQKAHGILARRPSYRTHG E3:E10 ATF1/EWSR1 11 MSVPTPIYQTSSGQYSSFRQDHPSSMGVYG E4:E8 12 RNVQDFKRASEEITKTTQDGLDWLIST E10:E11 ATG4C/FBX038 13 TPAQLYTLQPKLPITVYRRKHQELQAMQME E7:E20 ATIC/ALK 14 TQLPHIPVAVRVGCLQYYRTDSDNQAILSE E9:E21 BBS9/PKD1L1 15 KTRVYRDTAEPNWNEKPFSGQ E15:E2 BCR/ABL1 16 RKQTGVFGVKIAVVTKSPSAASSI E18:E2 17 EITPRRQSMTVKKGESYTFLISSDYERAEW E8:E12 18 KLQTVHSIPLTINKEAGSIEALQRPVASDF E13:E2 19 KTRVYRDTAEPNWNELDPQALQDRDWQRTV E15:E17 20 QWSHQQRVGDLFQKLNLRARSNKDAKDPTT E4:E6 21 SRDALVSGALESTKATKAKPFSGQ E2:E2 22 SNKDAKDPTTKNSLEKALQRPVASDFEPQG E6:E2 23 ASEETYLSHLEALLLKPFSGQ E3:E2 24 EITPRRQSMTVKKGEKPFSGQ E8:E2 25 KLQTVHSIPLTINKEGEKLRVLGYNHNGEW E13:E3 26 GVATDIQALKAAFDVRPSPCEDRHWPGLAL E19:E1 27 GVATDIQALKAAFDVKALQRPVASDFEPQG E19:E2 28 QIWPNDGEGAFHGDAGEKLRVLGYNHNGEW E1:E3 29 LNVIVHSATGFKQSSSEKLRVLGYNHNGEW E14:E3 30 LNVIVHSATGFKQSSKALQRPVASDFEPQG E14:E2 31 KLQTVHSIPLTINKEEALQRPVASDFEPQG E13:E2 32 QIWPNDGEGAFHGDAEALQRPVASDFEPQG E1:E2 33 QIWPNDGEGAFHGDADYELLTENDMLPNMR E1:E19 BCR/JAK2 34 QIWPNDGEGAFHGDAVLQERIPWVPPECIE E1:E17 35 APNVHINTIEPVNIDNDLRLQMEAQRICLS E8:E9 BRAF/AKAP9 36 RYVKSCLQKKQRKPFSSALPGPDMSMKPSA E10:E2 BRD3/NUTM1 37 SSSESSSSDSEDSETASALPGPDMSMKPSA E11:E2 38 SEFREGVRKIAREQKVYRRKHQELQAMQME E17:E20 CARS/ALK 39 LQEENRDLRKASVTIEDPKWEFPRKNLVLG E1:E12 CCDC6/RET 40 EEEFLTNELSRKLMQEDPKWEFPRKNLVLG E2:E12 41 SRHSLEQKPTDAPPKVVVHRRLKNQKSAKEG E6:E35 CD74/ROS1 42 SRHSLEQKPTDAPPKAGVPNKPGIPKLLEG E6:E32 43 SRHSLEQKPTDAPPKDDFWIPETSFILTII E6:E34 44 VHPDALNRFGKTALQLHVHACLLTRKQEDC E2:E3 CDKN2D/WDFY2 45 VHPDALNRFGKTALQLHVHACLLTRKQEDC E2:E3 46 VHPDALNRFGKTALQLHVHACLLTRKQEDC E2:E3 47 LAENITQERDSLMCLDLIRDQGFRGDGGST E16:E9 CEP89/BRAF 48 TQEEEDEILPRKDYEKTLGRRDSSDDWEIP E2:E11 CLCN6/BRAF 49 EERSVLNNQLLEMKKSTLPTQEEIENLPAF E20:E36 CLIP1/ROS1 50 RKEEEQATETQPIVYVYRRKHQELQAMQME E31:E20 CLTC/ALK 51 AMPYFIQVMKEYLTKGVYRRKHQELQAMQM E30:E20 52 AMPYFIQVMKEYLTKCTAGSTRSCKPCRWS E30:E20 53 CVAYERGQCDLELINLPVSGNLLDVYSSQG E17:E6 CLTC/TFE3 54 GKAGERGVPGPPGAVGDPIPEELYEMLSDH E26:E2 COL1A1/PDGFB 55 GPSGPRGLPGPPGAPGDPIPEELYEMLSDH E7:E2 56 GAPGAKGARGSAGPPGDPIPEELYEMLSDH E37:E2 57 GPSGPAGPTGARGAPGDPIPEELYEMLSDH E34:E2 58 GPPGPAGPAGPPGPIGDPIPEELYEMLSDH E36:E2 59 GPPGPRGRTGDAGPVGDPIPEELYEMLSDH E47:E2 60 GPAGPPGFPGAVGAKGDPIPEELYEMLSDH E16:E2 61 GPRGANGAPGNDGAKGDPIPEELYEMLSDH E31:E2 62 GKPGRPGERGPPGPQGDPIPEELYEMLSDH E10:E2 63 YDEKSTGGISVPGPMGDPIPEELYEMLSDH E6:E2 64 GPQGPGGPPGPKGNSGDPIPEELYEMLSDH E19:E2 65 GLPGTAGLPGMKGHRGDPIPEELYEMLSDH E11:E2 66 GNPGADGQPGAKGANGDPIPEELYEMLSDH E18:E2 67 KRHVWFGESMTDGFQGDPIPEELYEMLSDH E49:E2 68 RTCRDLKMCHSDWKSGGPHSRGAL E48:E2 69 GFQGPPGEPGEPGASGDPIPEELYEMLSDH E8:E2 70 GEPGSPGENGAPGQMGDPIPEELYEMLSDH E13:E2 71 GHRGFSGLQGPPGPPGDPIPEELYEMLSDH E45:E2 72 GPIGPPGPAGAPGDKGDPIPEELYEMLSDH E33:E2 73 GQAGVMGFPGPKGAAGDPIPEELYEMLSDH E25:E2 74 PPGPPGPPGPPGLGGGDPIPEELYEMLSDH E5:E2 75 GKDGEAGAQGPPGPAGDPIPEELYEMLSDH E27:E2 76 GQRGERGFPGLPGPSGDPIPEELYEMLSDH E40:E2 77 GPPGLAGPPGESGREGDPIPEELYEMLSDH E41:E2 78 GPAGPVGPVGARGPAGDPIPEELYEMLSDH E44:E2 79 GVPGDLGAPGPSGARGDPIPEELYEMLSDH E30:E2 80 GLPGERGRPGAPGPAGDPIPEELYEMLSDH E14:E2 81 GPAGEKGSPGADGPAGDPIPEELYEMLSDH E39:E2 82 GARGNDGATGAAGPPGDPIPEELYEMLSDH E15:E2 83 GEPGPPGPAGAAGPAGDPIPEELYEMLSDH E17:E2 84 GAPGSKGDTGAKGEPGDPIPEELYEMLSDH E20:E2 85 GAEGSPGRDGSPGAKGDPIPEELYEMLSDH E42:E2 86 GEAGRPGEAGLPGAKGDPIPEELYEMLSDH E23:E2 87 GFPGAAGRVGPPGPSGDPIPEELYEMLSDH E38:E2 88 GPAGPPGEAGKPGEQGDPIPEELYEMLSDH E29:E2 89 GEQGPSGASGPAGPRGDPIPEELYEMLSDH E46:E2 90 GPVGPAGKSGDRGETGDPIPEELYEMLSDH E43:E2 91 GERGAAGLPGPKGDRGDPIPEELYEMLSDH E32:E2 92 THGQEEGQVEGQDEDRWTVV E1:E2 COL1A1/USP6 93 THGQEEGQVEGQDEDTKNTIK E1:E1 94 TLLLLAVTLCLATCQYVVPKWEGLDSTLFHE E1:E3 COL1A2/PLAG1 95 TLLLLAVTLCLATCQCCLLVLPWPYLAPRM E1:E2 96 APSALSSSPLLTAPHRK E5:E7 CREB3L2/FUS 97 APSALSSSPLLTAPHVTMAKINPP E5:E6 98 ELSEPGDGEALMYHTALGTKDHVMTPNRII E1:E8 99 ELSEPGDGEALMYHTALGTKDHVMTP E1:E8 100 TRAFEQLMTDLTLSRLQGSLKRKQVVNLSP E1:E2 CRTC3/MAML2 101 SPPWDQDRRMMFPPPGILTNVI E20:E10 CTAGE5/SIP1 102 PPPSGIATLVSGIAGVYRRKHQELQAMQME E26:E20 DCTN1/ALK 103 DCVLVLLLMPRLICKCTAGSTRSCKPCRWS E16:E20 104 RHLVFPLLEFLSVKELVMYQIPFARVVCLV E1:E3 EIF3E/RSPO2 105 RHLVFPLLEFLSVKEVRGGEMLIALN E1:E2 106 NKYIMSNSGDYEILYLYRRKHQELQAMQME E20:E20 EML4/ALK 107 ILRGTFNDGFQIEVQCTAGSTRSCKPCRWS E15:E20 108 HTDGNEQLSVMRYSIVYRRKHQELQAMQME E18:E20 109 VTKTADKHKDVIINQVSPTPEPHLPLSLIL E6:E19 110 SEDHVASVKKSVSSKVYRRKHQELQAMQME E2:E20 111 IILWDHDLNPEREIECTAGSTRSCKPCRWS E14:E20 112 WSKTTVEPTPGKGPKVYRRKHQELQAMQME E13:E20 113 VTKTADKHKDVIINQVYRRKHQELQAMQME E6:E20 114 STSTQSKSSSGSAHFGPPRMQWRSPPG E10:E2 EPC1/PHF1 115 ECEQAERLGAVDESLRKYIFKPRTV E5:E5 ERO1L/FERMT2 116 ALRMEEDSIRLPAHLPKNRGIAIPVDLDSQ E2:E35 ETV6/ITPR2 117 IHTQPEVILHQNHEEGRKHPYSWECMCQKY E4:E16 ETV6/JAK2 118 IHTQPEVILHQNHEEVLQERIPWVPPECIE E4:E17 119 VSPPEEHAMPIGRIADYELLTENDMLPNMR E5:E19 120 VSPPEEHAMPIGRIADKSNLLVFRTNGVSD E5:E12 121 VSPPEEHAMPIGRIADVQHIKRRDIVLKRE E5:E15 ETV6/NTRK3 122 IHTQPEVILHQNHEEGPVAVISGEEDSASP E4:E14 123 VSPPEEHAMPIGRIAGPVAVISGEEDSASP E5:E14 124 IHTQPEVILHQNHEEDVQHIKRRDIVLKRE E4:E15 125 APSQYSQQSSSYGQQIAIAPNGALQLASPG E7:E5 EWSR1/ATF1 126 APSQYSQQSSSYGQQKKLLENVAERRKNM E7:E7 127 GMGSAGERGGFNKPGEKF E9:E4 128 GGMSRGGRGGGRGGMGKILKDLSSEDTRGR E8:E4 129 APSQYSQQSSSYGQQIAITQGGAIQLANNG E7:E7 EWSR1/CREB1 130 NKPGGPMDEGPDLDLVFKKEVYLHTSPHLK E10:E2 EWSR1/DDIT3 131 LPPREGRGMPPPLRGVFKKEVYLHTSPHLK E13:E2 132 APSQYSQQSSSYGQQMFKKEVYLHTSPHLK E7:E2 133 APSQYSQQSSSYGQQTAQPSPSTVPKTEDQ E7:E9 EWSR1/ERG 134 APSQYSQQSSSYGQQNPYQILGPTSSRLAN E7:E10 135 NKPGGPMDEGPDLDLDLPYEPPRRSAWTGH E10:E8 136 APSQYSQQSSSYGQQSSGQIQLWQFLLELL E7:E11 137 APSQYSQQSSSYGQQNLPYEPPRRSAWTGH E7:E8 138 APSQYSQQSSSYGQQRDIKQEPGMYREGPT E7:E12 EWSR1/ETV1 139 NKPGGPMDEGPDLDLDPVGDGLFKDGKNPS E10:E2 EWSR1/FEV 140 APSQYSQQSSSYGQQNPVGDGLFKDGKNPS E7:E2 141 GGMSRGGRGGGRGGMGIPVTASLPPLEWPL E8:E3 EWSR1/NFATC2 142 YEDPPTAKAAVEWFDDMPCVQAQYSPSPPG E12:E3 EWSR1/NR4A3 143 APSQYSQQSSSYGQQRPMDEGPDLDLGPPV E7:E10 144 GMGSAGERGGFNKPGGPPVDPDEDSDNSAI E9:E11 145 LPPREGRGMPPPLRGDMPCVQAQYSPSPPG E13:E3 146 NKPGGPMDEGPDLDLDMPCVQAQYSPSPPG E10:E3 147 YEDPPTAKAAVEWFDEPTAEEGSPASPGPE E12:E2 148 APSQYSQQSSSYGQQKPTAEEGSPASPGPE E7:E2 149 APSQYSQQSSSYGQQSGRDGISTSKRQKS E7:E5 EWSR1/PBX1 150 GGMSRGGRGGGRGGMGRKRRNFNKQATEIL E8:E5 151 APSQYSQQSSSYGQQNVKWGKLRDYQVRGL E7:E5 EWSR1/SMARCA5 152 GGMSRGGRGGGRGGMGGTNLGKKKQHICHI E8:E6 EWSR1/SP3 153 YGQTAYATSYGQPPTEGTSTGYTTPTAPQA E4:E5 EWSR1/WT1 154 AYPAYGQQPAATAPTSSAGERGGFNKPG E5:E9 155 AYPAYGQQPAATAPTSYSSTQPTSYDQSSY E5:E7 156 APSQYSQQSSSYGQQNEKKDIDHETVVEEQ E7:E2 EWSR1/YY1 157 GGMSRGGRGGGRGGMGRHRPWG E8:E5 EWSR1/ZNF444 158 LRLQDYEEKTKKAERDDFWIPETSFILTII E10:E34 EZR/ROS1 159 TSSLHGSSLHRPSTEDLIRDQGFRGDGGST E2:E9 FAM131B/BRAF 160 MGCIGSRTVGSTTGLSATPPASLPG E1:E10 161 STEQTRTDFSWDGINDLIRDQGFRGDGGST E3:E9 162 MASSGERTPSNALDPRWRSLW E1:E17 FBXL18/RNF216 163 RLSEARLSQRDLSPTDLIRDQGFRGDGGST E13:E9 FCHSD1/BRAF 164 ATLCTARPSPTLPEQDWPKWEGLDSTLFHE E2:E3 FGFR1/PLAG1 165 ATLCTARPSPTLPEQGCLLVLPWPYLAPRM E2:E2 166 LVEDLDRIVALTSNQGLLESSAEKAPVSVS E17:E7 FGFR1/TACC1 167 ARDIHHIDYYKKTTNLDAKKSPLALLAQTC E14:E2 FGFR1/ZNF703 168 LVEDLDRVLTVTSTDNVMEQFNPGLRNLIN E17:E2 FGFR3/BAIAP2L1 169 LVEDLDRVLTVTSTDFKESALRKQSLYLKF E17:E8 FGFR3/TACC3 170 LVEDLDRVLTVTSTDVPGPPPGVPAPGGPP E17:E10 171 LVEDLDRVLTVTSTDVKATQEENRELRSRC E17:E11 172 RKAGDFHRNDSIYEEPQQVVQKKPAQEETE E8:E4 FHIT/HMGA2 173 YFKDKGDSNSSAGWKVMGLLTNHGGVPHQP E1:E8 FOXO1/PAX3 174 QYNSSSGGGGGGGGGVAIAPNGALQLASPG E5:E5 FUS/ATF1 175 EPRGRGGGRGGRGGMGPSGPPAFAAHPSEQ E6:E5 FUS/CREB3L2 176 EPRGRGGGRGGRGGMGNCRDQALWS E6:E6 177 EPRGRGGGRGGRGGMGPQWTTCICRPPLRA E6:E5 178 EPRGRGGGRGGRGGMGCLPSGPPAFAAHPS E6:E5 179 QYNSSSGGGGGGGGGAPVDHLHLPPTPPSS E5:E5 180 QYNSSSGGGGGGGGGETAGIRPSGPDRGGE E5:E6 181 GGMGGSDRGGFNKFGAPVDHLHLPPTPPSS E7:E5 182 QYNSSSGGGGGGGGGVFKKEVYLHTSPHLK E5:E2 FUS/DDIT3 183 EPRGRGGGRGGRGGMGVQEGSVSSYITTPE E6:E2 184 GGMGGSDRGGFNKFGVFKKEVYLHTSPHLK E7:E2 185 GYGQSSYSSYGQSQNMFKKEVYLHTSPHLK E3:E2 186 FNRGGGNGRGGRGRGVFKKEVYLHTSPHLK E11:E2 187 IESVADYFKQIGIIKTDPTAEMAAESLPFS E9:E3 188 NKFGGPRDQGSRHDSVFKKEVYLHTSPHLK E8:E2 189 EPRGRGGGRGGRGGMGGSDRGGFNKFG E6:E7 FUS/ERG 190 GGMGGSDRGGFNKFGDLPYEPPRRSAWTGH E7:E8 191 NKFGGPRDQGSRHDSAAQPSPSTVPKTEDQ E8:E9 192 QYNSSSGGGGGGGGGDLPYEPPRRSAWTGH E5:E8 193 GGMGGSDRGGFNKFGDPYQILGPTSSRLAN E7:E10 194 GGMGGSDRGGFNKFGGSGQIQLWQFLLELL E7:E11 195 EPRGRGGGRGGRGGMGQWPDPALAVPPGAP E6:E11 196 FDDPPSAKAAIDWFDDPVGDGLFKDGKNPS E10:E2 FUS/FEV 197 RAENACVPPFTIEVKKTLGRRDSSDDWEIP E2:E11 GATM/BRAF 198 PLEGDMSSPNSTGIQIMFETFNTPAMYVAI E6:E4 GLI1/ACTB 199 MIPHPQSRGPFPTCQIMFETFNTPAMYVAI E5:E4 200 GKPRNVALITGITGQPLHICQP E1:E22 GMDS/PDE8B 201 EDGEKAAREVKLLLLGSTTGLSATPPASLP E1:E10 GNAI1/BRAF 202 QKLMGQIHQLRSELQEDPKWEFPRKNLVLG E7:E12 GOLGA5/RET 203 GARLAAKYLDKELAGSTLPTQEEIENLPAF E4:E36 GOPC/ROS1 204 GASCKDTSGEIKVLQVWHRRLKNQKSAKEG E8:E35 205 LINIMIEPQATRKAQDAIRSHSESASPSAL E16:E8 HACLI/RAFI 206 EVLRNLSSPGWENISSLLFVSKFFEHHPIP E4:E7 HERPUDI/BRAF 207 MTVDHLKMLHTAGGKAFNNPRPGQLGRLLP E4:E13 HEY1/NCOA2 208 VVASTISGKSQIEETVYRRKHQELQAMQME E28:E20 HIP1/ALK 209 KKHYELAGVAEGWEEVYRRKHQELQAMQME E30:E20 210 HGATTCLRAPPEPADLYRRKHQELQAMQME E21:E20 211 SDSAQGSDVSLTACKDDFWIPETSFILTII E9:E34 HLA-A/ROS1 212 EATGEKRPRGRPRKWVTVKVPQKNS E3:E13 HMGA2/ALDH2 213 PKGSKNKSPSKAAQKVHQERLYQEYNFSKA E2:E6 HMGA2/CCNB1IP1 214 EATGEKRPRGRPRKWNFFRLNYLEVCH E3:E4 HMGA2/COX6C 215 EATGEKRPRGRPRKWVVVSTTVNVDGHVLA E3:E8 HMGA2/EBF1 216 EATGEKRPRGRPRKWLQKHDKEDFPASWRS E3:E9 HMGA2/FHIT 217 EATGEKRPRGRPRKWGSVKSAGPTTAREQV E3:E4 HMGA2/LHFP 218 PRKWPQQVVQKKPAQSWYLG E4:E12 HMGA2/NFIB 219 EATGEKRPRGRPRKWSWYLG E3:E12 220 EATGEKRPRGRPRKWVILTNQITTHLSGAL E3:E8 HMGA2/RAD51B 221 EATGEKRPRGRPRKWLSASLAVVHMEPAMN E3:E9 HMGA2/WIF1 222 EATGEKRPRGRPRKWGTKPASYMP E3:E10 223 EATGEKRPRGRPRKWAEYFYEFLSLRSLDK E3:E3 224 EATGEKRPRGRPRKWLFKLVSHVLENRMGW E3:E4 225 PRKWPQQVVQKKPAQGTKPASYMP E4:E10 226 MESQRGRNCNEKPTNVR E1:E4 HNRNPA2B1/ETV1 227 KANAARSQLETYKRQEDPKWEFPRKNLVLG E11:E12 HOOK3/RET 228 SRSPPAENEVSTPMQKKKGGRGLMTENTMR E7:E3 IL6R/ATP8B2 229 SVEGVVRILLEHYYKAWKKRWFILRSGRMS E2:E2 INTS4/GAB2 230 SFRAIIRDLNSLFTPDCRLLWDYVYQLLSD E18:E6 JAK2/ETV6 231 NIIFQFTKCCPPKPKETGSDFSMFEALRDT E11:E25 JAK2/PCM1 232 SPKDFNKYFLTFAVEEAESGNISQKSDEED E10:E37 233 PPITPSSSFRSSTPTGPPRMQWRSPPG E3:E2 JAZF1/PHF1 234 PPITPSSSFRSSTPTEPTQIYRFLRTRNLI E3:E2 JAZF1/SUZ12 235 DLAEIGIAVGNNDVKEDPKWEFPRKNLVLG E15:E12 KIF5B/RET 236 VRSKNMARRGHSAQIDPLCDELCRTVIAAA E24:E11 237 LRKLFVQDLATRVKKEDPKWEFPRKNLVLG E22:E12 238 FLENNLEQLTKVHKQEDPKWEFPRKNLVLG E23:E12 239 VRSKNMARRGHSAQIDVAEEAGCPLSCAVS E24:E8 240 ENEKELAACQLRISQEDPKWEFPRKNLVLG E16:E12 241 EILTRAHEREFGSVDVYRRKHQELQAMQME E9:E20 KLC1/ALK 242 TLEGELHDLRGQVAKTLTAHLETRWRRRTK E2:E10 LMNA/NTRK1 243 TSSGAGFFLPQHDSSVWHRRLKNQKSAKEG E16:E35 LRIG3/ROS1 244 RGGRGGREFADFEYRDLIRDQGFRGDGGST E9:E9 LSM14A/BRAF 245 RKDEELTSSQRDLAVRDLKLDNILLDAEGH E6:E12 MBOAT2/PRKCE 246 QKKKAKSQQYKGHKKRTGWAPPTFLLYQFA E16:E1 MBTD1/CXorf67 247 SHHSSHKKRKNKNRHRPPQDAMAQPPRLSR E5:E2 MEAF6/PHF1 248 VLHPMDAAQRSQHIKKTLGRRDSSDDWEIP E4:E11 MKRN1/BRAF 249 KNLLEFAETLQFIDSFLNTSSNHENSDLEM E9:E11 MYB/NFIB 250 AFTVPKNRSLASPLQSWYLG E15:E12 251 AFTVPKNRSLASPLQPNGSGQVVGKVPGHF E15:E9 252 AFTVPKNRSLASPLQSSQLELHLHLHRCHF E15:E8 253 LMSTENELKGQQVLPLRICDWTMNQNGRHL E8:E11 254 AFTVPKNRSLASPLQPTQPQAHLKPIDMWD E15:E10 255 AFTVPKNRSLASPLQLRICDWTMNQNGRHL E15:E11 256 LMSTENELKGQQVLPPNGSGQVVGKVPGHF E8:E9 257 FQENGPPLLKKIKQESWYLG E13:E12 258 FQENGPPLLKKIKQELRICDWTMNQNGRHL E13:E11 259 LMSTENELKGQQVLPSWYLG E8:E12 260 EALNHRIVQQAKEMTVWHRRLKNQKSAKEG E23:E35 MYO5A/ROS1 261 FDSKRREGKQLSLHEATSKSQIMSLWGLVS E2:E2 NAB2/STAT6 262 DSASLSGESLDGHLQAEQMGKDGRGYVPAT E5:E17 263 QVARESTYLSSLKGSRQPPSPRSCLCGVWS E3:E2 264 QVARESTYLSSLKGSRPQVYPPHSHSIPPY E3:E19 265 DSASLSGESLDGHLQGTNHFLPQSSRCLPW E5:E18 266 PEELGGPPLKKLKQEGPTTSYPRAPDAYHG E4:E18 267 FDSKRREGKQLSLHECLCTA E2:E6 268 QVARESTYLSSLKGSRDQPLPTPELQMPTM E3:E18 269 PEELGGPPLKKLKQEGVPGRLRRLLLQLG E4:E3 270 QVARESTYLSSLKGSRPHLQMPPSLGQMSL E3:E20 271 DSASLSGESLDGHLQGSPQIENIQPFSAKD E5:E16 272 QVARESTYLSSLKGSS E3:E17 273 PEELGGPPLKKLKQEATSKSQIMSLWGLVS E4:E2 274 PEELGGPPLKKLKQESIYQRDPLKLVATFR E4:E4 275 FDSKRREGKQLSLHEFRHLPMPFHWKQEEL E2:E5 276 VGRLSPCVPAKPPLAAEQMGKDGRGYVPAT E6:E17 277 VGRLSPCVPAKPPLAGNLQVPDHVSVGSGL E6:E2 278 VGRLSPCVPAKPPLAGSPQIENIQPFSAKD E6:E16 279 PEELGGPPLKKLKQEFLFSVSSELQGGTWV E4:E1 280 VGRLSPCVPAKPPLAGTNHFLPQSSRCLPW E6:E18 281 PSRKPLDSRVLNAVKYYGTAANDIGDTTNR E4:E13 NACC2/NTRK2 282 KGETITGLLQEFDVQEALSVVSEDQSLFEC E3:E4 NDRG1/ERG 283 DVDLAEVKPLVEKGEEALSVVSEDQSLFEC E2:E4 284 PIAMALANVVPCSQWVFTKYGKCYMFNSGE E27:E2 NF1/ACCN1 285 PPTWPKPLVPAIPICSSAGERGGFNKPGGP E2:E9 NFATC2/EWSR1 286 MRRQQEGFKGTFPDALPVSGNLLDVYSSQG E9:E6 NONO/TFE3 287 GEVDADCMDVNVRGPAGPSRTGYLHPPSPG E30:E14 NOTCH1/GABBR2 288 KCGSGPVHISGQHLVVYRRKHQELQAMQME E5:E20 NPM1/ALK 289 VAPPTTAASSVEEPEGHRESNSRLPGPPEG E5:E11 NTN1/ACLY 290 FMDNPFEFNPEDPIPDKLKCTKEEHLCTQR E9:E8 NTRK1/TPM3 291 PQYFRQGHNCHKPDTYCRLLWDYVYQLLSD E14:E6 NTRK3/ETV6 292 MDRDLSYNLLEDLPSFSV E1:E12 NUP107/LGR5 293 SNPMNPTIGNGLSPQNSIRHNLSLHSKFIR E7:E2 PAX3/FOXO1 294 SNPMNPTIGNGLSPQFTADLDQFDQLLPTL E7:E14 PAX3/NCOA1 295 YQLSETSYQPTSIPQGLPELELEAIDNQFG E6:E15 296 SNPMNPTIGNGLSPQPGSELDNLEEILDDL E7:E12 PAX3/NCOA2 297 PSNHMNPVSNGLSPQNSIRHNLSLHSKFIR E7:E2 PAX7/FOXO1 298 LGRNLSTHQTYPVVAGREMVGPTLPGYPPH E8:E10 PAX8/PPARG 299 AGSPDTESPVLVNDYRENVIEYKHCLITKN E36:E11 PCM1/JAK2 300 AGSPDTESPVLVNDYEIELSSLREALSFVS E36:E9 301 LEKIIKCNRSTEISSVLQERIPWVPPECIE E24:E17 302 KKRNSTQLKSRVKNINKSNLLVFRTNGVSD E23:E12 303 NSELTPSESLATTDDEIELSSLREALSFVS E26:E9 304 RQIKAIMKEVIPFLKEDPKWEFPRKNLVLG E29:E12 PCM1/RET 305 GVACEPLPDRYTVSEESNGWK E13:E4 PLXND1/TMCC1 306 LQPMAGTCPAPEIHAIERLEVSSLAQTSSA E12:E4 307 DSERLQYEKKLKSTKCTAGSTRSCKPCRWS E8:E20 PPFIBP1/ALK 308 YKKMQDTVVLAQGKKVYRRKHQELQAMQME E12:E20 PPFIBP1/ALK 309 LVCKMKGEGVEIVDRVWHRRLKNQKSAKEG E9:E35 PPFIBP1/ROS1 310 KEPVKIAAPELHKGDVQTHLENPTRYHLQQ E1:E4 PRCC/TFE3 311 PQEIAPDASFIDDEAVQTHLENPTRYHLQQ E4:E4 312 DSEEDEPTKKKTILQLPVSGNLLDVYSSQG E2:E6 313 KEPVKIAAPELHKGDIDDVIDEIISLESSY E1:E5 314 KLWGIDRDSYRRILMEDPKWEFPRKNLVLG E7:E12 PRKAR1A/RET 315 SPWPLLGSAQGQFSAVHPNVSQGCQGGCAT E1:E2 PTPRK/RSPO3 316 TGLPGPPLITRTKCAVHPNVSQGCQGGCAT E7:E2 317 FGEKLFSGVLMDLSKSTLPTQEEIENLPAF E1:E36 PWWP2A/ROS1 318 ATSILEYPIEPSGVLGPASVISNDDDSASP E6:E16 QKI/NTRK2 319 EASSLKYLAEEFSIPEPTGEPSPKRPRGRP E7:E2 RAD51B/HMGA2 320 EASSLKYLAEEFSIPKAEATGEKRPRGRPR E7:E3 RAD51B/HMGA2 321 HMVSTTLPVDSRMIESTANPETPNSTISRE E7:E2 RAF1/DAZL 322 DGYQGSQTFHGAPLTVYRRKHQELQAMQME E18:E20 RANBP2/ALK 323 ASYDDPYKKAVAMSKR E2:E5 RBM14/PACS1 324 DSMENQVSVDAFKILDMEAQQVNEAESARE E11:E8 RET/GOLGA5 325 DSMENQVSVDAFKILKCERLLLYLYCHELS E11:E17 RET/TRIM33 326 EHRKELGPYVFREAQVNKLELELESAKQKF E22:E24 RGS22/SYCP1 327 FIQKIRYTNARDRNQDLIRDQGFRGDGGST E3:E9 RNF130/BRAF 328 TVQGSNIFERTEVLADDFWIPETSFILTII E4:E34 SDC4/ROS1 329 TVQGSNIFERTEVLAAGVPNKPGIPKLLEG E4:E32 330 GQESDDFELSGSGDLDDFWIPETSFILTII E2:E34 331 GQESDDFELSGSGDLVWHRRLKNQKSAKEG E2:E35 332 GQESDDFELSGSGDLAGVPNKPGIPKLLEG E2:E32 333 PGHMHTQVPPYPQPQLYRRKHQELQAMQME E19:E20 SEC31A/ALK 334 GTLPAASELPASQRTVYRRKHQELQAMQME E20:E20 335 GTLPAASELPASQRTVLQERIPWVPPECIE E20:E17 SEC31A/JAK2 336 MAATDLERFSNSYNNSQAPSPGLGS E1:E19 SEPT8/AFF4 337 VPPATMSGSMMGSDMLPVSGNLLDVYSSQG E9:E6 SFPQ/TFE3 338 VPPATMSGSMMGSDMIDDVIDEIISLESSY E9:E5 339 RQREESYSRMGYMDPIDDVIDEIISLESSY E7:E5 340 LEDMRSNNVEDCKMMVIHPKTDEQRCRLQE E17:E4 SLC26A6/PRKAR2A 341 VCSLDILSSAFQLVGDDFWIPETSFILTII E4:E34 SLC34A2/ROS1 342 VCSLDILSSAFQLVGAGVPNKPGIPKLLEG E4:E32 343 ILPYTLASLYHREKQLIAMDSAITLWQFLL E4: E2 SLC45A3/ELK4 344 LSSIRPPRLEGENTQDLIRDQGFRGDGGST E10:E9 SND1/BRAF 345 LSSIRPPRLEGENTQKTLGRRDSSDDWEIP E10:E11 346 PTANLDQKDKQFVAKDLIRDQGFRGDGGST E9:E9 347 SKKEVPIHRVADISGKTLGRRDSSDDWEIP E14:E11 348 SKKEVPIHRVADISGDLIRDQGFRGDGGST E14:E9 349 YSHKLFNGSMEAFIKRPRGQRDSSYYWEIE E12:E10 SRGAP3/RAF1 350 KQTLGEGERAECGTTRMQFEVTANQPHLQP E11:E8 351 GPPQPPQQRPYGYDQEWVSKSPSHLSCVIN E10:E4 SS18/SSX1 352 GPPQPPQQRPYGYDQLNILR E10:E5 353 QYPGQQGYPGQQQGYVEHPQMTFGRLHRII E9:E5 354 QYPGQQGYPGQQQGYGFKVTLPPFMCNKQA E9:E4 355 GPPQPPQQRPYGYDQIMPKKPAEDENDSKG E10:E6 356 TAPSAQQQRPYGYEQIMPKKPAEDENDSKG E10:E6 SS18L1/SSX1 357 GDGMPVGPVPPGFFQRENVIEYKHCLITKN E5:E11 SSBP2/JAK2 358 ETCEHSSEAKAFHDYRENVIEYKHCLITKN E4:E11 359 NITLGEPPGFLHSWWCEKMSLNINTV E3:E11 360 HPQMTFGRLHRIIPKGQYGNYQQ E5:E11 SSX1/SS18 361 YPKKPKDEAFRSHYKQFEEGLLDRCPAPGP E16:E7 STAT6/NAB2 362 TELNQGDMKPPSYDSVYRRKHQELQAMQME E3:E20 STRN/ALK 363 CTEKGTWRESTLTCTVLLQIL E6:E2 SUSD1/ROD1 364 RFAKKMDKMVQKKNAIGQNGKDWIPLSSTK E1:E3 TCEA1/PLAG1 365 HEGLSPTPFMNSNLMDMPCVQAQYSPSPPG E5:E3 TCF12/NR4A3 366 GYKILIPKGSYGRVKVS E7:E8 TECTA/TBCEL 367 SYLPGGTTGLQLPSTPVDREPVDREPVVCH E5:E8 TFE3/ASPSCR1 368 SPMALLTIGSSSEKEPVDREPVDREPVVCH E4:E8 369 QPPYTGAQTQAGQIEVYRRKHQELQAMQME E6:E20 TFG/ALK 370 KNVMSAFGLTDDQVSVYRRKHQELQAMQME E5:E20 371 EPPGEPGPSTNIPENVYRRKHQELQAMQME E4:E20 372 QAPPQQPQQYGIQYSDMPCVQAQYSPSPPG E7:E3 TFG/NR4A3 373 KNVMSAFGLTDDQVSDTNSTSGDPVEKKDE E5:E10 TFG/NTRK1 374 MALNSEALSVVSEDQSLFEC E2:E4 TMPRSS2/ERG 375 MALNSPSGSEQLVDGLAY E2:E3 376 FLVGAALAAGLLWKFRTLLMNAVWPKAGRW E4:E5 277 FLVGAALAAGLLWKFRSLISCE E4:E4 378 DGVSHCPGGEDENRCGSLISCE E5:E4 379 MALNSVIPGSLETRGKPC E2:E2 380 VCTQPKSPSGTVCTSRSLISCE E3:E4 381 VCTQPKSPSGTVCTSSYSRIFGDPRKAVLT E3:E2 382 MALNSLRYLTMMSSLYQTIR E2:E6 TMPRSS2/ETV1 383 VCTQPKSPSGTVCTSRGSLFPQKLLNAETS E3:E2 384 KGEPHHELPPGSTKRVPASVQLHTAVEMHH E8:E9 TP53/NTRK1 385 DAQAGKEPGGSRAHSSPGQCAAAHGGGDAP E10:E9 386 QPKKKPLDGEYFTLQSRPVCSCTRRWRCTT E9:E9 387 ERSVAKLEKTIDDLEVYRRKHQELQAMQME E7:E20 TPM3/ALK 388 ERSVAKLEKTIDDLEDTNSTSGDPVEKKDE E7:E10 TPM3/NTRK1 389 ERSVAKLEKTIDDLEVWHRRLKNQKSAKEG E8:E35 TPM3/ROS1 390 LQKLEEAEKAADESESTLPTQEEIENLPAF E2:E36 391 PRMQGPIQQPSISHQEDPKWEFPRKNLVLG E9:E12 TRIM24/RET 392 QLEEKQQQPTRELLQEDPKWEFPRKNLVLG E3:E12 393 KKGKTAQGLSPVDQREDPKWEFPRKNLVLG E16:E12 394 VISAENWKPATKTDQGLLKMTEYKLVVVGA E3:E2 UBE2L3/KRAS 395 RNELLGDDGNSSENQSNKVPVVQHPHHVHP E4:E5 VTI1A/TCF7L2 396 MRSYKQEMGKLETDFSNKVPVVQHPHHVHP E3:E5 397 MRSYKQEMGKLETDFYLQMKWPLLDVQAGS E3:E4 398 MVANVEKQLEEAKELSNKVPVVQHPHHVHP E2:E5 399 LRDNLTLWTSDMQGDAYPALGPGVTANPGT E5:E2 YWHAE/FAM22A 400 LRDNLTLWTSDMQGDAYPVLGPGVTANPGT E5:E2 YWHAE/NUTM2B 401 IKTLEGEFSVTMWSSGPMDEGPDLDLGPPV E1:E10 YY1/EWSR1 402 FGSTRGSLDKPDSFMGEYSVGNKHRDPFEA E10:E7 ZC3H7B/BCOR 403 QCKTETQESQAFQERGSTTGLSATPPASLP E3:E10 ZSCAN30/BRAF - In some embodiments, the fusion-specific vaccine library comprises 2 or more (e.g., 2-5, 5-10, 10-25, 25-50, 50-100, 100-500, 500-1,000 or more) different fusion junction sequences that can be used as therapeutic vaccines for treating cancer.
- In some embodiments, a method was developed for constructing a fusion-specific vaccine library from publicly available data such as but not limited to whole genome sequencing (WGS) data and/or RNA-sequencing data. In some embodiments, sources of publicly available data are databases such as but not limited to COSMIC (cancer.sanger.ac.uk/cosmic/), TCGA Fusion Gene Data Portal (54.84.12.177/PanCanFusV2/), and/or FusionCancer Database (donglab.ecnu.edu.cn/databases/FusionCancer/).
- In some embodiments, neoantigenic peptides having amino acid sequences corresponding to the gene fusion junction can be generated. In some embodiments, a library of recurrent fusion-derived neoantigenic peptide vaccines can be constructed containing all cancer-associated neoantigenic peptides or subsets thereof. In some embodiments, a library can contain 2 or more different fusion peptides (e.g., 2-5, 5-10, 10-25, 25-50, 50-100, 100-500, 500-1,000 or more different fusion peptides).
- In some embodiments, methods are disclosed for construction of a fusion-derived neoantigenic vaccine library, selection of patients and/or peptides for vaccination, and subsequent treating of patients with neoantigenic vaccines.
- In some embodiments, methods for identifying recurrent fusion derived neoepitopes and constructing a vaccine library include several steps (
FIG. 2 ). In some embodiments, methods comprise screening publicly available databases containing information regarding tumor whole genome sequencing (WGS) and/or RNA-sequencing data. In some embodiments, fusion genes and fusion transcripts can be de novo discovered using WGS and/or RNA-sequencing data. In some embodiments, methods integrate publicly available fusion-detection algorithms followed by heuristic filtering. - In some embodiments, methods comprise screening one or more publicly available databases containing information relating to annotated fusion genes, fusion transcripts, breakpoint coordinates of tumor-specific fusion genes, fusion proteins, and/or any resources containing information about recurrent fusions and their presence in tumor(s). In some embodiments, methods comprise screening peer-review articles. In some embodiments, methods comprise screening proprietary databases and/or patient sequence information.
- In some embodiments, methods comprise further validation of fusion genes detected by screening publicly available databases containing WGS and/or RNA-sequencing data.
- In some embodiments, methods comprise extracting fusion incidence data in cancer(s) from public data sources (e.g., cancer.org and/or cancer.net), proprietary information resources (e.g., uptodate.com) and/or peer-reviewed literature.
- In some embodiments, methods comprise translating recurrent fusions to chimeric proteins, identifying long peptides at fusion breakpoints, and predicting peptide binding affinity to MHC class I proteins and/or MHC class II proteins using bioinformatics algorithms. In some embodiments, methods comprise determining peptide binding affinity to MHC proteins using biochemical techniques in vitro.
- In some embodiments, methods comprise generating a set of T-cell epitopes by selection of fusion-derived neoepitopes having an IC50 less than 500 nM. In some embodiments, the epitopes can bind HLA proteins and be recognized by T-cells. In some embodiments, IC50 thresholds for MHC class I-peptide interaction are used for selecting peptides. In some embodiments, MHC class II-peptide interaction are used for selecting peptides.
- In some embodiments, methods comprise determining a binding affinity of peptide-HLA class I major genes comprising HLA-A, HLA-B, and/or HLA-C. In some embodiments, methods comprise determining a binding affinity of peptide-HLA class I minor genes comprising HLA-E, HLA-F, and/or HLA-G. In some embodiments, methods comprise determining a binding affinity of peptide-HLA class II genes comprising HLA-DMA, HLA-DMB, HLA-DOA, HLA-DOB, HLA-DPA1, HLA-DPB1, HLA-DQA1, HLA-DQA2, HLA-DQB1, HLA-DQB2, and/or HLA-DR. In some embodiments, methods comprise determining a binding affinity of the peptide to any antigen presenting protein.
- In some embodiments, population coverage for each long peptide is calculated based on HLA allele frequency, wherein the HLA protein can bind to the fusion-derived neoepitopes with IC50<500 nM. In some embodiments, patient coverage is calculated based on HLA allele frequency and gene fusion incidence rates in tumors. In some embodiments, the patient coverage is the percentage of patients having a particular tumor or tumors comprising a fusion-derived neoantigen included in the library. In some embodiments, patients having a particular tumor or tumors comprising a fusion-derived neoantigen included in the library are vaccinated with one or more fusion-specific vaccines from the library.
- In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides having 25-30 amino acids. In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides having 30-50 amino acids. In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides having 50-100 amino acids. In some embodiments, fusion-specific vaccines from the library comprise fusion-derived long peptides encompassing the entire fusion protein.
- In some embodiments, fusion-derived neoantigens can be modified by anchor residues, with additional amino acid sequences like T-helper epitopes that can be included in polypeptide for enhancing of in vivo processing, binding to MHC, and/or immunogenicity.
- In some embodiments, fusion-derived long peptides in the library are characterized by their association with particular fusion genes from which peptides are derived. In some embodiments, fusion-derived long peptides in the library are characterized by listing the HLA proteins that can effectively present neoepitopes derived from the fusion-derived long peptide. In some embodiments, fusion-derived long peptides in the library are characterized by the population coverage of the fusion-derived long peptide.
- In some embodiments, a vaccine library contains fusion-derived long peptides or polypeptides constructed of fusion-derived neoepitopes at the fusion breakpoint. In some embodiments, fusion-derived long peptides or polypeptides in the library are described by cancer types. In some embodiments, fusion-derived long peptides or polypeptides in the library are described by short peptides derived from long peptides, wherein the short peptides interact with MHC class I and/or MHC class II proteins. In some embodiments, fusion-derived long peptides or polypeptides in the library are described by the population coverage.
- In some embodiments, the interactions between short peptides and MHC proteins are characterized by an IC50, wherein the short peptides bind to MHC proteins with an IC50<500 nM. In some embodiments, fusion-derived peptides are formulated with an appropriate carrier or adjuvant. In some embodiments, fusion-derived neoantigens are DNA and/or RNA. In some embodiments, a single vaccine can contain one or more long peptides. In some embodiments, a fusion-derived long peptide can produce several shorter peptides that bind to MHC proteins. In some embodiments, a vaccine targets one or more neoantigens. In some embodiments, a vaccine library targets more neoantigens than the number of vaccines in the library.
- In some embodiments, a fusion-derived peptide in a vaccine has a length of 7-11 amino acids. In some embodiments, the peptide has a length of 7 amino acids. In some embodiments, the peptide has a length of 8 amino acids. In some embodiments, the peptide has a length of 9 amino acids. In some embodiments, the peptide has a length of 10 amino acids. In some embodiments, the peptide has a length of 11 amino acids. In some embodiments the peptide length is 25 or more amino acids, 50 or more amino acids, 75 or more amino acids, or 100 or more amino acids. In some embodiments, the peptides are processed to a shorter length intracellularly. In some embodiments the neoantigenic fusion-derived peptides in the library can include, but are not limited to, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 60, 70, 80, 90, 100 or more amino acids. In some embodiments, long peptides in the library correspond to shorter peptides that bind to MHC proteins. In some embodiments, a peptide in a vaccine can be of any suitable length that is sufficient to be immunogenic in a patient.
- In some embodiments, fusion-derived peptides are in neutral (uncharged) forms or in forms that are salts. Methods for synthesizing peptides are well known in the art. In one embodiment, the peptides provided herein are synthesized using an appropriate solid-state synthetic procedure (see for example, Steward and Young, Solid Phase Peptide Synthesis, Freemantle, San Francisco, Calif. (1968); Merrifield (1967) Recent Progress in Hormone Res 23: 451). However, any other suitable synthetic technique may be used. In some embodiments, one or more peptides provided herein are synthesized by expressing the peptides through standard molecular biological techniques. In some embodiments, one or more peptides provided herein are isolated from natural sources.
- In some embodiments, fusion-derived peptides are modified. Modifications should not reduce biological activity of peptides and their ability to induce tumor-specific immune responses. Modifications include but are not limited to phosphorylation, glycosylation, and oxidation. In some embodiments, peptides described herein are linked to one or more additional moieties (e.g., that help promote or stimulate an immune response, stabilize or solubilize the peptide, etc., or any combination thereof).
- In some embodiments, fusion-derived peptides are modified for enhancing their in vivo processing, binding to MHC, and/or immunogenicity. In some embodiments, fusion-derived peptide modifications include modification to anchor residues. In some embodiments, anchor residues are position 2 and position 8 in peptides comprising 9-10 amino acid residues. In some embodiments, peptide modifications comprise adding amino acid sequences like T-helper epitopes upstream or downstream.
- In some embodiments, fusion-derived neoantigens comprise polypeptides consisting of repeating fusion-derived neoantigenic short peptides.
- In some embodiments, a patient is eligible for treatment with one or more fusion-specific vaccines from the library when the patient's tumor biopsy comprises one or more gene fusions corresponding to fusion-derived peptides or fusion-derived neoantigens present in the library.
- In some embodiments, a patient is eligible for treatment with fusion-specific vaccines from the library when the long peptide in the library can bind to the HLA alleles of the patient and be presented to the patient's immune system. In some embodiments, long peptides in the library are characterized by the HLA alleles which can bind the long peptide derivatives and present them to the immune system.
- In some embodiments, the long peptide or polypeptide at the point of junction must be able to produce neoantigens for a particular patient. In some embodiments, the patient is eligible for vaccination if at least one HLA allele of the patient matches the HLA allele of the particular fusion-derived neoantigen. In some embodiments, up to six HLA alleles of the patient match the HLA alleles of the particular fusion-derived neoantigen.
- In some embodiments, a method of selecting a patient for vaccination with a therapeutic fusion-specific vaccine from a fusion-specific vaccine library is based on one or more factors (e.g., as illustrated in
FIG. 3 ). In some embodiments, selecting a patient for vaccination with a therapeutic peptide vaccine from a fusion-specific vaccine library is based on genetic analysis of a patient's tumor sample (e.g., biopsy) and normal tissue sample. In some embodiments, genetic analysis is performed using one or more techniques that detects fusion genes, fusion transcripts, and/or fusion proteins in a patient's tumor. In some embodiments, genetic analysis is performed with whole genome sequencing, RNA sequencing, proteome sequencing, fluorescence in situ hybridization, pyrosequencing, qPCR, Sanger sequencing, or any known analysis method that allows identification of fusion genes or/and transcripts presented in a tumor sample and absent in a normal tissue sample. - In some embodiments, one or more gene fusions found with WGS and/or RNA sequencing are validated with in vitro techniques. In some embodiments, fusions identified by screening public and proprietary databases for information about the presence of a particular fusion in a particular cancer type are validated with in vitro techniques.
- In some embodiments, selecting a patient for vaccination with a therapeutic peptide vaccine from a fusion-specific vaccine library is based on measuring the expression level of the fusion gene or transcript. In some embodiments, the expression level of the fusion gene or transcript is measured by RNA sequencing and/or any technique that measures the expression level of the fusion transcript(s) and/or the corresponding chimeric protein(s). In some embodiments, the fusion is expressed.
- In some embodiments, selecting a patient for vaccination with a therapeutic fusion-specific vaccine from a fusion-specific vaccine library is based on the patient's HLA genotype. In some embodiments, the patient is HLA genotyped using one or more serological tests, PCR, WGS, WES, RNA sequencing, and/or any other technique that determines the patient's HLA genes and/or HLA proteins. In some embodiments, the patient's HLA genotyping can be performed in silico with patient's tumor sequencing data comprising transcriptome, exome, and/or genome sequencing data. In some embodiments, HLA genotyping should have at least a 4-digit resolution for matching a patient's HLA alleles to vaccines in the library. However, other thresholds can be used for HLA matching.
- In some embodiments, selecting a patient for vaccination with a therapeutic fusion-specific vaccine from fusion-specific vaccine library is based on matching of patient's HLA alleles with HLA alleles that bind to fusion-derived long peptides in the vaccine library. In some embodiments, HLA proteins can bind to peptides derived from the fusion gene detected in a patient's tumor and bind to short peptides derived from long peptides presented in the library. In some embodiments, the patient is eligible for vaccination if at least one HLA allele of the patient matches the HLA allele of the particular fusion-derived peptide. In some embodiments, up to six HLA alleles of the patient matches the HLA alleles of the particular fusion-derived peptide.
- In some embodiments, a patient is selected for vaccination with a therapeutic fusion-specific vaccine from the fusion-specific vaccine library if one or more of the fusion-derived long peptide(s) in library are found in the patient's tumor biopsy as part of the expressed fusion protein (e.g., a fusion gene or fusion transcript) and not found in normal tissue(s). In some embodiments, a patient is selected for vaccination with a therapeutic fusion-specific vaccine from the fusion-specific vaccine library if the patient has one or more HLA proteins that can effectively bind and present to the immune system one or more fusion-derived neoantigens that are present in the library. In some embodiments, at least one HLA allele of the patient must match one of the HLA alleles that bind to the fusion-derived neoantigens in the vaccine library.
- In some embodiments, long peptides in a library might not bind to a patient's HLA proteins, whereas shorter peptides may bind to one or more of the patient's HLA proteins, and the patient is eligible for vaccination. For example, 30-mer peptides (peptides that are 30 amino acids long) cannot bind to MHC class I proteins, but derivatives of the 30-mer peptides, such as 8-mer, 9-mer, 10-mer, and/or 11-mer peptides will bind to the patient's HLA proteins and can be used to vaccinate the patient.
- In some embodiments, a patient may have multiple HLA proteins that match multiple tumor-specific recurrent fusion-derived long peptides present in the library.
- In some embodiments, protein mass spectrometry can be used for identifying fusion-derived peptides bound to a patient's HLA proteins. In some embodiments, peptides are eluted from HLA molecules on cancer cells and then analyzed with mass spectrometry and matched with peptides in the vaccine library.
- In some embodiments, no appropriate vaccine in the library matches a particular patient and a “de novo” method for identifying tumor-specific chimeric protein-derived neoepitopes in a patient can be used and a patient-specific personalized vaccine composition can be generated.
- In some embodiments, patient tumor-specific chimeric protein-derived neoepitopes (e.g., neoantigens) can be determined by sequencing RNA and/or DNA isolated from the patient's tumor biopsy sample(s) and/or normal tissue sample(s).
- In some embodiments, fusion transcripts which are present in a tumor sample and absent from normal tissue are identified using established bioinformatical algorithms. In some embodiments, false positive fusion transcripts are filtered out using WGS data, homology of fused genes at RNA level, or other available approaches. In some embodiments, false positive fusion transcripts identified with in silico fusion detection are filtered out using publicly available fusion genes and fusion transcripts and chimeric proteins databases.
- In some embodiments, in vitro validation of in silico detected fusion transcripts is performed using qPCR and/or Sanger sequencing with DNA and/or RNA isolated from patient's tumor sample(s) and normal tissue sample(s).
- In some embodiments, a set of patient tumor-specific fusion-derived peptides corresponding to a chimeric protein's breakpoint is generated. In some embodiments, a peptide represents one or more novel tumor-specific sequences that are not presented in normal tissues and contains at least one amino acid of one fusion partner, for example from the N-terminal side or from the C-terminal side of the breakpoint, and several amino acids of the other fusion partner (e.g., from the C-terminal side or from the N-terminal side of the breakpoint).
- In some embodiments, the patient is HLA genotyped using one or more in vitro techniques such as serological tests or in silico techniques based on WGS, WES or RNA sequencing data.
- In some embodiments, binding affinity (or any other parameter characterizing peptide—MHC interaction process) is predicted by means of highly validated bioinformatical algorithms that can be found elsewhere including iedb.org, or cbs.dtu.dk/services/. In some embodiments, the expression level of all identified fusion transcripts corresponding to the patient's tumor-specific fusion-derived peptides are measured using RNA sequencing data or any available technique for measuring expression level of fusion transcript and/or corresponding chimeric protein. In some embodiments, the patient's tumor-specific fusion-derived neoepitopes are expression products of the fusion gene transcript and have IC50 to patient's HLA proteins less than 500, less than 250, less than 150,or less than 50 nM.
- In some embodiments, a patient's tumor-specific vaccine composition comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or any appropriate number of patient tumor-specific fusion-derived peptides, wherein the composition optionally comprises one or more DNA or RNA constructs encoding such peptides.
- In some embodiments, a variety of bioinformatical algorithms and pipelines have been established for identifying tumor-specific fusions and generating corresponding neoepitopes.
- In some embodiments, gene fusion peptides are selected based on IC50 for HLA proteins. In some embodiments, gene fusion peptides having an IC50 of more than 500 nM are considered non-binding. In some embodiments, peptides with an IC50 of less than 500 nM are considered binding. In some embodiments, peptide vaccine compositions comprise gene fusion peptides having IC50 less than 500 nM, less than 450 nM, less than 400 nM, less than 350 nM, less than 300 nM, less than 250 nM, less than 200 nM, less than 150 nM, less than 100 nM, less than 50 nM, less than 25 nM, less than 10 nM, or less than 1 nM for one or more HLA proteins of a patient are selected for a vaccine for that patient (e.g., one or more of these concentration thresholds can be used for determining peptide matches for a patient). However, other IC50 thresholds (e.g., higher, lower, or intermediate concentrations) can be used to determine whether a peptide is a match for a patient.
- In some embodiments, a gene fusion peptide IC50 is predicted using established computational methods. In some embodiments, computational methods include NetMHC (e.g., cbs.dtu.dk/services/NetMHC/) and NetMHCpan (e.g., cbs.dtu.dk/services/NetMHCpan/). In some embodiments, a gene fusion peptide IC50 is determined in vitro using one or more biochemical assays. Methods described herein are not limited by the techniques used to identify the gene fusion peptide IC50.
- In some embodiments, binding of gene fusion peptides to HLA proteins is determined from biological samples by eluting peptides from HLA proteins and analyzing them using mass spectrometry.
- In some embodiments, gene fusion peptides are selected based on patient coverage. In some embodiments, gene fusion peptides having patient coverage greater than 5%, greater than 10%, greater than 20%, greater than 30%, greater than 40%, greater than 50%, greater than 60%, greater than 70%, greater than 80%, or greater than 90% are selected.
- In some embodiments, the vaccine library can be expanded with the same methods described herein to incorporate new recurrent fusion data as it emerges.
- Methods provided herein detect gene fusions in biological samples. Biological samples, as used herein, refer to samples taken or derived from a patient. These samples may be tissue samples or they may be fluid samples (e.g., a bodily fluid). Examples of biological fluid samples are whole blood, plasma, serum, urine, sputum, phlegm, saliva, tears, and other bodily fluids. In some embodiments, the biological sample is a whole blood sample, or a sample of white blood cells from a subject. In some embodiments, the biological sample is a tumor, a fragment of a tumor, a tumor biopsy, or a tumor cell(s).
- Other aspects of the specification relate to methods of treatment for a patient with cancer. Cancer includes, but is not limited to: melanoma, skin cancer, head and neck cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, thyroid cancer, kidney cancer, liver cancer, pancreatic cancer, gastric cancer, testicular cancer, brain tumor, glioma, glioblastoma, solitary fibrous tumor, bladder cancer, colorectal cancer, renal cell carcinoma, sarcoma, myeloma, leukemia, and/or lymphoma.
- In some embodiments, the treatment is regimented to modulate the patient's immune system to induce a response against a tumor comprising a gene fusion. In some embodiments, treatment comprises administering a peptide vaccine one or more times to a patient. In some embodiments, an initial vaccine can be administered followed by one or more booster administrations. In some embodiments, a vaccine can be administered once or more daily, weekly, monthly, or at other time intervals or other frequencies. The frequency of administration and the duration of a treatment (e.g., once, one week, 1-4 weeks, 1-12 months or longer) can depend on the severity of the disease, the effectiveness of the vaccine, and/or the health of the patient. In some embodiments, treatment comprises administering a peptide vaccine at
day 1, 4, 8, 15, and 21 and at week 12, 20, 30, and 40. - In some embodiments, vaccines can be administered intravenously (i.v.), intradermally (i.d.), parenterally, intraperitoneally (i.p.), subcutaneously (s.c.), intramuscularly (i.m.), orally, sublingually, intranasally, rectally, or intravaginally. The treatment is not limited to the method of vaccine administration.
- In some embodiments, treatment comprises therapeutic or prophylactic vaccination of a patient with a tumor or at risk of developing cancer, and inducing antitumor immune responses in the patient. In some embodiments, treatment comprises preventive vaccination of the patient against a tumor by one or more peptides from the library or vaccine composition identified with methods described herein.
- In some embodiments, treatment comprises treating a patient with a fusion-derived peptide or vaccine composition in combination with one or more additional therapies. In some embodiments, an additional therapy is an FDA approved therapy. In some embodiments, an additional therapy is an experimental therapy that is not yet approved. In some embodiments, vaccination of a patient is combined with one or more targeted therapies, chemotherapies, radiation, immunotherapy, or with hematopoietic stem cell transplantation. In some embodiments, any other suitable therapy for a particular tumor and patient may be combined with vaccination. In some embodiments, suitable therapies that can be combined with vaccination include but are not limited to immunotherapies, for example checkpoint blockade therapies, for example, but not limited to, anti-PD1 (e.g., nivolumab (Opdivo®), pembrolizumab (Keytruda®), pidilizumab etc), anti-CTLA4 (e.g., ipilimumab (Yervoy®), tremelimumab), or other checkpoint inhibitors such as BMS-936559, MPDL3280A, MEDI4736, MSB0010718C, IMP321, MGA271.
- One aspect of the specification provides methods for treating a patient having a tumor and eliciting an antitumor immune response in the patient by administering dendritic cells (or other antigen presenting cells) that have been pulsed with at least one fusion-derived peptide (or coding mRNA or DNA) from the vaccine library. The dendritic cells (or other antigen presenting cells) pulsed in this manner comprise at least one fusion-derived peptide (or coding mRNA or DNA) from the vaccine library.
- In some embodiments, the vaccine composition comprises at least two distinct peptides wherein each peptide corresponds to the amino acid sequence at the point of junction and each peptide is equal to or less than 50 amino acids in length.
- In some embodiments, peptides or vaccine compositions are administered at concentrations sufficient to induce an antitumor immune response in the patient. Concentrations of peptides and vaccine components and dosing regimens can be easily determined by anyone skilled in the art.
- In some embodiments, treatment comprises administering a vaccine having a peptide concentration of 1-10 mg per injection. In some embodiments, peptide doses per patient for one vaccination are 100 ng or more (e.g., 100-500 ng, 500-1,000 ng, or more), 1 μg or more (e.g., 1-10 μg, 10-100 μg, 100-500 μg, 500-1,000 μg, or more), 1 mg or more (e.g., 1-10 mg, 10-50 mg, 50-100 mg, or more), or 100 mg or more. In some embodiments, peptide doses per patient are adjusted depending on patient condition, patient weight, cancer stage and severity. In some embodiments, peptide doses and treatment regimen can vary depending on a patient's response to therapy. In some embodiments, peptide doses and treatment regimen can vary depending on a patient's condition.
- The concentration of peptides provided in the pharmaceutical formulations can vary widely, e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected primarily by fluid volumes, viscosities, etc., in accordance with the particular mode of administration selected.
- In some embodiments, the peptide concentration in the vaccine (e.g., for each peptide, or the combined total peptide concentration) is around 1 nM, around 250 nM, around 500 nM, around 750 nM, around 1 around 250 around 500 around 750 around 1 mM, around 250 mM, around 500 mM, around 750 mM, or around 1M, or more or an intermediate concentration. In some embodiments, the peptide dose per patient is around 1 ng, around 250 ng, around 500 ng, around 750 ng, around 1 μg, around 250 μg, around 500 μg, around 750 μg, around 1 mg, around 250 mg, around 500 mg, around 750 mg, around 1,000 mg, or more or an intermediate amount.
- In some embodiments, an initial dose is (e.g., for therapeutic or prophylactic administration) from about 1.0m to about 50,000m of peptide for a 70 kg patient, followed by subsequent doses (e.g., boosting doses) of from about 1.0m to about 10,000m of peptide pursuant to a regimen (e.g., a boosting regimen) over weeks to months depending upon the patient's response and condition. However, in some embodiments, subsequent doses can be the same as the initial dose. It should be appreciated that equivalent dosages for patients in different weight ranges can be calculated. In some embodiments, a typical dose (e.g., daily dose) is at least 0.1 μg/kg, at least 1 μg/kg, at least 10 μg/kg, at least 25 μg/kg, at least 50 μg/kg, at least 100 μg/kg, at least 250 μg/kg, at least 500 μg/kg, at least 750 μg/kg, at least 1 mg/kg, at least 10 mg/kg, or more or an intermediate range between any of these values.
- In some embodiments, DNA or mRNA encoding a fusion-derived peptide or polypeptide is administered to a patient. In some embodiments, DNA or mRNA encoding a fusion-derived peptide or polypeptide is incorporated into a vector. In some embodiments, DNA or mRNA comprises additional sequences including but not limited to a T-helper sequence. In some embodiments, DNA or mRNA comprises standard regulatory sequences that ensure expression in a particular cell type. In some embodiments, DNA or mRNA comprises additional sequences encoding proteins such as IL-2 or GM-CSF that can increase a patient's immune response. In some embodiments, DNA or mRNA is transfected into mammalian cells with techniques including but not limited to electroporation.
- In some embodiments, autologous T-cells can be collected from a patient and stimulated ex vivo with fusion-derived peptides and/or DNA or RNA encoding the fusion-derived peptides. In some embodiments, autologous T-cells can be collected from a patient and stimulated ex vivo with fusion-derived peptides and/or DNA or RNA encoding the fusion-derived peptides and the stimulated T-cells are infused into the patient.
- In some embodiments, DNA or RNA encoding the fusion-derived peptides comprises attenuated viral vectors. In some embodiments, viral vectors comprise BCG, vaccinia, and/or fowlpox.
- In some embodiments, the library can be used for treating subjects diagnosed with cancer, wherein the subject is human. In some embodiments, the subject can be a mouse, cat, dog, horse, primate, or any animal.
- To practice the method disclosed herein, an effective amount of the pharmaceutical composition (e.g., vaccine) described herein can be administered to a subject (e.g., a human) in need of the treatment via a suitable route (e.g., intravenous administration, subcutaneous, intradermal, or other route).
- The subject to be treated by the methods described herein can be a human patient having cancer. Examples of cancer includes, but is not limited to, melanoma, skin cancer, head and neck cancer, breast cancer, lung cancer, ovarian cancer, cervical cancer, prostate cancer, thyroid cancer, kidney cancer, liver cancer, pancreatic cancer, gastric cancer testicular cancer, brain tumor, glioma, glioblastoma, solitary fibrous tumor, bladder cancer, colorectal cancer, renal cell carcinoma, sarcoma, myeloma, leukemia, and/or lymphoma.
- The subject to be treated by the methods described herein can be a mammal, more preferably a human. Mammals include, but are not limited to, farm animals, sport animals, pets, primates, horses, dogs, cats, mice and rats. A human subject who needs the treatment may be a human patient having a cancer. A subject having a cancer can be identified by routine medical examination, e.g., laboratory tests, PET scan, biopsy, PET scans, CT scans, or ultrasounds. A subject having a cancer might show one or more symptoms of the disorder, e.g., unexplained weight loss, fever, fatigue, pain, skin changes, unusual bleeding or discharge, and/or thickening or lumps in parts of the body. A subject at risk for a cancer can be a subject having one or more of the risk factors for that disorder. For example, risk factors associated with cancer include (a) viral infection (e.g., herpes virus infection), (b) age, (c) family history, (d) heavy alcohol consumption, (e) obesity, and (f) tobacco use.
- “An effective amount” as used herein refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more other active agents. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. It is generally preferred that a maximum dose of the individual components or combinations thereof be used, that is, the highest safe dose according to sound medical judgment. It will be understood by those of ordinary skill in the art, however, that a patient may insist upon a lower dose or tolerable dose for medical reasons, psychological reasons or for virtually any other reasons.
- Empirical considerations, such as the half-life, generally will contribute to the determination of the dosage. For example, antibodies that are compatible with the human immune system, such as humanized antibodies or fully human antibodies, may be used to prolong half-life of the peptide and to prevent the peptide being attacked by the host's immune system. Frequency of administration may be determined and adjusted over the course of therapy, and is generally, but not necessarily, based on treatment and/or suppression and/or amelioration and/or delay of a cancer. Alternatively, sustained continuous release formulations of a fusion-specific vaccine may be appropriate. Various formulations and devices for achieving sustained release are known in the art.
- In one example, dosages for a fusion-specific vaccine as described herein may be determined empirically in individuals who have been given one or more administration(s) of a fusion-specific vaccine. Individuals are given incremental dosages of the fusion-specific vaccine. To assess efficacy of the fusion-specific vaccine, an indicator of a cancer (such as tumor formation or tumor growth) can be followed.
- In some embodiments, dosing frequency is once every week, every 2 weeks, every 4 weeks, every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks; or once every month, every 2 months, or every 3 months, or longer. The progress of this therapy is easily monitored by conventional techniques and assays. The dosing regimen (including the fusion-specific vaccine used) can vary over time. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of symptoms occurs or until sufficient therapeutic levels are achieved to alleviate a cancer, or a symptom thereof.
- For the purpose of the present disclosure, the appropriate dosage of a fusion-specific vaccine will depend on the specific fusion-specific vaccine(s) (or compositions thereof) employed, the type and severity of cancer, whether the fusion-specific vaccine is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antagonist, and the discretion of the attending physician. Typically the clinician will administer a fusion-specific vaccine, until a dosage is reached that achieves the desired result. Administration of a fusion-specific vaccine can be continuous or intermittent, depending, for example, upon the recipient's physiological condition, whether the purpose of the administration is therapeutic or prophylactic, and other factors known to skilled practitioners. The administration of a fusion-specific vaccine may be essentially continuous over a preselected period of time or may be in a series of spaced dose, e.g., either before, during, or after developing cancer.
- As used herein, the term “treating” refers to the application or administration of a composition including one or more active agents to a subject, who has a cancer, a symptom of a cancer, or a predisposition toward a cancer, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disorder, the symptom of the disease, or the predisposition toward a cancer.
- Alleviating a cancer includes delaying the development or progression of the disease, or reducing disease severity. Alleviating the disease does not necessarily require curative results. As used therein, “delaying” the development of a disease (such as lung cancer) means to defer, hinder, slow, retard, stabilize, and/or postpone progression of the disease. This delay can be of varying lengths of time, depending on the history of the disease and/or individuals being treated. A method that “delays” or alleviates the development of a disease, or delays the onset of the disease, is a method that reduces probability of developing one or more symptoms of the disease in a given time frame and/or reduces extent of the symptoms in a given time frame, when compared to not using the method. Such comparisons are typically based on clinical studies, using a number of subjects sufficient to give a statistically significant result.
- “Development” or “progression” of a disease means initial manifestations and/or ensuing progression of the disease. Development of the disease can be detectable and assessed using standard clinical techniques as well known in the art. However, development also refers to progression that may be undetectable. For purpose of this disclosure, development or progression refers to the biological course of the symptoms. “Development” includes occurrence, recurrence, and onset. As used herein “onset” or “occurrence” of a cancer includes initial onset and/or recurrence.
- In some embodiments, the fusion-specific vaccine described herein is administered to a subject in need of the treatment at an amount sufficient to induce a immunological response against a tumor by at least 5% (e.g., 15%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater). In other embodiments, the fusion-specific vaccine is administered in an amount effective in reducing tumor metastasis. Alternatively, the fusion-specific vaccine is administered in an amount effective in reducing tumor formation or tumor growth.
- Conventional methods, known to those of ordinary skill in the art of medicine, can be used to administer the pharmaceutical composition to the subject, depending upon the type of disease to be treated or the site of the disease. This composition can also be administered via other conventional routes, e.g., administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The term “parenteral” as used herein includes subcutaneous, intracutaneous, intravenous, intramuscular, intraarticular, intraarterial, intrasynovial, intrasternal, intrathecal, intralesional, and intracranial injection or infusion techniques. In addition, it can be administered to the subject via injectable depot routes of administration such as using 1-, 3-, or 6-month depot injectable or biodegradable materials and methods.
- Injectable compositions may contain various carriers such as vegetable oils, dimethylactamide, dimethyformamide, ethyl lactate, ethyl carbonate, isopropyl myristate, ethanol, and polyols (glycerol, propylene glycol, liquid polyethylene glycol, and the like). For intravenous injection, water soluble antibodies can be administered by the drip method, whereby a pharmaceutical formulation containing the antibody and a physiologically acceptable excipients is infused. Physiologically acceptable excipients may include, for example, 5% dextrose, 0.9% saline, Ringer's solution or other suitable excipients. Intramuscular preparations, e.g., a sterile formulation of a suitable soluble salt form of the antibody, can be dissolved and administered in a pharmaceutical excipient such as Water-for-Injection, 0.9% saline, or 5% glucose solution.
- In one embodiment, a fusion-specific vaccine is administered via site-specific or targeted local delivery techniques. Examples of site-specific or targeted local delivery techniques include various implantable depot sources of the fusion-specific vaccine or local delivery catheters, such as infusion catheters, an indwelling catheter, or a needle catheter, synthetic grafts, adventitial wraps, shunts and stents or other implantable devices, site specific carriers, direct injection, or direct application. See, e.g., PCT Publication No. WO 00/53211 and U.S. Pat. No. 5,981,568.
- Targeted delivery of therapeutic compositions containing a polynucleotide, expression vector, or subgenomic polynucleotides can also be used. Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol. (1993) 11:202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer (J. A. Wolff, ed.) (1994); Wu et al., J. Biol. Chem. (1988) 263:621; Wu et al., J. Biol. Chem. (1994) 269:542; Zenke et al., Proc. Natl. Acad. Sci. USA (1990) 87:3655; Wu et al., J. Biol. Chem. (1991) 266:338. Therapeutic compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol. In some embodiments, concentration ranges of about 500 ng to about 50 mg, about 1 μg to about 2 mg, about 5 μg to about 500 μg, and about 20 μg to about 100 μg of DNA or more can also be used during a gene therapy protocol.
- The therapeutic polynucleotides and polypeptides described herein can be delivered using gene delivery vehicles. The gene delivery vehicle can be of viral or non-viral origin (see generally, Jolly, Cancer Gene Therapy (1994) 1:51; Kimura, Human Gene Therapy (1994) 5:845; Connelly, Human Gene Therapy (1995) 1:185; and Kaplitt, Nature Genetics (1994) 6:148). Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters and/or enhancers. Expression of the coding sequence can be either constitutive or regulated.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art. Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos. 5,219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No. 0 345 242), alphavirus-based vectors (e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)), and adeno-associated virus (AAV) vectors (see, e.g., PCT Publication Nos. WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655). Administration of DNA linked to killed adenovirus as described in Curiel, Hum. Gene Ther. (1992) 3:147 can also be employed.
- Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther. (1992) 3:147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem. (1989) 264:16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Pat. No. 5,814,482; PCT Publication Nos. WO 95/07994; WO 96/17072; WO 95/30763; and WO 97/42338) and nucleic charge neutralization or fusion with cell membranes. Naked DNA can also be employed. Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/11092 and U.S. Pat. No. 5,580,859. Liposomes that can act as gene delivery vehicles are described in U.S. Pat. No. 5,422,120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP Patent No. 0524968. Additional approaches are described in Philip, Mol. Cell. Biol. (1994) 14:2411, and in Woffendin, Proc. Natl. Acad. Sci. (1994) 91:1581.
- It is also apparent that an expression vector can be used to direct expression of any of the fusion-specific vaccines described herein. The particular dosage regimen, i.e., dose, timing and repetition, used in the method described herein will depend on the particular subject and that subject's medical history.
- In some embodiments, more than one fusion-specific vaccine may be administered to a subject in need of the treatment. The fusion-specific vaccine can correspond to the same tumor junction sequence or different tumor junction sequences. At least one, at least two, at least three, at least four, at least five different fusion-specific vaccines can be co-administered. Generally, those fusion-specific vaccines have complementary activities that do not adversely affect each other. Fusion-specific vaccines can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
- Treatment efficacy can be assessed by methods well-known in the art, e.g., monitoring tumor growth or formation in a patient subjected to the treatment.
- Also provided herein are combined therapies using any of the fusion-specific vaccines described herein and another anti-cancer therapeutic agent, such as those described herein. The term combination therapy, as used herein, embraces administration of these agents (e.g., a fusion-specific vaccine and an anti-cancer therapeutic agent) in a sequential manner, that is, wherein each therapeutic agent is administered at a different time, as well as administration of these therapeutic agents, or at least two of the agents, in a substantially simultaneous manner. In some embodiments, combination therapies include two or more therapeutic agents (e.g., vaccines or other agents) combined in the same composition. However, in many embodiments, different therapeutic agents are provided in separate compositions. Sequential or substantially simultaneous administration of each agent can be affected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular, subcutaneous routes, and direct absorption through mucous membrane tissues. The agents can be administered by the same route or by different routes. For example, a first agent (e.g., a fusion-specific vaccine) can be administered orally, and a second agent (e.g., an anti-cancer agent) can be administered intravenously.
- As used herein, the term “sequential” means, unless otherwise specified, characterized by a regular sequence or order, e.g., if a dosage regimen includes the administration of a fusion-specific vaccine and an anti-cancer agent, a sequential dosage regimen could include administration of the fusion-specific vaccine before, simultaneously, substantially simultaneously, or after administration of the anti-cancer agent, but both agents will be administered in a regular sequence or order. The term “separate” means, unless otherwise specified, to keep apart one from the other. The term “simultaneously” means, unless otherwise specified, happening or done at the same time, i.e., the agents of the invention are administered at the same time. The term “substantially simultaneously” means that the agents are administered within minutes of each other (e.g., within 10 minutes of each other) and intends to embrace joint administration as well as consecutive administration, but if the administration is consecutive it is separated in time for only a short period (e.g., the time it would take a medical practitioner to administer two agents separately). As used herein, concurrent administration and substantially simultaneous administration are used interchangeably. Sequential administration refers to temporally separated administration of the agents described herein.
- Combination therapy can also embrace the administration of the agents described herein (e.g., a fusion-specific vaccine and an anti-cancer agent) in further combination with other biologically active ingredients (e.g., a different anti-cancer agent) and non-drug therapies (e.g., surgery).
- It should be appreciated that any combination of a fusion-specific vaccine and another anti-cancer agent (e.g., a chemotherapeutic agent) may be used in any sequence for treating a cancer. The combinations described herein may be selected on the basis of a number of factors, which include but are not limited to the effectiveness of inducing an immune response, reducing tumor formation or tumor growth, and/or alleviating at least one symptom associated with the cancer, or the effectiveness for mitigating the side effects of another agent of the combination. For example, a combined therapy described herein may reduce any of the side effects associated with each individual members of the combination, for example, a side effect associated with the anti-cancer agent.
- In some embodiments, another anti-cancer therapeutic agent is a chemotherapy, a radiation therapy, a surgical therapy and/or an immunotherapy. Examples of the chemotherapeutic agents include, but are not limited to, Carboplatin or Cisplatin, Docetaxel, Gemcitabine, Nab-Paclitaxel, Paclitaxel, Pemetrexed, and Vinorelbine. Examples of radiation therapy include, but are not limited to, ionizing radiation, gamma-radiation, neutron beam radiotherapy, electron beam radiotherapy, proton therapy, brachytherapy, and systemic radioactive isotopes and radiosensitizers. Examples of a surgical therapy include, but are not limited to, a curative surgery (e.g., tumor removal surgery), a preventive surgery, a laparoscopic surgery, and a laser surgery. Examples of an immunotherapy include, but are not limited to, a PD-1 inhibitor or a PD-L1 inhibitor, adoptive cell transfer, and therapeutic cancer vaccines.
- Additional examples of chemotherapy include, but are not limited to, Platinating agents, such as Carboplatin, Oxaliplatin, Cisplatin, Nedaplatin, Satraplatin, Lobaplatin, Triplatin, Tetranitrate, Picoplatin, Prolindac, Aroplatin and other derivatives; Topoisomerase I inhibitors, such as Camptothecin, Topotecan, irinotecan/SN38, rubitecan, Belotecan, and other derivatives; Topoisomerase II inhibitors, such as Etoposide (VP-16), Daunorubicin, a doxorubicin agent (e.g., doxorubicin, doxorubicin HCl, doxorubicin analogs, or doxorubicin and salts or analogs thereof in liposomes), Mitoxantrone, Aclarubicin, Epirubicin, Idarubicin, Amrubicin, Amsacrine, Pirarubicin, Valrubicin, Zorubicin, Teniposide and other derivatives; Antimetabolites, such as Folic family (Methotrexate, Pemetrexed, Raltitrexed, Aminopterin, and relatives); Purine antagonists (Thioguanine, Fludarabine, Cladribine, 6-Mercaptopurine, Pentostatin, clofarabine and relatives) and Pyrimidine antagonists (Cytarabine, Floxuridine, Azacitidine, Tegafur, Carmofur, Capacitabine, Gemcitabine, hydroxyurea, 5-Fluorouracil (5FU), and relatives); Alkylating agents, such as Nitrogen mustards (e.g., Cyclophosphamide, Melphalan, Chlorambucil, mechlorethamine, Ifosfamide, mechlorethamine, Trofosfamide, Prednimustine, Bendamustine, Uramustine, Estramustine, and relatives); nitrosoureas (e.g., Carmustine, Lomustine, Semustine, Fotemustine, Nimustine, Ranimustine, Streptozocin, and relatives); Triazenes (e.g., Dacarbazine, Altretamine, Temozolomide, and relatives); Alkyl sulphonates (e.g., Busulfan, Mannosulfan, Treosulfan, and relatives); Procarbazine; Mitobronitol, and Aziridines (e.g., Carboquone, Triaziquone, ThioTEPA, triethylenemalamine, and relatives); Antibiotics, such as Hydroxyurea, Anthracyclines (e.g., doxorubicin agent, daunorubicin, epirubicin and other derivatives); Anthracenediones (e.g., Mitoxantrone and relatives); Streptomyces family (e.g., Bleomycin, Mitomycin C, Actinomycin, Plicamycin); and Ultraviolet light.
- In some embodiments, methods are provided for constructing a fusion-derived vaccine library which can be used for treating a patient having cancer and eliciting an immune response in the patient. In some embodiments, the vaccine comprises fusion-derived long peptides or polypeptides comprising neoantigens peptides matched to patients HLA and which can induce an antitumor immune response in the patient. In some embodiments, the immune response can be detected by analyzing IFN-γ production or tumor killing activity of T-cells in vitro.
- In some embodiments, the vaccine comprises one fusion-derived long peptide at a breakpoint or several shorter derivatives of the long peptide. In some embodiments, the vaccine comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 neoantigenic peptides that can be bound by the patient's HLA class I and/or class II proteins. It should be appreciated that the vaccine comprising one or more neoantigenic peptides may further comprise one or more additional therapeutic agents. Alternatively, or in addition, on or more additional therapeutic agents may be administered separately
- In some embodiments, a vaccine comprises two or more different peptides that are selected for a patient, wherein the peptide are mixed together in a single vaccine composition for administration to the patient. However, in some embodiments, two or more different peptides can be administered separately to a patient. It should be appreciated that a vaccine can contain any suitable concentration of each of the two or more peptides. In some embodiments, the concentration of each peptide in the vaccine is identical or similar. However, in some embodiments, different peptides can be provided at different concentrations.
- In some embodiments, the vaccine comprises fusion-derived long peptides or polypeptides that are processed into shorter neoantigenic peptides which can be bound to at least one HLA class I protein of the patient. In some embodiments, the vaccine comprises fusion-derived long peptides or polypeptides that are processed into shorter neoantigenic peptides which can be bound to one or more, two or more, three or more, four or more, five or more, or six HLA class I protein of the patient. In some embodiments, peptides can bind to HLA class II proteins and induce helper T-cell response.
- In some embodiments, a vaccine comprises several different fusion-derived long peptides or polypeptides corresponding to several different fusion genes present in the patient's tumor. In some embodiments, compositions comprises one or more, or two or more neoantigenic fusion-derived peptides.
- In some embodiments, vaccine compositions comprises any adjuvant that can be used to activate an immune response in a patient. In some embodiments, an adjuvant can be any substance or any compound incorporated into a vaccine composition that increases the immune response of the patient to the fusion-derived peptides. Examples of adjuvants include, but are not limited to, poly-ICLC, Poly (I:C), GM-CSF, BCG, monophosphoryl lipid A, MF59, Freund's adjuvants, Montanide IMS, Montanide ISA 206, Montanide ISA-51, Montanide ISA 50V, Aluminium salts, Alhydrogel, Rehydrogel HPA, PLGA, MPL1, AS04, AS01B, AS02A, P3CSK4, CpG-ODN, Imiquimod ISS, ONTAK, LipoVac, Amplivax, CpG7909, dSLIM, IC30, IC31, SRL172, virus particles, YF-17D, AS15, OK-432, IMP321, OM-174, cytokines, and other adjuvants that can be found in the field using any source (e.g., peer-reviewed literature or medical guidelines).
- In some embodiments, fusion-derived peptides are administered separately from one or more adjuvant(s). In some embodiments, fusion-derived peptides are administered along with one or more adjuvant(s). In some embodiments, vaccine compositions comprise one or more adjuvants and one or more fusion-derived peptides.
- In some embodiments, vaccine compositions comprise different carriers such as polysaccharides, polypeptides, proteins, liposomes, or antigen presenting cells. In some embodiments, peptides might be combined with carriers that increase their immunogenicity, biological activity, and/or stability. In some embodiments, carriers include, but are not limited to, proteins such as bovine serum albumin (BSA), human serum albumin, immunoglobulins, transferrin, insulin; and/or carbohydrates such as lactose, cellulose, starch. In some embodiments, carriers are proteins such as diphtheria toxoid, tetanus toxoid, influenza virus proteins, and/or herpes virus proteins. In some embodiments, vaccine compositions comprise any carriers that are safe and acceptable for patients.
- In some embodiments, vaccine compositions comprise at least one or more autologous antigen presenting cells (APC) pulsed with respective fusion-derived peptides from library. Pulsing APC cells may be performed in any manner known in the field. See, for example, Boczkowski et al, J Exp. Med. 1996 Aug. 1; 184(2): 465-72; see also: O'Neill and Bhardwaj, Adoptive Immunotherapy: Methods and Protocols, 2005, Volume 109 pp 97-112, which are incorporated by reference herein for this purpose. In some embodiments, vaccine compositions comprise at least one or more autologous antigen presenting cells (APC) comprising fusion-derived peptides from library. In some embodiments, APCs can be dendritic cells, macrophages, B-cells, or any professional antigen presenting cell. In some embodiments, APCs can be loaded with DNA or mRNA encoding respective fusion-derived peptide(s) of a vaccine library. In some embodiments, vaccine compositions comprise autologous peripheral blood mononuclear cells (PBMC).
- In another aspect, vaccine compositions comprise components directed to the personal needs of a particular patient. In some embodiments, the personal needs of a particular patient include but are not limited to allergies, previous treatments, and/or comorbidities.
- In some embodiments, fusion-derived peptides from a library can be combined with any other tumor-specific neoantigens for a particular patient that are not included in the vaccine library. In some embodiments, fusion-derived peptides from a library can be combined with tumor-specific neoantigens for a particular patient that have been identified de novo from WGS, WES, or RNA sequencing data.
- In some embodiments, vaccine compositions can be prepared in sterilized water. In some embodiments, vaccine compositions can be prepared in buffered solutions such as but not limited to 0.9% saline.
- One or more of the fusion-specific vaccines provided herein can be mixed with a pharmaceutically acceptable carrier (excipient), including buffer, to form a pharmaceutical composition for use in treating cancer. “Acceptable” means that the carrier must be compatible with the active ingredient of the composition (and preferably, capable of stabilizing the active ingredient) and not deleterious to the subject to be treated. Pharmaceutically acceptable excipients (carriers) including buffers, which are well known in the art. See, e.g., Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.
- For example, a pharmaceutical composition described herein contains one or more fusion-specific vaccines that correspond to one or more tumor-specific gene fusions. In one example, a pharmaceutical composition described herein contains more than one fusion-specific vaccines that recognize a tumor-specific gene fusion. In another example, the pharmaceutical composition comprises at least two fusion-specific vaccines that correspond to different tumor-specific gene fusions. Alternatively or in addition, the pharmaceutical composition comprises one or more peptide vaccines or other anticancer agents. It should be appreciated that any of the pharmaceutical compositions provided herein may be administered alone, separately or in a combination.
- The pharmaceutical compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions. (Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover). Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations used, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™ (polysorbate), PLURONICS™ (poloxamers) or polyethylene glycol (PEG). Pharmaceutically acceptable excipients are further described herein.
- In some examples, the pharmaceutical composition described herein comprises liposomes containing the fusion-specific vaccine, which can be prepared by methods known in the art, such as described in Epstein, et al., Proc. Natl. Acad. Sci. USA 82:3688 (1985); Hwang, et al., Proc. Natl. Acad. Sci. USA 77:4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556. Particularly useful liposomes can be generated by the reverse phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
- The active ingredients (e.g., a fusion-specific vaccine) may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are known in the art, see, e.g., Remington, The Science and Practice of Pharmacy 20th Ed. Mack Publishing (2000).
- In other examples, the pharmaceutical composition described herein can be formulated in sustained-release format. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and 7 ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), sucrose acetate isobutyrate, and poly-D-(−)-3-hydroxybutyric acid.
- The pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by, for example, filtration through sterile filtration membranes. However, other sterilization techniques, including but not limited to heat, chemical, and/or radiation based sterilization techniques may be used. Therapeutic vaccine compositions are generally placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- The pharmaceutical compositions described herein can be in unit dosage forms such as tablets, pills, capsules, powders, granules, solutions or suspensions, or suppositories, for oral, parenteral or rectal administration, or administration by inhalation or insufflation.
- For preparing solid compositions such as tablets, the principal active ingredient can be mixed with a pharmaceutical carrier, e.g. conventional tableting ingredients such as corn starch, lactose, sucrose, sorbitol, talc, stearic acid, magnesium stearate, dicalcium phosphate or gums, and other pharmaceutical diluents, e.g. water, to form a solid preformulation composition containing a homogeneous mixture of a compound of the present invention, or a non-toxic pharmaceutically acceptable salt thereof. When referring to these preformulation compositions as homogeneous, it is meant that the active ingredient is dispersed evenly throughout the composition so that the composition may be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. This solid preformulation composition is then subdivided into unit dosage forms of the type described herein containing from 0.1 to about 500 mg of the active ingredient of the present invention. The tablets or pills of the novel composition can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by an enteric layer that serves to resist disintegration in the stomach and permits the inner component to pass intact into the duodenum or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol and cellulose acetate.
- Suitable surface-active agents include, in particular, non-ionic agents, such as polyoxyethylenesorbitans (e.g., Tween™ 20, 40, 60, 80 or 85) and other sorbitans (e.g., Span™ 20, 40, 60, 80 or 85). Compositions with a surface-active agent will conveniently comprise between 0.05 and 5% surface-active agent, and can be between 0.1 and 2.5%. It will be appreciated that other ingredients may be added, for example mannitol or other pharmaceutically acceptable vehicles, if necessary.
- Suitable emulsions may be prepared using commercially available fat emulsions, such as Intralipid™, Liposyn™, Infonutrol™, Lipofundin™ and Lipiphysan™. The active ingredient may be either dissolved in a pre-mixed emulsion composition or alternatively it may be dissolved in an oil (e.g., soybean oil, safflower oil, cottonseed oil, sesame oil, corn oil or almond oil) and an emulsion formed upon mixing with a phospholipid (e.g., egg phospholipids, soybean phospholipids or soybean lecithin) and water. It will be appreciated that other ingredients may be added, for example glycerol or glucose, to adjust the tonicity of the emulsion. Suitable emulsions will typically contain up to 20% oil, for example, between 5 and 20%. The fat emulsion can comprise fat droplets between 0.1 and 1.0 .im, particularly 0.1 and 0.5 .im, and have a pH in the range of 5.5 to 8.0.
- The emulsion compositions can be those prepared by mixing a fusion-specific vaccine with Intralipid™ (a lipid emulsion) or the components thereof (soybean oil, egg phospholipids, glycerol and water).
- Pharmaceutical compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as set out above. In some embodiments, the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
- Compositions in preferably sterile pharmaceutically acceptable solvents may be nebulised by use of gases. Nebulised solutions may be breathed directly from the nebulising device or the nebulising device may be attached to a face mask, tent or intermittent positive pressure breathing machine. Solution, suspension or powder compositions may be administered, preferably orally or nasally, from devices which deliver the formulation in an appropriate manner.
- The present disclosure also provides kits for use in alleviating cancer. Such kits can include one or more containers comprising a fusion-specific vaccine. In some embodiments, the kit can comprise instructions for use in accordance with any of the methods described herein. The included instructions can comprise a description of administration of the fusion-specific vaccine to treat, delay the onset, or alleviate a cancer according to any of the methods described herein. The kit may further comprise a description of selecting an individual suitable for treatment based on identifying whether that individual has cancer. In still other embodiments, the instructions comprise a description of administering a fusion-specific vaccine to an individual having, suspected of having, or at risk for a cancer.
- The instructions relating to the use of a fusion-specific vaccine generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- The label or package insert indicates that the composition is used for treating, delaying the onset and/or alleviating a cancer. Instructions may be provided for practicing any of the methods described herein.
- The kits of this invention are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump. A kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is a fusion-specific vaccine.
- Kits may optionally provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiments, the invention provides articles of manufacture comprising contents of the kits described herein.
- Without further elaboration, it is believed that one skilled in the art can, based on the description herein, utilize the present invention to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference for the purposes or subject matter referenced herein.
- It should be appreciated that the various aspects and concepts of the present methods described herein may be implemented in any of numerous ways, and are not limited to any particular implementation technique. Examples of specific implementations are described below for illustrative purposes only, but the aspects of the methods described herein are not limited to these illustrative implementations.
-
FIG. 5 shows a non-limitingillustrative environment 500 in which embodiments of the present methods may operate. In the illustrative environment,healthcare provider 502 may use anydevice 504 to obtain information fromsystem 510.Healthcare provider 502 may obtain information fromsystem 510 one time or multiple times. Information betweenhealthcare provider 502 andsystem 510 may be initiated in any suitable way. - In some embodiments,
device 504 may be any suitable device thathealthcare provider 502 may use to obtain information fromsystem 510. For instance,device 504 may be a dedicated mobile phone (e.g., a cellular phone), a mobile smart phone, a personal digital assistant (PDA), a laptop computer, a tablet computer, or any other mobile device capable of supporting an exchange of information through a communications medium (e.g., a wired or wireless communications medium). In some embodiments,healthcare provider 502 is not limited to obtaining information by using a mobile device and may use any device capable of obtaining information. For instance,healthcare provider 502 may obtain information from 510 by using a telephone connected to landline, a desktop computer connected to a network such as the Internet, or using any other device capable of communicating withsystem 510. It should also be recognized that ifhealthcare provider 502 obtains information fromsystem 510,healthcare provider 502 is not limited to using the same device. Thus,healthcare provider 502 may obtain information using one or a plurality of different devices, each of which may be any suitable device capable of obtaining information. - Information may be any suitable information relating to patient data and/or library data. Information is not limited by the type of communications infrastructure or communications medium used to obtain the information. For example, information may be patient information such as but not limited to a patient's identity, cancer type, gene fusion, and/or HLA allele information. As another example, information may be library information such as but not limited to peptide sequence information, peptide-HLA affinities, sequences of DNA and/or RNA encoding peptide sequence information, and/or gene fusion information.
- In the illustrated embodiment,
device 504 communicates withsystem 510 through acommunication medium 508.Communication medium 508 may be any suitable network or other type of communication medium. For example,communication medium 508 may be a cellular network, a local area network, a circuit-switched telephone network, a public-switched telephone network, the Internet, some combination of any of the foregoing, or any other communication medium capable of supporting telecommunications. - In the illustrated embodiment,
device 504 is communicatively coupled tocommunication medium 508 viawireless connection 506 andsystem 510 is communicatively coupled tocommunication medium 508 using awired connection 516. This is merely for illustration, asdevice 504 andsystem 510 each may be communicatively coupled tocommunication medium 508 in any suitable way including wired and/or wireless connections. -
System 510 comprises one or more computers (e.g., servers) each configured to perform processing related to supporting matching patient data and library data. In the illustrated embodiment,system 510 comprises asingle server 512, though in other embodiments any suitable number of servers may be used and distributed in any manner. For instance, in some embodiments,system 510 may comprise at least ten, at least one hundred, at least one thousand, or at least ten thousand servers. For embodiments in whichsystem 510 comprises multiple servers, the servers need not be located in the same physical location and may be distributed across multiple physical locations. - Each server, such as
server 512, may be configured (alone or in combination with one or more other servers) to support one or more applications and may be configured to execute any other programs. For example, one or more of the servers may be configured to execute programs for supporting functionality related to patient data, library data, patient and library matching, and/or any other functions used in embodiments of the present methods. - As previously discussed, a healthcare provider, such as
healthcare provider 502, may conduct one or multiple analyses withsystem 510. Multiple analyses may take place over any suitable time period of any suitable length. In some embodiments,system 510 calculates HLA-peptide affinities. In some embodiments,system 510 calculates HLA-peptide matching and a healthcare provider obtains this information. In some embodiments, a healthcare provider receives matched HLA-peptide information fromsystem 510. - As discussed herein,
system 510 may obtain any suitable data associated with one or more healthcare providers (e.g., information identifyinghealthcare provider 502, patient information, library information, patient and library matching information, etc.).System 510 may obtain any of the above-described data, associated with one or more healthcare providers, in any suitable way. For example,system 510 may extract this data from information collected fromhealthcare provider 502. In this case,system 510 may store at least a portion of the obtained data on one ormore storage devices 516 so that it may be retrieved from the one or more storage devices for subsequent use as discussed herein. - Storage device(s) 516 may be any suitable storage device(s) or article(s) of manufacture capable of storing information. For example, storage device(s) 516 may be any non-transitory computer readable storage medium or media such as a computer memory (RAM and/or ROM), one or more hard disk drives, one or more optical disks (CDs and/or DVDs), one or more magnetic tapes, one or more flash memories, one or more circuit configurations in Field Programmable Gate Arrays and/or any other suitable device(s).
- In the illustrated embodiment, storage device(s) 516 are shown as being part of
system 510 and as being connected toserver 512 bywired connection 514. It should be appreciated that all embodiments are not limited in this respect. For example, in other embodiments, storage device(s) 516 may be connected toserver 512 using any suitable type of connection or communication medium, and may be internal or external tosystem 510. When storage device(s) 516 are external tosystem 510, the system may be communicatively coupled to storage device(s) 516 to obtain information from them in any suitable manner. - While
FIG. 5 shows only a single healthcare provider using asingle device 504, it should be recognized that embodiments of the present method are not limited in this respect and thatsystem 510 may be configured to service any number of healthcare providers (e.g., hundreds, thousands, or greater) who may be using any number of devices (e.g., hundreds, thousands, or greater). Data associated with one or more patients made by each healthcare provider may be stored on at least one storage device (e.g.,storage device 516 and/or on devices that the healthcare provider(s) use). - Regardless of where data associated with one or more patients involving one or more healthcare providers may be stored, such data may be stored in any suitable form.
FIG. 6 shows a non-limiting example of a data structure 600 that may be used to store data associated with one or more patients in accordance with one embodiment. While in the illustrated embodiment data structure 600 is shown in the form of a table, this is not a limitation of the present method, as any suitable data structure may be used to store the data. - Data structure 600 may store any suitable data associated with one or more patients between any of one or more healthcare providers and
system 510. In one non-limiting example described herein, data structure 600 may storepatient identification data 602,patient data 604,library data 606, and/or data matching 608. In some embodiments,patient identification data 602 comprises information relating to patient identification such as name and date of birth. In some embodiments,patient data 604 comprises information relating to a patient's cancer type, gene fusion information, and/or HLA allele information. In some embodiments,library data 606 comprises information relating to peptide sequence, peptide-HLA affinity, sequences of DNA and/or RNA encoding peptides, gene fusion sequences, gene fusion cancer types, and IC50. In some embodiments, data matching 608 comprises information relating to peptide population coverage, allele coverage, and information matching peptides to HLA alleles, peptides to gene fusions, and/or peptides to cancer types. However, it should be recognized that these examples are not limiting, and that data structure 600 may store any other data associated with one or more patients. - For each patient, data structure 600 may store one or more data records. A data record may store any suitable data associated with a patient and may store such data in any suitable format (e.g., in one or more fields). Each field may store any suitable amount of data and any suitable type of data and, for example, may store alphanumeric data representing the data directly, or a pointer to another location where data may be stored. In some instances, data structure 600 may store the same type of data record for each patient, but this is not a limitation on the data structure or other aspects of the methods described herein, as in other embodiments, data structure 600 may store one type of data record for one patient and another type of data record for another patient. For example, a data record for one patient may store a different amount of data than another data record for another patient.
- Data structure 600 may store any suitable number of data records. In
FIG. 6 , data structure 600 is shown as storing four data records, but it should be appreciated that the data structure may store many more (e.g., hundreds, thousands, millions, etc.) data records. - Each data record in data structure 600 is shown as having four fields; however, this is for purposes of illustration only and is not a limitation of the present methods as any suitable number of fields may be used. For instance, any suitable number of fields may be used to store information identifying the patient, and any suitable number of fields may be used to store data associated with the patient.
-
FIG. 7 shows a flow chart of an illustrative process for matching patient data and library data, in accordance with some embodiments of the present method. -
Process 700 begins inact 702, where patient data may be received from a healthcare provider. The patient data may be received by a system, such assystem 510, and may be received in any suitable way. Next,process 700 proceeds to act 704, where library information is obtained. - After the library information is obtained in
act 704,process 700 proceeds to decision block 706, where it is determined whether patient information obtained inact 702 matches library information obtained inact 704. For example, it may be determined, indecision block 706, whether the patient is a candidate for treatment with one or more peptide vaccines from the library. As disclosed herein, such data may include patient allele data, peptide sequence information, and/or any of the other types of data described herein. - If it is determined, in
decision block 706, that library data does not match data associated with one or more patients,process 700 proceeds to act 712, where a patient may be identified as a candidate for de novo vaccine generation and treatment or a candidate for alternative treatment. - If it is determined in
decision block 706 that library data matches patient data,process 700 proceeds to act 708, where at least a portion of the library data may be retrieved. The data to retrieve may be any suitable data and may be determined in any suitable way. After peptide library data associated with one or more patients is retrieved inact 708,process 700 proceeds to act 710, where peptide information is sent to the healthcare provider. - An illustrative implementation of a
computer system 810 that may be used in connection with any of the embodiments of the method described herein is shown inFIG. 8 . Thecomputer system 800 may include one ormore processors 810 and one or more articles of manufacture that comprise non-transitory computer-readable storage media (e.g.,memory 820 and one or more non-volatile storage media 830).Processor 810 may control writing data to and reading data frommemory 820 andnon-volatile storage device 830 in any suitable manner, as the aspects of the method described herein are not limited in this respect. - To perform any of the functionality described herein,
processor 810 may execute one or more processor-executable instructions stored in one or more non-transitory computer-readable storage media (e.g., memory 820), which may serve as non-transitory computer-readable storage media storing processor-executable instructions for execution byprocessor 810. - The terms “program” or “software” are used herein in a generic sense to refer to any type of computer code or set of processor-executable instructions that can be employed to program a computer or other processor to implement various aspects of embodiments as discussed herein. Additionally, it should be appreciated that according to one aspect, one or more computer programs that when executed perform methods described herein need not reside on a single computer or processor, but may be distributed in a modular fashion among different computers or processors to implement various aspects of the present method.
- Programs for Fusion Detection in RNA Sequence and/or WGS Data
- In some embodiments, any one of the more than 30 publicly available programs for fusion detection can be used (programs available at omicstools (omictools.com/gene-fusion-detection-category). In some embodiments, more than one program for fusion detection is used. In some embodiments, the results from different fusion detection programs may significantly diverge.
- In some embodiments, fusion detection programs are alignment-based programs that map reads to a reference and infer breakpoint positions from discordantly aligned reads. The majority of existing programs are alignment-based programs. However, alignment-based programs may differ in references (genome, transcriptome or both) or aligners, e.g., STAR (ncbi.nlm.nih.gov/pmc/articles/PMC3530905/), TopHat2 (ncbi.nlm.nih.gov/pmc/articles/PMC4053844/) or bowtie2 (ncbi.nlm.nih.gov/pmc/articles/PMC3322381/) and therefore give very diverse results.
- In some embodiments, de novo assembly-based programs perform transcriptome assembly and align obtained sequences to a reference transcriptome and thus find chimeric transcripts. In some embodiments, the de novo assembly-based program JAFFA (genomemedicine.biomedcentral.com/articles/10.1186/s13073-015-0167-x) can be used in ‘assembly’ mode.
- In some embodiments, fusion detection programs are a hybrid of alignment-based and de-novo assembly-based approaches. In some embodiments, the hybrid approach first aligns reads to known transcriptome similar to the alignment-based approach. In some embodiments, the hybrid approach re-assembles unaligned reads and fragments spanning a breakpoint to new sequences. In some embodiments, the hybrid approach re-assembles unaligned reads and fragments spanning a breakpoint to new sequences using TRUP (ncbi.nlm.nih.gov/pmc/articles/PMC4300615/).
- In some embodiments, fusion callers may be used for de novo assembly. In some embodiments, fusion callers consume a lot of resources and time. In some embodiments, fusion callers and alignment-based tools gave the same results.
- In some embodiments, a program has filters that influence the results produced by the program. In some embodiments, a program has its own set of filters with specific default values. In some embodiments, a program has a filter for low fusion coverage that filters out low frequency junction or spanning reads. In some embodiments, a program has a filter for homology that filters out fusion partners with long homological regions. In some embodiments, a program has a filter for minimal distance between fusion partners that filters out potential read through transcripts. In some embodiments, a program has a promiscuity filter that filters out fusions containing partner transcripts which are presented in many other fusions. In some embodiments, a program generates a program-specific list of frequent false-positives.
- In some embodiments, multiple fusion detection programs are used to determine a gene fusion recurrence rate. In some embodiments, four fusion detection programs are used to identify gene fusions. In some embodiments, a gene fusion is detected by two out of four fusion detection programs. In some embodiments, the fusion detection programs used are ChimeraScan (ncbi.nlm.nih.gov/pmc/articles/PMC3187648/), SOAP-fuse (ncbi.nlm.nih.gov/pmc/articles/PMC4054009/), and Integrate (genome.cshlp.org/content/early/2015/11/10/gr.186114.114.abstract).
- In some embodiments, fusion-derived peptide lengths are calculated from gene fusions. In some embodiments, computational algorithm (1) is used for calculating fusion-derived peptide lengths,
-
- wherein X is a fusion of genes A and B, SA1 is a transcript sequence of A to the left of the fusion breakpoint, SA2 is a transcript sequence of A to the right of the fusion breakpoint, SB1 is a transcript sequences of B to the left of the fusion breakpoint, SB2 is a transcript sequence of B to the right of the fusion breakpoint, SA1∩SB2 is a fusion transcript sequence, SA1∩SA2 is a transcript sequence of gene A, SB1∩SB2 is a transcript sequence of gene B, L is the peptide length, Right and Left return a given number of bases to rightmost or leftmost, Shift skips a given number of bases on the left, RF is a position of a base in open reading frame, and LRF is the length of ORF. Fusion X yields a joint set of mutant peptides {S(X,Li)} where peptide length Li varies in some predefined range Lmin . . . Lmax.
- In some embodiments, HLA genotyping is calculated in silico from genome, exome, transcriptome, and/or HLA sequencing data. In some embodiments, a set of predicted HLA alleles that a patient may have is generated using computation algorithm (2),
-
- wherein Hi is a HLA genotyping algorithm, Aij is a set of HLA alleles predicted by algorithm Hi, and CA is a set of HLA alleles. In some embodiments, Aij should have 4-digit precision (e.g., HLA-A0201). In some embodiments, the set of HLA alleles CA is used for matching patient and vaccine.
- Algorithms are available for predicting MHC-peptide binding affinity and (algorithms available at cancerimmunity.org/resources/webtools/or cbs.dtu.dk/services/). In some embodiments, MHC-peptide binding was predicted with NetMHC and NetMHCpan programs (NetMHC (ncbi.nlm.nih.gov/pubmed/26258412, NetMHCpan ncbi.nlm.nih.gov/pubmed/25588790).
- In some embodiments, MHC molecules of class I consist of a heavy chain and a light chain and bind to peptides comprising 8 to 11 amino acids. In some embodiments, MHC molecule of class I bind to peptides comprising 9 or 10 amino acids. In some embodiments, long peptides or entire proteins are degraded in the cell, bound to MHC proteins, and presented to cytotoxic T-cells.
- In some embodiments, HLA proteins bind peptides comprising 8 to 14 amino acids. In some embodiments, peptides with predicted IC50<500 nM are considered to bind to HLA proteins. In some embodiments, peptides with predicted IC50<50 nM are considered as strong binders to HLA proteins. In some embodiments, peptides with predicted IC50>500 nM are considered as non-binders to HLA proteins. In some embodiments, non-binding peptides are filtered out from a list of peptides. In some embodiments, a population coverage for each long peptide is calculated using only those HLA proteins that can bind its short derivatives. In some embodiments, a long peptide comprising 30 amino acids can be shortened into peptides comprising 9 amino acids for predicting binding to HLA proteins. In some embodiments, mutant peptides are compared to wild type counterparts for binding affinity.
- In some embodiments, a population coverage of fusion-derived peptides is calculated. In some embodiments, a population coverage of fusion-derived peptides is an estimate of how many patients will be eligible candidates for vaccination with the fusion-derived peptide. In some embodiments, a population coverage of fusion-derived peptides is calculated from the incidence of the corresponding gene fusion. In some embodiments, a population coverage of fusion-derived peptides is calculated from the allele frequency of HLA proteins that bind to the fusion-derived peptide. In some embodiments, a population coverage of fusion-derived peptides is calculated using computation algorithm (3),
-
P=Σ i Q(F i)(1−Σj′(1−Q(A ij′))2 (3) - wherein Aij′=∪k (Ajjk), Aij′ is a set of alleles matching peptides yielded by fusion Fi, Fi is a set of fusions yielding a set of peptides Dij comprising the given peptide vaccine, Aijk is the HLA alleles that can bind peptide Dij, Q(Aijk) is the allele frequency of allele Aijk, Q(Fi) is the incidence rate of fusion Fi, and P is the probability that a patient will be a candidate for treatment with the peptide vaccine.
- “Fusion transcript” refers to a product of fusion gene. Fusion transcript and chimeric transcript are used interchangeably.
- “Fusion protein” or “chimeric protein” refers to a product of a fusion transcript and may emerge from genomic rearrangement, read through transcript, or trans-splicing. Fusion protein and chimeric protein are used interchangeably.
- “Fusion variant” refers to a variant at particular breakpoints in fusion partner genes. “Fusion exonic variant” refers to a variant at breakpoints leading to fusion of the same partner gene exons.
- “Point of junction” and “breakpoint” refer to the point at which two genes, transcripts, or proteins are fused together.
- “Administering” or “administration” means providing a material to a subject in a manner that is pharmacologically useful.
- “At risk” patients are patients that a health practitioner believes has a chance of having a disease, disorder or condition as provided herein.
- “HLA proteins” refers to human leukocyte antigen (HLA) proteins that bind peptides resulting from proteolytic cleavage of protein antigens and representing potential T-cell epitopes, transporting them to the cell surface and presenting them there to specific cells, in particular cytotoxic T-lymphocytes or T-helper cells. HLA proteins are products of HLA genes that are classified into two gene groups coding for different proteins, namely proteins of HLA class I and proteins of HLA class II. HLA class I proteins and HLA class II proteins are specialized for different antigen sources. HLA class I proteins present endogenously synthesized antigens, for example viral proteins and tumor antigens. HLA class II proteins present protein antigens originating from exogenous sources, for example bacterial products. “HLA protein” and “MHC protein” are used interchangeably.
- “Vaccine” refers to a composition for generating immunity for the prophylaxis and/or treatment of diseases. Vaccines are compositions comprising antigens and are intended to be used in humans or animals for generating specific defense and protective substance by vaccination.
- “Peptide” refers to a series of residues, typically L-amino acids, connected one to the other, typically by peptide bonds between the α—amino and carboxyl groups of adjacent amino acids. Peptides can be a variety of lengths, either in neutral (uncharged) forms or in forms which are salts, and either free of modifications or containing modifications, subject to the condition that the modification not destroy the biological activity of the peptide as described herein. It should be appreciated that a “peptide sequence” or “sequence” may be used to refer to a “peptide” having a particular sequence in the present disclosure in some contexts. In some embodiments, a “long peptide” refers to a peptide comprising about 11-30 amino acid residues corresponding to the fusion breakpoint. In some embodiments, the long peptide is processed into a neoantigenic peptide comprising about 8-11 amino acid residues.
- “Neoantigen” refers to a tumor antigen which is produced from tumor-specific mutations in expressed genes. “Fusion-derived”, “fusion-specific”, and “neoantigen” are used interchangeably. “Neoantigenic peptides” refers to peptides that comprise tumor-specific amino acid sequences (e.g., that contain a fusion junction that is only found in cancer cells due to the genetic rearrangement that is only present in the cancer cells). “Fusion-derived peptide”, “fusion-specific peptide”, and “neoantigenic peptide” are used interchangeably.
- “IC50” refers to the concentration of gene fusion peptide necessary for inhibiting binding of a standard peptide to the HLA protein by fifty percent.
- “Patient coverage” refers to the percentage of patients (e.g., in a population, for example in a population that is being treated or evaluated) that have a gene fusion corresponding to a fusion-specific neoantigen present in the vaccine library and that have HLA proteins capable of binding the fusion-specific neoantigen.
- “Pulsing” refers to the process of antigen loading onto a cell, wherein the antigen may be a nucleic acid or a peptide.
- A therapeutic cancer vaccine should guide the immune response and be readily combine with other therapies. Therapeutic cancer vaccines can be composed of processed tumor cells, peptides, whole proteins, DNA, or mRNA. Vaccine antigens include tumor-associated antigens (TAA), differentiation antigens, or cancer-testis antigens. However, many antigens that are present in cancer cells are also present in peripheral organs, thus specifically targeting cancer cells is difficult. The first and only FDA approved therapeutic cancer vaccine called “Provenge” showed modest efficacy in prostate cancer (ncbi.nlm.nih.gov/pubmed/16809734).
- Advances in sequencing technologies and bioinformatics algorithms have made it possible to identify mutations in whole cancer genomes. However, “de novo” identification of mutations from whole genome (WGS), whole exome (WES) or RNA sequencing data is expensive and time consuming. Many patients are in need of immediate treatment, especially patients with aggressive tumors like lung cancer, advanced melanoma, or acute leukemia.
- Fusion genes have a higher reoccurrence rate than the reoccurrence rates of missense mutations or frameshift mutations. Highly mutated genes including TP53, PIK3CA, EGFR, KRAS, BRAF, and NRAS can be found across different tumor types, yet the reoccurrence rate of mutations in these genes is low. Moreover, recurrent fusion genes and recurrent driver mutations are often mutually exclusive. Thus, recurrent fusions are attractive as a source of neoantigens for the construction of “off-the-shelf” vaccine libraries for at least two reasons: high recurrence rate and the ability to drive cancer (ncbi.nlm.nih.gov/pubmed/25500544). The following examples provide a background for the construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines.
- In one study (ncbi.nlm.nih.gov/pubmed/25428507), neoantigenic peptides were identified and used for vaccination of mice. The study showed that two 3-methylcholanthrene-induced sarcoma cell lines d42m1-T3 and F244 were effectively rejected with anti-PD-1 and/or anti-CTLA-4 therapies. The immunological nature of the rejection was confirmed with multiple experimental approaches including depleting CD4+ and CD8+ T-cells with mouse antibodies, performing experiments in mice lacking T, B, natural killer T-cells or dendritic cells, and generating immunological memory in the mice.
- The study identified neoantigens responsible for the checkpoint blockade therapy-mediated tumor rejection using a genomic approach. The approach was initially established for identifying TSA responsible for spontaneous rejection of d42m1 sarcomas (ncbi.nlm.nih.gov/pubmed/22318521). The study included features including mutation calling from exome sequencing data, translating mutations to corresponding protein sequences, predicting peptide-MHC class I binding affinity for each epitope, prioritizing epitopes, and filtering out epitopes with lower expression level and lower binding affinity in comparison to the wild-type peptides. Two mutant epitopes for murine MHC H-2 Kb were identified in this study: ITYTWTRL (SEQ ID NO: 612) (A506T mutation in alpha-1,3-glucosyltransferase) and VGFNFRTL (SEQ ID NO: 613) (G1254V mutation in laminin alpha subunit 4). Both epitopes were shown to be targets of CD8+ T-cells generated as a consequence of anti-PD1 treatment by experiments including MHC tetramer-binding assays, mass spectrometry detection of epitopes, and ELISPOT assays. Mice were vaccinated with two peptide vaccines based on the identified mutant epitopes and 9/10 mice rejected their tumors and survived. As a negative control, mice were vaccinated with human papillomavirus 28-mer peptides and only 1/10 mice survived. In multiple experiments of mice vaccination, the survival rate for mice vaccinated with therapeutic neoantigenic vaccines was 85% while the survival rate of mice vaccinated with human papillomavirus peptides was only 10%.
- In another study (ncbi.nlm.nih.gov/pubmed/25901682), a bioinformatics approach was used to detect tumor-specific mutations from cancer exome sequencing data for B 16F10 tumor (melanoma) and colon carcinoma model CT26 in three independent mouse models with different MHC backgrounds. Mutant epitopes were prioritized using both MHC class I and class II prediction algorithms. A considerable fraction of detected mutations produced immunogenic neoantigens which can be recognized by both CD8+ and CD4+ T-cells. Vaccination with the identified immunogenic neoantigens produced anti-tumor activity and complete tumor rejection. About two-thirds of the mice vaccinated with the neoantigenic peptides were alive at day 100 while all untreated mice died at day 65. Interestingly, depletion experiments showed that CD4+ instead of CD8+ T-cells played a major role in anti-cancer response efficacy. Also, immunization with neoantigens encoded by mRNA elicited higher anti-tumor activity than immunization with peptides only. Taken together, this study showed that both MHC class I and class II restricted epitopes can be selected based on binding affinity and can display high anti-tumor potency.
- In another study (ncbi.nlm.nih.gov/pubmed/25428506), neoepitopes were identified using whole-exome and transcriptome sequencing analysis with mass spectrometry. This approach identified neoepitopes in MC-38 and TRAMP-C1 mouse tumor cell lines using mutation calling from sequencing data, identification of expressed neoantigens using RNA-sequencing data, prediction of MHC class I binding interactions, and filtering of immunogenic epitopes. Six epitopes were predicted to bind with an IC50 less than 500 nM. Immunization of C57BL/6 mice with peptides encoding all six mutated epitopes elicited CD8+ T-cell responses in three out of six mice. Vaccination with long peptides encoding mutant epitopes had therapeutic and preventive effects. Subsequent challenging of vaccinated mice with MC-38 tumor cells didn't result in tumor spreading or growth compared to mice immunized with adjuvant only which experienced tumor spreading and growth.
- As described herein, bioinformatics pipelines for detecting and prioritizing neoantigens in whole cancer exomes and/or transcriptomes have made it possible to select targets for vaccination using solely in silico simulation steps. Computational pipelines validated in mice models have improved mouse survival rates and inspired confidence in the potential success of vaccination with personalized neoantigenic vaccines in humans.
- The following two examples illustrate a non-limiting schematic pipeline used for neoantigen generation from sequencing data (
FIG. 1 ). - In one study (ncbi.nlm.nih.gov/pubmed/24894089), epitope-MHC class I binding prediction algorithms were applied to a large set of neoantigens which had been known to induce strong anti-tumor activity or long-term cancer control. The study analyzed 40 epitopes previously identified as cytotoxic T-cell targets in the literature including 35 epitopes resulting from missense mutations and 5 epitopes resulting from frame-shift mutations. All epitopes were restricted by HLA class I alleles and were present in non-small cell lung cancer, melanoma, renal cell carcinoma, bladder cancer, B-cell acute lymphoblastic leukemia, multiple myeloma, and chronic lymphocytic leukemia. All epitopes were neoantigens that had been identified from cloning, mass spectrometry experiments, genomic mutations, and epitope-binding predictions. Using artificial neural network based prediction algorithms, 27 of 31 of the epitopes recognized by T-cells were predicted to have binding affinity of less than 500 nM to MHC class I proteins. Two-thirds of the patients experienced spontaneous complete tumor regression or tumor regression following therapy. Thus, in silico peptide-MHC class I binding predictions provided a reliable tool to identify neoantigens from exome and/or transcriptome data, and inclusion of such neoantigens in vaccine formulations provided tumor regression in patients.
- In another study (ncbi.nlm.nih.gov/pubmed/24891321), neoantigens in human cancer genomes were identified using bioinformatics. A bioinformatics pipeline was applied to 91 whole exomes obtained from chronic lymphocytic leukemias (CLL) biopsies from a group of patients who developed durable remission after allo-HSCT. On average 20 neoantigens derived from 16 missense mutations were predicted to bind HLA class I proteins and more than 50% of all neoantigen were confirmed to bind HLA proteins with biochemical studies. The general steps of the computational pipeline were DNA sequencing, mutation calling, peptide-MHC class I predictions, and experimental validation of binding peptides. From a total of 1838 detected mutations, 3 general classes of mutations were identified including missense, frameshift and splice site mutations. The most abundant class of mutations were missense mutations which represented more than 90% of all detected mutations in cancer genomes (or exomes). A computational pipeline was applied to 2488 whole exome sequences from 13 tumor types and to a large set of HLA alleles. The analysis revealed that one point mutation produced on average 1 to 5 neoantigens and 1 frameshift mutation produced 4 neoantigens with an IC50<50 nM. Neoantigens derived from frameshift mutations and gene fusions are expected to be more specific and more immunogenic because there is no corresponding wild type peptide. The study demonstrated that neoantigens derived from frameshift mutations and from gene fusions can be predicted using computational methods.
- The Wilms tumor gene 1 (WT1) can be used as a biomarker in different cancer types including acute myeloid leukemia (AML). In the clinical trial NCT00398138, WT1-positive patients with AML were treated with synthetic analogs of WT1 protein fragments in combination with adjuvants. Synthetic peptide analogs of WT1 protein fragments were designed to bind HLA molecules better than wild-type counterparts and were shown to more effectively induce a WT1-specific T-cell response compared to wild-type counterparts.
- Anchor-modified peptides derived from PASD1 were shown to induce a cytotoxic T-cell response against tumor cells in AML patients. Interestingly, their non-modified wild-type analogs demonstrated no detectable binding to HLA proteins. These two examples demonstrate that neoantigenic peptide modifications can lead to an increase in peptide immunogenicity.
- The Philadelphia chromosome is the result of a translocation between chromosomes 22 and 9. This translocation is present in several cancers types and most notably the translocation is present in ˜95% of chronic myelogenous leukemia (CML) cases. The translocation produces a fusion between BCR and ABL1 genes. The ABL1 kinase is constitutively active in the BCR/ABL1 fusion protein and this upregulation of activity leads to dysregulation of cell division and development of cancer.
- The sequence spanning the BCR/ABL1 breakpoint is absent in normal tissues and is present only in cancer cells, thus it may be recognized and attacked by the immune system. In a series of recent studies, peptides spanning the BCR/ABL breakpoint were shown to stimulate the immune response.
- Cancer specific gene fusions have been used as neoantigens in several anti-cancer vaccines (Table 1). The EWS/FLI1 gene fusion is present in more than 85% of Ewing's sarcoma tumors (ncbi.nlm.nih.gov/pubmed/17250957) and the PAX-3/FKHR gene fusion is present in 55% of patients with alveolar rhabdomyosarcoma (ARMS) (ncbi.nlm.nih.gov/pubmed/12039929).
-
TABLE 1 List of fusions used as neoantigens in anti-cancer vaccines. Gene Fusion Patent BCR/ABL-1 [1-5] google.com.ar/patents/U.S. Pat. No. 5,997,869 EWS/FLI-1 (ncbi.nlm.nih.gov/pubmed/12039929) google.com.ar/patents/U.S. Pat. No. 5,997,869 PAX-3/FKHR (ncbi.nlm.nih.gov/pubmed/12039929) google.com.ar/patents/U.S. Pat. No. 5,997,869 TMPRSS2/ERG (ncbi.nlm.nih.gov/pubmed/24149465) - Detection of recurrent chimeric transcripts was performed on 34 follicular lymphoma (FL) transcriptome samples from SRP048820 (ncbi.nlm.nih.gov/pubmed/25607463) and SRP056293 (ncbi.nlm.nih.gov/pmc/articles/PMC4676270/). Transcriptome samples included read through transcripts, products of trans-splicing, and chimeric transcripts formed as a result of genomic rearrangements. Chimeric transcripts were identified as recurrent if present in one or more of the FL transcriptome samples. Chimeric transcripts were identified as present in the sample if detected using two or more software programs, wherein the software programs were ChimeraScan, SOAPFuse, and Integrate.
- An average of 28-29 fusion candidates were detected per sample. A total of 308 fusion candidates were detected with 149 of the fusion candidates found in more than one sample. A number of gene fusions present in the FL samples are also found in other cancer types including gastric, colon, breast, and prostate cancers (Table 2).
- Neoantigenic peptides for each recurrent fusion protein having a predicted IC50 less than 500 nM to HLA class I proteins were selected. The prediction analysis can be performed using various length peptides, for example a peptide with 9 amino acids corresponding to 9 amino acids of the fusion junction. HLA class I alleles that bind to peptides with an IC50 less than 500 nM are identified as binding (Table 3). All fusion-derived peptides were novel and could be placed into a vaccine library. Patients are eligible for vaccination if they have a gene fusion corresponding to a fusion-derived peptide in the library and if the patient has at least one MHC class I alleles capable of binding to the fusion-derived peptide in the library. Methods of selecting a patient for vaccination and vaccine compositions are described herein.
-
TABLE 2 Recurrent Fusions Detected in Follicular Lymphoma (FL) Samples Breakpoint Number of Samples Non-FL Cancer Type Gene Fusion Coordinates Fusion/Total (References) DUS4L/BCAP29 chr7: 107217037 4/34 Gastric Cancer chr7: 107221204 (ncbi.nlm.nih.gov/pubmed/24240688) RRM2/C2orf48 chr2: 10269281 2/34 BT474 and SKBR3 cell lines chr2: 10281981 (ncbi.nlm.nih.gov/pubmed/23956304) PRKAA1/TTC33 chr5: 40764616 13/34 Colon, Kidney, Stomach, Breast, chr5: 40747121 Ovary, Uterus Cancers (ncbi.nlm.nih.gov/pubmed/23226102) MTG1/LOC619207 chr10: 135216277 8/34 Breast Cancer chr10: 135269741 (ncbi.nlm.nih.gov/pubmed/22496456) CIRBP/C19orf24 chr19: 1274439 14/34 Prostate Cancer chr19: 1277182 (google.com/patents/WO2012149522A1?cl=en) -
TABLE 3 Predicted HLA Alleles of Recurrent Fusion-Derived Peptides. Gene Number of HLA class I alleles Fusion Fusion Sequence peptides (9 AA) (IC50 < 500 nM) DUS4L/ VWRITGTDGVKKKMTLQW 13 HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, HLA-A*02:06, BCAP29 AAV HLA-A*02:11, HLA-A*02:12, HLA-A*02:16, HLA-A*02:19, (SEQ ID NO.: 404) HLA-A*02:50, HLA-A*11:01, HLA-B*15:03, HLA-B*27:20, HLA-B*39:01 RRM2/ RLMLELGFSKVLGDREVQS 37 HLA-A*02:01, HLA-A*02:02, HLA-A*02:03, C2orf48 RWSPGPRGDSTPVREMETN HLA-A*02:06, HLA-A*02:11, HLA-A*02:12, HPPSVRG HLA-A*02:16, HLA-A*02:19, HLA-A*02:50, (SEQ ID NO.: 405) HLA-A*30:01, HLA-A*31:01, HLA-A*32:07, HLA-A*33:01, HLA-A*68:01, HLA-B*07:02, HLA-B*15:03, HLA-B*18:01, HLA-B*27:20, HLA-B*40:01, HLA-B*40:02, HLA-B*40:13, HLA-B*42:01, HLA-B*44:02, HLA-B*45:01, HLA-B*73:01, HLA-C*03:03, HLA-C*07:01, HLA-C*12:03 PRKAA1/ TYLLDFRSIDEWLPLGGRG 34 HLA-A*02:03, HLA-A*02:06, HLA-A*02:11, TTC33 KLVRRSQRSLPSSLKLKLLM HLA-A*02:16, HLA-A*02:50, HLA-A*03:01, RRM HLA-A*11:01, HLA-A*30:01, HLA-A*31:01, (SEQ ID NO.: 406) HLA-A*32:07, HLA-A*32:15, HLA-A*33:01, HLA-A*68:23, HLA-B*07:02, HLA-B*08:01, HLA-B*15:01, HLA-B*15:03, HLA-B*15:17, HLA-B*27:05, HLA-B*27:20, HLA-B*35:01, HLA-B*39:01, HLA-B*40:13, HLA-B*42:01, HLA-B*53:01, HLA-B*57:01, HLA-B*58:01 HLA-C*03:03, HLA-C*12:03,HLA-C*15:02 MTG1/ LYTLNKHQRFGWTRCSEAG 208 HLA-A*31:01, HLA-B*27:20, HLA-C*06:02 LOC619207 VQTQHVRRSGVGPTPRGM GIRVQPGVDAGRGLCRVQA AGLRPCRGRPQVCPAAWR DGPALASQRVLPGQRVLPL GVQPWLMVPEPVPPRMGG GRAVLQRHFPGAPAGEGPQ SLRGTPRDQKREWGGPPLC PACGGGHGVLPGAGVRPCA PGPPPGRGRRQEVPGLQGY RAHHPQLQTGQQLPQRLRP AAGRRGGLLR (SEQ ID NO.: 407) CIRBP/ non-coding 0 — C19orf24 - Two fusion transcripts can be found in solitary fibrous tumors. The transcripts are formed from fusion of exon 4 of the Nab2 gene (5′ partner gene) with exon 2 of the Stat6 gene (3′ partner gene) and exon 6 of the Nab2 gene (5′ partner gene) with exon 16 of the Stat6 gene (3′ partner gene). The amino acid sequence of the Nab2/Stat6 fusion protein is shown below. A novel amino acid sequence is generated when exon 4 of Nab2 is fused with exon 2 of Stat6 because of the presence of an untranslated region at the beginning of exon 2 of Stat6. Exon 6 of the Nab2 gene is fused with exon 16 of the Stat6 gene in frame.
-
Nab2/Stat6 (Nab2 exon 4 to Stat6 exon 2) fusion protein (COSF1547) (SEQ ID NO.: 408) MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQ RANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQ KALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGE KAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE EEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVE RIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV ARESTYLSSLKGSRLHPEELGGPPLKKLKQEATSKSQIMSLWGLVSKMPP EKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQ HLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVME QFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSL HSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQLAG NGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLD EVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGAPAKPPLVR ADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALFKN LLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVV IVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAE VGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGF TFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFLLR FSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQL KNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQ MPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESV NVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLC SDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGE SGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW Nab2/Stat6 (Nab2 exon 6 to Stat6 exon 16) fusion protein (COSF1561) (SEQ ID NO.: 409) MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQ RANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQ KALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGE KAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE EEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPEMVRMVVESVE RIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQV ARESTYLSSLKGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESY VPPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLW SRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAGSPQIENIQPF SAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYV PATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQV YPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQ GLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFP PLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR ANPSW - In the case of COSF1547, a long peptide having a sequence GPPLKKLKQEATSKSQIMSLWGLVSKM (SEQ ID NO.: 410) was used for generating neoantigenic peptides (8-11 amino acids) for predicting peptide binding to MHC class I proteins. The example below contains predicted neoantigenic peptides having 9 amino acids.
- In the case of COSF1561, a long peptide having a sequence PCVPAKPPLAGSPQIENIQP (SEQ ID NO: 614) was used for generating neoantigenic peptides having 8-11 amino acids for predicting peptide binding to MHC class I proteins.
- A set of neoantigenic peptides comprising 8-11 amino acids was generated for all available MHC class I alleles using prediction algorithms described herein and filtering out of all epitopes with IC50>500 nM. Those MHC class I proteins that are able to effectively bind Nab/Stat6 fusion-derived neoepitopes are listed in the Table 4.
- For Nab2/Stat6 COSF1547, the allele coverage was calculated to be 94% meaning that 94% of the population can effectively present neoantigenic peptides derived from the long peptide spanning the Nab2/Stat6 fusion breakpoint. The Nab2/Stat6 COSF1547 fusion incidence rate is around 34% in solitary fibrous tumors. The patient coverage of the fusion-derived long peptide from Nab2/Stat6 COSF1547 is around 32%. For COSF1561, patient coverage of the fusion-derived long peptide is about 20%.
- Both recurrent Nab2/Stat6 fusion-derived long peptides spanning fusion breakpoints are original and placed into the vaccine library. Results for another less frequent Nab2/Stat6 fusion (COSF1561, exon 6 of Nab2 to exon 17 of Stat6) are also shown in Table 4.
-
TABLE 4 Nab/Stat6 fusion-derived peptides predicted to bind HLA alleles. Long peptide spanning HLA class I alleles fusion breakpoint and 8-11-mer neoantigenic that bind neoantigens Fusion yielding neoantigens peptides (SEQ ID NO.) (IC50 < 500 nM) Nab2/Stat6 GPPLKKLKQE ATSKSQI MS ATSKSQIM (429) HLA-A*02:01 COSF1547 LWGLVSKM EATSKSQI (430) HLA-A*02:02 (SEQ ID NO.: 426) IMSLWGLV (431) HLA-A*02:03 KSQIMSLW (432) HLA-A*02:06 QIMSLWGL (433) HLA-A*02:11 SKSQIMSL (434) HLA-A*02:17 EATSKSQIM (435) HLA-A*03:01 KLKQEATSK (436) HLA-A*11:01 QEATSKSQI (437) HLA-A*30:01 QIMSLWGLV (438) HLA-A*32:01 SQIMSLWGL (439) HLA-A*68:01 TSKSQIMSL (440) HLA-A*68:02 ATSKSQIMSL (441) HLA-A*69:01 IMSLWGLVSK (442) HLA-B*15:01 KKLKQEATSK (443) HLA-B*15:03 KQEATSKSQI (444) HLA-B*15:17 KSQIMSLWGL (445) HLA-B*35:01 QEATSKSQIM (446) HLA-B*39:01 SQIMSLWGLV (447) HLA-B*40:01 TSKSQIMSLW (448) HLA-B*40:02 ATSKSQIMSLW (449) HLA-B*44:02 EATSKSQIMSL (450) HLA-B*45:01 IMSLWGLVSKM (451) HLA-B*48:01 KQEATSKSQIM (452) HLA-B*57:01 KSQIMSLWGLV (453) HLA-B*58:01 LKQEATSKSQI (454) HLA-C*03:03 QEATSKSQIMS (455) HLA-C*12:03 QIMSLWGLVSK (456) HLA-C*15:02 SQIMSLWGLVS (457) Nab2/Stat6 PCVPAKPPLAGSPQIENIQP PLAGSPQI (458) HLA-A*02:11 COSF1561 (SEQ ID NO.: 427) PPLAGSPQI (459) HLA-B*07:02 KPPLAGSPQI (460) HLA-B*15:17 LAGSPQIENI (461) HLA-B*42:01 GSPQIENIQPF (462) HLA-C*03:03 PLAGSPQIENI (463) HLA-C*12:03 Nab2/Stat6 PCVPAKPPLAAEQMGKDG AEQMGKDG (464) HLA-A*03:01 COSF1561 RGY LAAEQMGK (465) HLA-A*68:01 (SEQ ID NO.: 428) PPLAAEQM (466) HLA-B*07:02 KPPLAAEQM (467) HLA-B*35:01 PLAAEQMGK (468) HLA-B*42:01 VPAKPPLAA (469) HLA-B*44:02 AEQMGKDGRGY (470) HLA-B*44:03 LAAEQMGKDGR (471) HLA-B*45:01 PAKPPLAAEQM (472) HLA-C*03:03 HLA-C*12:03 - In total, 8 exonic variants of the TMPRSS2/ERG fusion from the COSMIC database were analyzed. The majority of the discovered antigenic peptides were not previously published. The TMPRSS2/ERG fusion is specific to prostate cancer and has quite a high incidence rate. The major protein coding exonic variant is estimated to be found in over 10% of cases. Further analysis showed that a vaccine based on TMPRSS2/ERG fusion-derived neoantigens can be used for about 20,000 prostate cancer patients a year in the USA.
-
TABLE 5 Population coverage of TMPRSS2/ERG fusion peptides. Long peptide spanning fusion breakpoint and Population yielding neoantigens HLA class (alleles that bind covered by (number of neoantigens) neoantigens (IC50 < 500 nM) the alleles DGVSHCPGGEDENRCGSLISCE (3) B*40:01, B*40:02, C*12:03 18% (SEQ ID NO.: 473) FLVGAALAAGLLWKFRSLISCE (13) A*02:01, A*02:02, A*02:03, A*02:06, A*02:11, 73% (SEQ ID NO.: 474) A*02:17, A*30:01, A*31:01,A*33:01, A*68:01, B*08:01, B*15:03, C*03:03, C*12:03 FLVGAALAAGLLWKFRTLLMNAVW A*02:01, A*02:02, A*02:03, A*02:06, A*02:11, 92% PKAGRW (22) A*02:17, A*03:01, A*11:01, A*24:03, A*30:01, (SEQ ID NO.: 475) A*31:01, A*32:01, A*33:01, A*68:01, A*69:01, B*08:01, B*15:03, B*15:17, B*27:05, B*39:01, B*57:01, B*58:01, C*03:03, C*12:03, C*14:02, C*15:02 MALNSEALSVVSEDQSLFEC (9) A*02:01, A*02:02, A*02:03, A*02:06, A*02:11, 67% (SEQ ID NO.: 476) A*02:17, A*68:02, A*69:01, B*15:03, B*15:17, B*35:01, B*40:02, B*45:01, B*53:01, C*03:03, C*12:03, C*14:02, C*15:02 MALNSPSGSEQLVDGLAY (11) A*01:01, A*02:02, A*02:11, A*02:17, A*26:01, 88% (SEQ ID NO.: 477) A*29:02, A*68:02, B*07:02, B*15:01, B*15:03, B*15:17, B*18:01, B*35:01, B*40:01, B*40:02, B*42:01, B*44:02, B*44:03, B*45:01, C*03:03, C*15:02 MALNSVIPGSLETRGKPC (10) A*02:01, A*02:02, A*02:03, A*02:06, A*02:11, 78% (SEQ ID NO.: 478) A*11:01, A*30:01, A*31:01, A*68:01, A*69:01, B*15:01, B*15:03, B*15:17, B*35:01, C*03:03, C*12:03, C*14:02 VCTQPKSPSGTVCTSRSLISCE (5) A*31:01, A*68:02, B*15:17, C*03:03 17% (SEQ ID NO.: 479) VCTQPKSPSGTVCTSSYSRIFGDPRK A*02:01, A*02:02, A*02:03, A*02:11, A*03:01, 98% AVLT (60) A*11:01, A*29:02, A*30:01, A*30:02, A*31:01, (SEQ ID NO.: 480) A*32:01, A*33:01, A*68:01, A*68:02, B*07:02, B*15:01, B*15:03, B*15:17, B*35:01, B*42:01, B*44:03, B*53:01, B*57:01, B*58:01, C*03:03, C*05:01, C*07:02, C*08:02, C*12:03, C*14:02, C*15:02 - Four exonic variants of the ETV6/NTRK3 fusion from the COSMIC database were analyzed to predict neoantigen peptides. All of the predicted neoantigen peptides were not previously published. According to the COSMIC database, this fusion was found in congenital (infantile) fibrosarcoma, mesoblastic nephroma, breast ductal secretory carcinoma, mammary analogue secretory carcinoma of salivary glands, thyroid carcinoma, and intestine carcinoma. This demonstrated that neoantigen vaccines based on a single fusion can target a wide spectrum of tumor types.
-
TABLE 6 ETV6/NTRK3 fusion-derived peptides predicted to bind HLA alleles. Long peptide spanning fusion breakpoint and Population yielding neoantigens HLA class I alleles that bind covered by (number of neoantigens) neoantigens (IC50 < 500 nM) the alleles IHTQPEVILHQNHEEDVQH A*02:02, A*02:03, A*02:11, A*33:01, A*68:01, B*15:03, 68% IKRRDIVLKRE (8) B*40:01, B*44:02, C*06:02, C*07:01, C*12:03 (SEQ ID NO.: 481) IHTQPEVILHQNHEEGPVA A*02:02, A*02:03, A*02:11, A*02:17, B*15:03, B*15:09, 48% VISGEEDSASP (10) B*39:01, B*40:01, B*40:02, B*45:01, C*07:01, C*12:03, (SEQ ID NO.: 482) C*14:02 VSPPEEHAMPIGRIADVQH A*02:03, A*02:06, A*02:11, A*03:01, A*11:01, A*30:01, 92% IKRRDIVLKRE (14) A*31:01, A*33:01, A*68:01, A*68:02, B*07:02, B*08:01, (SEQ ID NO.: 483) B*27:05, B*35:01, B*42:01, B*58:01, C*03:03, C*06:02, C*07:01, C*12:03, C*15:02 VSPPEEHAMPIGRIADVQH A*02:02, A*02:03, A*02:06, A*02:11, A*02:17, A*30:01, 66% IKRRDIVLKRE (11) A*32:01, A*68:02, A*69:01, B*07:02, B*15:01, B*15:17, (SEQ ID NO.: 484) B*27:05, B*35:01, B*39:01, B*42:01, B*58:01, C*03:03, C*12:03, C*14:02, C*15:02 - FUS/ERG fusion can be found, for example, in acute myeloid leukaemia and occurs due to fusion of exon 7 of the FUS gene with
exon 11 of the ERG gene. The amino acid sequence of the FUS/ERG fusion protein is shown below. -
FUS/ERG (Fus exon 7 to exon 11 of Erg) fusionprotein (COSF315) (SEQ ID NO.: 485) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY GQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGY GQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYN PPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQS GGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGG RGGMGGSDRGGFNKFGGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFK MTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF DFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPV TSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY - The fusion-derived long peptide having the sequence SDRGGFNKFGGSGQIQLWQF (SEQ ID NO: 615) was used for generating neoantigenic peptides (8-11 amino acids) for predicting peptide binding to MHC class I proteins. Results are shown in the Table 7. In the case of acute myeloid leukaemia, patient coverage of the fusion-derived long peptide is about 10%. Recurrent FUS/ERG fusion-derived long peptides are original and placed into the vaccine library.
-
TABLE 7 FUS/ERG fusion-derived peptides predicted to bind HLA alleles. HLA class I Long peptide spanning neoantigenic peptides alleles that bind fusion breakpoint and (8-11 amino acids) neoantigens Fusion yielding neoantigens (SEQ ID NO.) (IC50 <500 nM) FUS/ERG GPPLKKLKQE ATSKSQI MSLW GSGQIQLW (487) HLA-A*24:02 COSF315 GLVSKM KFGGSGQI (488) HLA-A*24:03 (SEQ ID NO.: 486) FGGSGQIQL (489) HLA-B*15:17 GGSGQIQLW (490) HLA-B*39:01 KFGGSGQIQL (491) HLA-B*57:01 KFGGSGQIQLW (492) HLA-B*58:01 NKFGGSGQIQL (493) HLA-C*03:03 HLA-C*14:02 - FUS/DDIT3 fusions can be found, for example, in myxoid-round cell liposarcoma. The most frequent subtypes of this fusion are formed due to junction of exon 5 of Fus with exon 2 of DDIT3, exon 7 of Fus with exon 2 of DDIT3, and exon 8 of Fus with exon 2 of DDIT3. The amino acid sequences of the FUS/DDIT3 fusion proteins are shown below. In each fusion protein, a stop codon occurs soon after the breakpoint due to a frameshift. Neoantigens predictions were calculated using long peptides having 10 amino acids to the left and all amino acids to the right from the fusion junction.
-
FUS/DDIT3 (Fus exon 5 to exon 2 of DDIT3) fusion protein (COSF300) (SEQ ID NO.: 494) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY GQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGY GQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYN PPQGYGQQNQYNSSSGGGGGGGGGVFKKEVYLHTSPHLKAD FUS/DDIT3 (Fus exon 7 to exon 2 of DDIT3) fusion protein (COSF302) (SEQ ID NO.: 495) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY GQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGY GQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYN PPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQS GGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGG RGGMGGSDRGGFNKFGVFKKEVYLHTSPHLKAD FUS/DDIT3 (Fus exon 8 to exon 2 of DDIT3) fusion protein (COSF301) (SEQ ID NO.: 496) MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY GQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGY GQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYN PPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQS GGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGG RGGMGGSDRGGFNKFGGPRDQGSRHDSVFKKEVYLHTSPHLKAD - Fusion-derived long peptides that were used for generating neoantigenic peptides having 8-11 amino acids for predicting peptide binding to MHC class I are shown in Table 8. Patient coverage with three fusion-derived long peptides is around 50% for myxoid-round cell liposarcoma. Recurrent FUS/DDIT3 fusion-derived peptides spanning fusion breakpoints are original and placed into vaccine library.
-
TABLE 8 FUS/DDIT3 fusion-derived peptides predicted to bind HLA alleles. Long peptide spanning fusion breakpoint and neoantigens peptides HLA class I alleles that bind Fusion yielding neoantigens (8-11 amino acids) neoantigens (IC50 < 500 nM) FUS/DDIT3 SGGGGGGGGGVFK HTSPHLKA (498) HLA-A*02:01, HLA-A*02:02, COSF300 KEVYLHTSPHLKAD KEVYLHTS (499) HLA-A*02:03, HLA-A*02:06, (SEQ ID NO.: 497) VFKKEVYL (500) HLA-A*02:11, HLA-A*02:17, VYLHTSPH (501) HLA-A*03:01, HLA-A*11:01, YLHTSPHL (502) HLA-A*23:01, HLA-A*24:02, EVYLHTSPH (503) HLA-A*24:03, HLA-A*26:01, GVFKKEVYL (504) HLA-A*29:02, HLA-A*30:01, KEVYLHTSP (505) HLA-A*33:01, HLA-A*66:01, VYLHTSPHL (506) HLA-A*68:01, HLA-A*68:02, YLHTSPHLK (507) HLA-A*69:01, HLA-B*15:01, EVYLHTSPHL (508) HLA-B*15:03, HLA-B*15:03, YLHTSPHLKA (509) HLA-B*40:01, HLA-B*40:02, EVYLHTSPHLK (510) HLA-B*44:03, HLA-B*45:01, KEVYLHTSPHL (511) HLA-C*03:03, HLA-C*12:03, GVFKKEVY (512) HLA-C*14:02 FUS/DDIT3 SDRGGENKFGVEKK FNKFGVFK (514) HLA-A*02:01, HLA-A*02:02, COSF302 EVYLHTSPHLKAD GFNKFGVF (515) HLA-A*02:03, HLA-A*02:06, (SEQ ID NO.: 513) GVFKKEVY (516) HLA-A*02:11, HLA-A*02:17, HTSPHLKA (517) HLA-A*03:01, HLA-A*11:01, KEVYLHTS (518) HLA-A*23:01, HLA-A*24:02, NKFGVFKK (519) HLA-A*24:03, HLA-A*26:01, VFKKEVYL (520) HLA-A*29:02, HLA-A*30:01, VYLHTSPH (521) HLA-A*31:01, HLA-A*33:01, YLHTSPHL (522) HLA-A*66:01, HLA-A*68:01, EVYLHTSPH (523) HLA-A*68:02, HLA-A*69:01, FNKFGVFKK (524) HLA-B*15:01, HLA-B*15:03, GFNKFGVFK (525) HLA-B*40:01, HLA-B*40:02, GGFNKFGVF (526) HLA-B*44:03, HLA-B*45:01, GVFKKEVYL (527) HLA-C*03:03, HLA-C*12:03, KEVYLHTSP (528) HLA-C*14:02 VYLHTSPHL (529) YLHTSPHLK (530) EVYLHTSPHL (531) FGVFKKEVYL (532) GFNKFGVFKK (533) YLHTSPHLKA (534) EVYLHTSPHLK (535) FNKFGVFKKEV (536) GGFNKFGVFKK (537) KEVYLHTSPHL (538) KFGVFKKEVYL (539) NKFGVFKKEVY (540) RGGFNKFGVFK (541) FUS/DDIT3 PRDQGSRHDSVFKK DSVFKKEV (543) HLA-A*02:01, HLA-A*02:02, COSF301 EVYLHTSPHLKAD GSRHDSVF (544) HLA-A*02:03, HLA-A*02:06, (SEQ ID NO.: 542) HTSPHLKA (545) HLA-A*02:11, HLA-A*02:17, KEVYLHTS (546) HLA-A*03:01, HLA-A*11:01, SRHDSVFK (547) HLA-A*23:01, HLA-A*24:02, SVFKKEVY (548) HLA-A*24:03, HLA-A*26:01, VFKKEVYL (549) HLA-A*29:02, HLA-A*30:01, VYLHTSPH (550) HLA-A*33:01, HLA-A*66:01, YLHTSPHL (551) HLA-A*68:01, HLA-A*68:02, EVYLHTSPH (552) HLA-A*69:01, HLA-B*15:01, GSRHDSVFK (553) HLA-B*15:03, HLA-B*15:17, KEVYLHTSP (554) HLA-B*27:05, HLA-B*40:01, QGSRHDSVF (555) HLA-B*40:02, HLA-B*44:03, SRHDSVFKK (556) HLA-B*45:01, HLA-C*03:03, SVFKKEVYL (557) HLA-C*06:02, HLA-C*07:01, VYLHTSPHL (558) HLA-C*12:03, HLA-C*14:02, YLHTSPHLK (559) HLA-C*15:02 DQGSRHDSVF (560) EVYLHTSPHL (561) GSRHDSVFKK (562) RHDSVFKKEV (563) YLHTSPHLKA (564) EVYLHTSPHLK (565) KEVYLHTSPHL (566) RDQGSRHDSVF (567) SRHDSVFKKEV (568) - While the BCR/ABL1 fusion and its immunogenic properties have been described, the most comprehensive neoantigens were discovered by the disclosed method, namely two fusion peptides that are present in 68% of patients (
FIG. 4 ). In this non-limiting example, the method described in the specification is applied to identification of BCR/ABL1 fusion peptides for the treatment of CML. Three breakpoints in BCR and ABL1 genes are marked with arrows inFIG. 4 . Fusion at these breakpoints yields two BCR/ABL1 gene fusions that are present in 90% of CML patients which comprises 45,000 patients in the U.S. and 950,00 patients worldwide (2). The method discloses two BCR/ABL1 fusion peptides selected based on allele coverage and patient coverage that are present in 68% of CML patients which means that 30,000 patients in the U.S. and 650,000 patients worldwide are eligible for treatment with a cancer vaccine comprising these two peptides shown inFIG. 4 . The sequences correspond to SEQ ID NOs: 610 to 611 from top to bottom, respectively. - The COSMIC database contains over 18 exonic variants of the BCR/ABL1 fusion that were analyzed and yielded neoantigen peptides. Half of the fusion exonic variants yielded peptides that were not previously published. According to COSMIC, the fusion variants are found in CML and ALL (including T-ALL and B-ALL).
-
TABLE 9 BCR/ABL1 fusion-derived peptides predicted to bind HLA alleles. Long peptide spanning fusion Population breakpoint and yielding neoantigens HLA class I alleles that bind covered by (number of neoantigens) neoantigens (IC50 <500 nM) the alleles ASEETYLSHLEALLLKPFSGQ (6) A*03:01, A*11:01, A*23:01, A*24:03, 79% (SEQ ID NO.: 569) A*30:01, A*68:01, B*15:01, B*15:03, B*18:01, B*35:01, B*40:01, B*40:02, B*44:02, B*44:03, C*14:02 EITPRRQSMTVKKGEKPFSGQ (6) A*11:01, A*68:01, B*15:01, B*15:03, 37% (SEQ ID NO.: 570) B*15:17, C*03:03, C*14:02 EITPRRQSMTVKKGESYTFLISSDY A*23:01, A*25:01, A*26:01, A*29:02, 77% ERAEW (17) A*30:01, A*30:02, A*32:01, A*68:01, (SEQ ID NO.: 571) B*15:01, B*15:03, B*15:17, B*35:01, B*40:01, B*40:02, B*44:02, B*44:03, B*45:01, B*57:01, B*58:01, C*03:03 GVATDIQALKAAFDVKALQRPVAS A*02:02, A*02:03, A*02:11, A*03:01, 64% DFEPQG (14) A*11:01, A*30:01, A*31:01, A*68:01, (SEQ ID NO.: 572) A*68:02, B*15:01, B*15:03, B*15:17, B*39:01, B*58:01, C*03:03, C*12:03 GVATDIQALKAAFDVRPSPCEDRH A*31:01, A*68:01, B*15:01, B*15:03, 88% WPGLAL (15) B*15:09, B*15:17, B*35:01, B*38:01, (SEQ ID NO.: 573) B*39:01, B*40:01, B*40:02, B*42:01, B*48:01, B*53:01, B*58:01, C*03:03, C*06:02, C*07:01, C*07:02, C*12:03, C*14:02 KLQTVHSIPLTINKEAGSIEALQRPV A*02:11, A*02:17, A*11:01, A*68:01, 53% ASDF (14) A*68:02, B*15:03, B*15:17, B*35:01, (SEQ ID NO.: 574) B*39:01, B*40:01, B*40:02, B*42:01, B*45:01, C*03:03, C*12:03, C*15:02 KLQTVHSIPLTINKEEALQRPVASD A*31:01, A*68:01, B*07:02, B*15:17, 64% FEPQG (11) B*35:01, B*40:02, B*42:01, B*44:02, (SEQ ID NO.: 575) B*45:01, C*03:03, C*14:02 KLQTVHSIPLTINKEGEKLRVLGYN A*11:01, A*31:01, A*68:01, B*15:17, 54% HNGEW (10) B*40:02, B*44:02, B*44:03, C*03:03, (SEQ ID NO.: 576) C*15:02 KTRVYRDTAEPNWNEKPFSGQ (5) A*68:01, B*15:03, B*35:01, B*42:01, 32% (SEQ ID NO.: 577) B*53:01, C*03:03, C*12:03 KTRVYRDTAEPNWNELDPQALQD A*68:02, A*69:01, B*39:01, B*40:01, 45% RDWQRTV (5) B*40:02, B*44:02, C*03:03, C*12:03 (SEQ ID NO.: 578) LNVIVHSATGFKQSSKALQRPVAS A*02:11, A*03:01, A*11:01, A*30:01, 63% DFEPQG (17) A*31:01, A*68:01, A*68:02, B*15:03, (SEQ ID NO.: 579) B*15:09, B*15:17, B*39:01, B*58:01, C*03:03, C*12:03, C*14:02, C*15:02 LNVIVHSATGFKQSSSEKLRVLGY A*01:01, A*11:01, A*30:01, A*31:01, 88% NHNGEW (18) A*68:01, B*15:01, B*15:03, B*15:09, (SEQ ID NO.: 580) B*15:17, B*18:01, B*39:01, B*44:02, B*44:03, C*03:03, C*06:02, C*07:01, C*15:02 QIWPNDGEGAFHGDAEALQRPVAS A*24:03, A*68:02, B*15:09, B*35:01, 88% DFEPQG (11) B*38:01, B*39:01, B*40:01, B*40:02, (SEQ ID NO.: 581) B*44:02, B*45:01, C*03:03, C*06:02, C*07:01, C*07:02, C*12:03, C*14:02 QIWPNDGEGAFHGDAGEKLRVLG A*24:03, B*15:09, B*15:17, B*38:01, 74% YNHNGEW (7) B*39:01, B*44:02, B*44:03, C*03:03, (SEQ ID NO.: 582) C*06:02, C*07:01, C*12:03, C*14:02 QWSHQQRVGDLFQKLNLRARSNK A*02:06, A*02:11, A*03:01, A*11:01, 50% DAKDPTT (8) A*30:01, A*31:01, A*33:01, A*68:01, (SEQ ID NO.: 583) B*15:03 RKQTGVFGVKIAVVTKSPSAASSI A*02:03, A*02:06, A*11:01, A*30:01, 41% (10) A*31:01, B*15:03, B*15:17, B*39:01, (SEQ ID NO.: 584) C*03:03, C*12:03, C*14:02, C*15:02 SNKDAKDPTTKNSLEKALQRPVAS A*02:02, A*02:03, A*02:11, A*03:01, 68% DFEPQG (10) A*11:01, A*30:01, A*68:01, A*69:01, (SEQ ID NO.: 585) B*15:03, B*15:17, B*39:01, B*40:02, B*44:02, B*58:01, C*03:03, C*12:03, C*14:02, C*15:02 SRDALVSGALESTKATKAKPFSGQ A*03:01, A*11:01, A*30:01, A*31:01, 63% (SEQ ID NO.: 586) A*68:01, B*15:01, B*15:03, B*15:17, B*57:01, B*58:01, C*03:03, C*14:02 - The EWSR1/FLI1 fusion can be found, for example, in Ewing's sarcoma. Two most frequent types of EWSR1/FLI1 fusions occur due to junction of exon 7 of the EWSR1 gene with exon 5 or exon 6 of the FLI1 gene. The amino acid sequences of the fusion proteins are shown below.
- Fusion-derived peptides having 8-10 amino acids corresponding to the fusion junction were used for predicting peptide binding to MHC class I proteins. Results are shown in Table 10. Some of the immunogenic EWSR1/FLI1 derived peptides were previously disclosed by patent application U.S. Pat. No. 5,997,869A and were also successfully discovered using methods described herein.
-
EWSR1/FLI1 (EWSR1 exon 7 to exon 6 of FLI1) fusion protein (COSF166) (SEQ ID NO.: 587) MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDV SYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDT TTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQ PQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQP TSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQA PSQYSQQSSSYGQQNPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT EQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEG TNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGK RYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPH PSSMPVTSSSFFGAASQYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY EWSR1/FLI1 (EWSR1 exon 7 to exon 5 of FLI1) fusion protein (COSF168) (SEQ ID NO.: 588) MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDV SYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDT TTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQ PQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQP TSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQA PSQYSQQSSSYGQQSSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGN NMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQ LWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNY DKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYP SDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAASQYWTSPTGGIYP NPNVPRHPNTHVPSHLGSYY -
TABLE 10 EWSR1/FLI1 fusion-derived peptides predicted to bind HLA alleles. Long peptide spanning HLA class I alleles fusion breakpoint and 8-11-mer neo- that bind neoantigens Fusion yielding neoantigens antigenic peptides (IC50 < 500 nM) EWSR1/FLI1 SQQSSSYGQQNPSYDSVRRG SSYGQQNPSY (591) HLA-A*11:01 COSF166 (SEQ ID NO.: 589) SYGQQNPSY (592) HLA-A*29:02 SSYGQQNPSY (593) HLA-A*31:01 YGQQNPSY (594) HLA-A*68:01 NPSYDSVR (595) HLA-B*15:01 QQNPSYDSV (596) HLA-B*35:01 NPSYDSVRR (597) HLA-C*12:03 YGQQNPSY (598) QQNPSYDSVR (599) EWSR1/FLI1 SQQSSSYGQQSSLLAYNTTS GQQSSLLAY (600) HLA-A*24:02 COSF168 (SEQ ID NO.: 590) QQSSLLAY (601) HLA-A*29:02 SSSYGQQSSL (602) HLA-B*15:01 SSYGQQSSL (603) HLA-B*35:01 SSYGQQSSL (604) HLA-C*03:03 SSYGQQSSLL (605) HLA-C*06:02 SYGQQSSL (606) HLA-C*07:01 SYGQQSSLL (607) HLA-C*07:02 YGQQSSLL (608) YGQQSSLLAY (609) - All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
- From the above description, one skilled in the art can easily ascertain the essential characteristics of the present disclosure, and without departing from the spirit and scope thereof, can make various changes and modifications of the disclosure to adapt it to various usages and conditions. Thus, other embodiments are also within the claims.
- While several inventive embodiments have been described and illustrated herein, those of ordinary skill in the art will readily envision a variety of other means and/or structures for performing the function and/or obtaining the results and/or one or more of the advantages described herein, and each of such variations and/or modifications is deemed to be within the scope of the inventive embodiments described herein. More generally, those skilled in the art will readily appreciate that all parameters, dimensions, materials, and configurations described herein are meant to be exemplary and that the actual parameters, dimensions, materials, and/or configurations will depend upon the specific application or applications for which the inventive teachings is/are used. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific inventive embodiments described herein. It is, therefore, to be understood that the foregoing embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed. Inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein. In addition, any combination of two or more such features, systems, articles, materials, kits, and/or methods, if such features, systems, articles, materials, kits, and/or methods are not mutually inconsistent, is included within the inventive scope of the present disclosure.
- All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms.
- All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
- The indefinite articles “a” and “an,” as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean “at least one.”
- The phrase “and/or,” as used herein in the specification and in the claims, should be understood to mean “either or both” of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with “and/or” should be construed in the same fashion, i.e., “one or more” of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the “and/or” clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
- As used herein in the specification and in the claims, “or” should be understood to have the same meaning as “and/or” as defined above. For example, when separating items in a list, “or” or “and/or” shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as “only one of” or “exactly one of,” or, when used in the claims, “consisting of,” will refer to the inclusion of exactly one element of a number or list of elements. In general, the term “or” as used herein shall only be interpreted as indicating exclusive alternatives (i.e. “one or the other but not both”) when preceded by terms of exclusivity, such as “either,” “one of,” “only one of,” or “exactly one of.” “Consisting essentially of,” when used in the claims, shall have its ordinary meaning as used in the field of patent law.
- As used herein in the specification and in the claims, the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, “at least one of A and B” (or, equivalently, “at least one of A or B,” or, equivalently “at least one of A and/or B”) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
- It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
- In the claims, as well as in the specification above, all transitional phrases such as “comprising,” “including,” “carrying,” “having,” “containing,” “involving,” “holding,” “composed of,” and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases “consisting of” and “consisting essentially of” shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03. It should be appreciated that embodiments described in this document using an open-ended transitional phrase (e.g., “comprising”) are also contemplated, in alternative embodiments, as “consisting of” and “consisting essentially of” the feature described by the open-ended transitional phrase. For example, if the disclosure describes “a composition comprising A and B”, the disclosure also contemplates the alternative embodiments “a composition consisting of A and B” and “a composition consisting essentially of A and B”.
Claims (42)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US16/108,739 US20190030147A1 (en) | 2016-04-07 | 2018-08-22 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
US16/671,574 US11904002B2 (en) | 2016-04-07 | 2019-11-01 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662319774P | 2016-04-07 | 2016-04-07 | |
PCT/US2017/026723 WO2017177207A1 (en) | 2016-04-07 | 2017-04-07 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
US16/108,739 US20190030147A1 (en) | 2016-04-07 | 2018-08-22 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2017/026723 Continuation WO2017177207A1 (en) | 2016-04-07 | 2017-04-07 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/671,574 Continuation US11904002B2 (en) | 2016-04-07 | 2019-11-01 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
Publications (1)
Publication Number | Publication Date |
---|---|
US20190030147A1 true US20190030147A1 (en) | 2019-01-31 |
Family
ID=60001547
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/108,739 Abandoned US20190030147A1 (en) | 2016-04-07 | 2018-08-22 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
US16/671,574 Active US11904002B2 (en) | 2016-04-07 | 2019-11-01 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/671,574 Active US11904002B2 (en) | 2016-04-07 | 2019-11-01 | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
Country Status (3)
Country | Link |
---|---|
US (2) | US20190030147A1 (en) |
CA (1) | CA3056212A1 (en) |
WO (1) | WO2017177207A1 (en) |
Cited By (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20200138923A1 (en) * | 2017-06-21 | 2020-05-07 | Transgene | Personalized vaccine |
US20220396839A1 (en) * | 2019-11-12 | 2022-12-15 | Foundation Medicine, Inc. | Methods of detecting a fusion gene encoding a neoantigen |
US11793843B2 (en) | 2019-01-10 | 2023-10-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
US11904002B2 (en) | 2016-04-07 | 2024-02-20 | Bostongene Corporation | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
US11926667B2 (en) | 2020-10-13 | 2024-03-12 | Janssen Biotech, Inc. | Bioengineered T cell mediated immunity, materials and other methods for modulating cluster of differentiation IV and/or VIII |
US12295997B2 (en) | 2020-07-06 | 2025-05-13 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
US12391736B2 (en) | 2018-07-26 | 2025-08-19 | Curevac Netherlands B.V. | Off-the-shelf cancer vaccines |
Families Citing this family (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN109136277A (en) * | 2018-09-30 | 2019-01-04 | 北京鼎成肽源生物技术有限公司 | A kind of construction method of LRFFT2 cell |
EP4048304A1 (en) * | 2019-10-22 | 2022-08-31 | Institut Curie | Immunotherapy targeting tumor neoantigenic peptides |
WO2022009051A1 (en) * | 2020-07-06 | 2022-01-13 | Janssen Biotech, Inc. | A method for determining responsiveness to prostate cancer treatment |
EP4216991A1 (en) * | 2020-09-23 | 2023-08-02 | University of Houston System | Discovery and use of immunogenic peptides for the treatment and prevention of cancers |
WO2022125507A1 (en) * | 2020-12-07 | 2022-06-16 | Iogenetics, Llc | Personalized immunotherapies |
Family Cites Families (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5840839A (en) * | 1996-02-09 | 1998-11-24 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Alternative open reading frame DNA of a normal gene and a novel human cancer antigen encoded therein |
JP2005536987A (en) * | 2002-04-01 | 2005-12-08 | ユーロ−セルティーク エス.エイ. | Epitope construct containing antigen-presenting cell targeting mechanism |
US20060008468A1 (en) | 2004-06-17 | 2006-01-12 | Chih-Sheng Chiang | Combinations of tumor-associated antigens in diagnostics for various types of cancers |
US9732131B2 (en) * | 2006-02-27 | 2017-08-15 | Calviri, Inc. | Identification and use of novopeptides for the treatment of cancer |
PT3023788T (en) * | 2010-05-14 | 2020-05-18 | Massachusetts Gen Hospital | COMPOSITIONS OF SPECIFIC TUMOR NEOANTIGENS FOR USE IN TUMOR TREATMENT |
EP3511425A1 (en) * | 2012-07-12 | 2019-07-17 | Persimmune, Inc. | Personalized cancer vaccines and adoptive immune cell therapies |
US20150203589A1 (en) | 2012-07-24 | 2015-07-23 | The Trustees Of Columbia University In The City Of New York | Fusion proteins and methods thereof |
CN113337604A (en) * | 2013-03-15 | 2021-09-03 | 莱兰斯坦福初级大学评议会 | Identification and use of circulating nucleic acid tumor markers |
US9777333B2 (en) * | 2013-04-05 | 2017-10-03 | Life Technologies Corporation | Gene fusion |
JP7044551B2 (en) * | 2014-09-10 | 2022-03-30 | ジェネンテック, インコーポレイテッド | Immunogenic variant peptide screening platform |
ES2952603T3 (en) * | 2015-05-20 | 2023-11-02 | Univ California | Method to generate human dendritic cells for immunotherapy |
MX2017014700A (en) * | 2015-05-20 | 2018-08-15 | Broad Inst Inc | Shared neoantigens. |
MA44524A (en) | 2016-03-31 | 2019-02-06 | Neon Therapeutics Inc | NEOANTIGENS AND THEIR METHODS OF USE |
WO2017177207A1 (en) | 2016-04-07 | 2017-10-12 | Bostongene, Llc | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
-
2017
- 2017-04-07 WO PCT/US2017/026723 patent/WO2017177207A1/en active Application Filing
- 2017-04-07 CA CA3056212A patent/CA3056212A1/en not_active Abandoned
-
2018
- 2018-08-22 US US16/108,739 patent/US20190030147A1/en not_active Abandoned
-
2019
- 2019-11-01 US US16/671,574 patent/US11904002B2/en active Active
Cited By (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11904002B2 (en) | 2016-04-07 | 2024-02-20 | Bostongene Corporation | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines |
US20200138923A1 (en) * | 2017-06-21 | 2020-05-07 | Transgene | Personalized vaccine |
US11969462B2 (en) * | 2017-06-21 | 2024-04-30 | Transgene | Personalized vaccine |
US12391736B2 (en) | 2018-07-26 | 2025-08-19 | Curevac Netherlands B.V. | Off-the-shelf cancer vaccines |
US11793843B2 (en) | 2019-01-10 | 2023-10-24 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
US20220396839A1 (en) * | 2019-11-12 | 2022-12-15 | Foundation Medicine, Inc. | Methods of detecting a fusion gene encoding a neoantigen |
US12295997B2 (en) | 2020-07-06 | 2025-05-13 | Janssen Biotech, Inc. | Prostate neoantigens and their uses |
US11926667B2 (en) | 2020-10-13 | 2024-03-12 | Janssen Biotech, Inc. | Bioengineered T cell mediated immunity, materials and other methods for modulating cluster of differentiation IV and/or VIII |
Also Published As
Publication number | Publication date |
---|---|
CA3056212A1 (en) | 2017-10-12 |
US20200054728A1 (en) | 2020-02-20 |
WO2017177207A1 (en) | 2017-10-12 |
US11904002B2 (en) | 2024-02-20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11904002B2 (en) | Construction and methods of use of a therapeutic cancer vaccine library comprising fusion-specific vaccines | |
KR102591136B1 (en) | Population-based immunogenic peptide identification platform | |
KR102308798B1 (en) | Novel peptides, combination of peptides and scaffolds for use in immunotherapeutic treatment of various cancers | |
CA2797868C (en) | Compositions and methods of identifying tumor specific neoantigens | |
US11576954B2 (en) | Method for treating non-small lung cancer with a population of activated cells | |
WO2018015433A2 (en) | Selecting neoepitopes as disease-specific targets for therapy with enhanced efficacy | |
US20230348611A1 (en) | Obinutuzumab treatment of a dlbcl patient subgroup | |
WO2013083659A1 (en) | Combination treatment comprising ho - 1 inhibitor and immunotherapeutic agent | |
US20220313804A1 (en) | Hla tumor antigen peptides of class i and ii for treating mammary/breast carcinomas | |
BR112019021094A2 (en) | PEPTIDES AND COMBINATIONS OF THE SAME FOR USE IN IMMUNOTHERAPY AGAINST LEUKEMIA AND OTHER CANCERS | |
Oka et al. | WT1 peptide cancer vaccine for patients with hematopoietic malignancies and solid cancers | |
TW201925220A (en) | KIF20A epitope peptides for TH1 cells and vaccines containing the same | |
EA037271B1 (en) | Multi-peptide t specific immune therapy for treatment of brain metastases | |
JP6871432B2 (en) | HLA-A2 subtype-specific antigenic determinant derived from HLA-A2 that induces an antigen-specific T cell immune response to the PLK1 protein | |
US20240025959A1 (en) | Beclin 2 and uses thereof for treating cancer and neurodegenerative diseases | |
US20250255945A1 (en) | Click chemistry hla polypeptides | |
EA046410B1 (en) | IMMUNOGENETIC SCREENING TEST FOR CANCER | |
EA045699B1 (en) | PERSONALIZED PLATFORM FOR IMMUNOGENIC PEPTIDE IDENTIFICATION |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
AS | Assignment |
Owner name: BOSTONGENE, LLC, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ARTOMOV, MAKSYM;FRENKEL, FELIKS;GOLUBEV, IGOR;AND OTHERS;SIGNING DATES FROM 20150801 TO 20171212;REEL/FRAME:048276/0001 Owner name: BOSTONGENE CORPORATION, MASSACHUSETTS Free format text: ENTITY CONVERSION;ASSIGNOR:BOSTONGENE, LLC;REEL/FRAME:050467/0575 Effective date: 20180905 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |