US20180340017A1 - Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia - Google Patents

Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia Download PDF

Info

Publication number
US20180340017A1
US20180340017A1 US15/990,170 US201815990170A US2018340017A1 US 20180340017 A1 US20180340017 A1 US 20180340017A1 US 201815990170 A US201815990170 A US 201815990170A US 2018340017 A1 US2018340017 A1 US 2018340017A1
Authority
US
United States
Prior art keywords
sequence
seq
fragment
protein
meningococcal
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/990,170
Inventor
Xavier Nassif
Sandrine Bourdoulous
Olivier Join-Lambert
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Institut National de la Sante et de la Recherche Medicale INSERM
Universite Paris 5 Rene Descartes
Original Assignee
Institut National de la Sante et de la Recherche Medicale INSERM
Universite Paris 5 Rene Descartes
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Institut National de la Sante et de la Recherche Medicale INSERM, Universite Paris 5 Rene Descartes filed Critical Institut National de la Sante et de la Recherche Medicale INSERM
Priority to US15/990,170 priority Critical patent/US20180340017A1/en
Publication of US20180340017A1 publication Critical patent/US20180340017A1/en
Priority to US16/397,196 priority patent/US20190389927A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A61K39/095—Neisseria
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/40—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum bacterial
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/502—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects
    • G01N33/5041—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing non-proliferative effects involving analysis of members of signalling pathways
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/11—Antisense
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/195—Assays involving biological materials from specific organisms or of a specific nature from bacteria
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00—Screening for compounds of potential therapeutic value
    • G01N2500/02—Screening involving studying the effect of compounds C on the interaction between interacting molecules A and B (e.g. A = enzyme and B = substrate for A, or A = receptor and B = ligand for the receptor)
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2500/00—Screening for compounds of potential therapeutic value
    • G01N2500/10—Screening for compounds of potential therapeutic value involving cells

Definitions

  • the present invention concerns the use of an inhibitor of an interaction between type IV pilus-associated protein and CD147 for preventing or treating meningococcal bacteraemia and/or infection.
  • the present invention also relates to the combined use of such inhibitor and of an anti-bacterial compound, such as one used to prevent or treat a meningococcal infection.
  • the invention also relates to a method for the prevention and/or treatment of meningococcal bacteraemia and/or infection, and to a method for screening inhibitors of the interaction between type IV pilus-associated protein and CD147.
  • Meningococcus ( N. meningitidis , Nm), a cause of epidemic meningitis and sepsis, is a commensal Gram-negative bacterium of the human nasopharynx. After bloodstream invasion, virulent encapsulated bacteria adhere to brain endothelial cells and proliferate onto the apical surface of host cells to form microcolonies at the site of initial bacterial attachment, then cross the Blood Brain Barrier (BBB) to colonize meninges (Nassif et al., 2002, Trends Microbiol, 10:227-232).
  • BBB Blood Brain Barrier
  • meningitis The main clinical feature of meningococcal infection is meningitis.
  • Neisseria meningitidis is a frequent asymptomatic colonizer of the human nasopharynx, and only a very small proportion of infections proceed to a sustained bacteraemia.
  • N. meningitidis the presence of N. meningitidis in the bloodstream will remain asymptomatic.
  • the bacteria will interact with the brain endothelial cells and invade the meninges to be responsible for meningitis, which is the first clinical complication of meningococcal dissemination in 70% of patients.
  • Type IV pili are composed of hetero-multimeric pilin subunits, which are assembled into helical fibers by a complex machinery.
  • PilE the major pilin PilE required for piliation
  • other low-abundance pilins such as PilV, PilX or Comp
  • the adhesive properties of type IV pili are also modulated by components of the pilus machinery such as the PilC1 allele, making it difficult to identify the molecular determinants involved in direct interaction with host cell receptors using a genetic approach. As a consequence, the precise adhesive components of the complex pilus structure remain undefined.
  • the host G-protein-coupled ⁇ 2-adrenergic receptor is an essential endothelial receptor for meningococcal type IV pili to trigger signalling events (Coureuil et al., 2010, Cell, 143:1149-1160; Lecuyer et al., 2011, Infect Immun, 80:175-186).
  • Nm colonies at the cell surface of a human brain endothelial cell line promote the translocation of Barrs to the inner surface of plasma membrane, facing bacteria. Barrs translocated under the colonies serve as a scaffolding platform for signaling events elicited by Nm.
  • endothelial cells depleted of ⁇ 2-adrenergic receptors still support bacterial adhesion, indicating that type IV pili promote the primary attachment of meningococci by interaction with another as yet unknown receptor.
  • meningococci bacteraemia
  • meningococcal infection a meningococcal infection
  • the inventors have found that primary meningococcal adhesion to endothelial cells is mediated by the interaction between type IV pilus-associated proteins present at the surface of the meningococci and CD147 present at the surface of the host endothelial cells, and that such interaction can be blocked, thereby inhibiting meningococcal bacteraemia, and consequently meningococcal infection.
  • the invention relates to an inhibitor of an interaction between type IV pilus-associated proteins and CD147 for use for preventing or treating meningococcal bacteraemia and/or infection.
  • Said inhibitor is preferably (i) a CD147 inhibitor and/or (ii) a type IV pilus-associated protein inhibitor.
  • said interaction is a direct interaction.
  • said inhibitor comprises a CD147 inhibitor which is a polypeptide able to interact with the CD147 receptor and thereby inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • this polypeptide is an anti-CD147 antibody or antibody fragment, preferably directed against an extracellular portion of CD147, and by this interaction, in particular binding, said antibody inhibits interaction between type IV pilus-associated protein and CD147 receptor or prevent or abolish attachment of the type IV pilus-associated protein to the CD147.
  • said anti-CD147 antibody is the MEM-M6/6 antibody.
  • the polypeptide may be a type IV pilus-associated protein fragment which is able to bind to the CD147 receptor and compete with the bacteria, thereby inhibiting interaction between type IV pilus-associated protein and CD147 receptor or prevent or abolish attachment of the type IV pilus-associated protein to the CD147.
  • said inhibitor comprises a CD147 inhibitor which is a nucleic acid, preferably a dsRNA which silences CD147 expression.
  • Said CD147 inhibitor may comprise a siRNA or several siRNA silencing CD47 expression, preferably at least one siRNA of sequence SEQ ID NO: 1, 2, 3, 4 or 5.
  • said inhibitor comprises a type IV pilus-associated protein inhibitor which is a polypeptide able to interact with the type IV pilus-associated protein and thereby inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • this polypeptide is an anti-type IV pilus-associated protein antibody or antibody fragment, preferably directed against the binding site to the CD147 receptor, and by this interaction, in particular binding, said antibody inhibits interaction between type IV pilus-associated protein and CD147 receptor or prevents or abolishes attachment of the type IV pilus-associated protein to the CD147.
  • this polypeptide is a CD147 polypeptide, preferably a polypeptide comprising CD147 amino acid sequence or a fragment thereof able to bind to a type IV pilus-associated protein, wherein said antibody or polypeptide inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • said CD147 polypeptide comprises or consists of the soluble form of the extracellular domain of CD147, or a fragment thereof wherein said soluble form or fragment inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • Said soluble form of the extracellular domain of CD147 may comprise or consist of the sequence SEQ ID NO: 6, or a fragment thereof.
  • composition comprising an inhibitor of an interaction between type IV pilus-associated proteins and CD147 and a pharmaceutically acceptable vehicle, diluent or carrier.
  • compositions comprising an inhibitor of an interaction between type IV pilus-associated proteins and CD147 and additionally at least one anti-bacterial compound.
  • Said composition comprises a pharmaceutically acceptable vehicle, diluent or carrier.
  • the composition is for a simultaneous, separate or sequential administration to a mammal, including human.
  • said at least one anti-bacterial compound is (i) a meningococcal vaccine antigen, or (ii) a fusion protein comprising at least two meningococcal vaccine antigens.
  • Said meningococcal vaccine antigen may comprise or consist of a meningococcal PilE, PilV, PilX, PilC, ComP, fHbp, PorA, NHBA, NadA, MafA, NspA, HmbR, TbpB, AusP, or a fragment thereof.
  • an inhibitor of an interaction between type IV pilus-associated proteins and CD147 in a method of preventing the adhesion of a meningococcus to endothelial cells. This method may be used in vivo or in vitro.
  • Also provided is a method for preventing or treating meningococcal bacteraemia and/or meningococcal infection comprising administering to an individual in need thereof (mammal, preferably human) a therapeutically effective amount of an inhibitor of an interaction between type IV pilus-associated proteins and CD147, or a composition as disclosed and provided herein.
  • meningococcal bacteraemia is meant the transient passage of a viable meningococcus in the blood of the host without any clinical symptoms.
  • meningococcal infection it is meant the sustained presence of viable meningococcus in a host with clinical symptoms.
  • a meningococcus is meant the Neisseria meningitidis (Nm) bacteria, preferably a Nm of serogroup A, B, C, Y or W135.
  • Nm Neisseria meningitidis
  • type IV pilus-associated protein is meant a protein that is present at the surface of the pilus of a bacterium.
  • said type IV pilus-associated protein may be the PilE, the PilV, the PilX, the PilC, or the ComP protein.
  • said type IV pilus-associated protein is a PilE or PilV protein, and more preferably a PilE or PilV protein derived from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • CD147 also called Basigin (BSG) or extracellular matrix metalloproteinase inducer (EMMPRIN), is a member of the immunoglobulin superfamily that contains two heavily glycosylated C2 type immunoglobulin-like domains at the N-terminal extracellular portion.
  • BSG Basigin
  • EMMPRIN extracellular matrix metalloproteinase inducer
  • CD147 comprises or consists of:
  • interaction between type IV pilus-associated protein and CD147 is meant the direct interaction between type IV pilus-associated protein present at the surface of the meningococcus and CD147 present at the surface of the endothelial cells, such as peripheral or brain endothelial cells, of the host.
  • the inventors have found that the direct interaction between type IV pilus-associated protein and CD147 allows the adhesion of meningococcus to the endothelial cells, thereby allowing the meningococcus to infect blood vessels, such as brain blood vessels and peripheral vessels.
  • inhibitor an agent that is able to reduce or to abolish the interaction between type IV pilus-associated protein and CD147. Said inhibitor may also be able to reduce or abolish the expression of CD147. According to the invention, said inhibitor is (i) a CD147 inhibitor and/or (ii) a type IV pilus-associated protein inhibitor.
  • said inhibitor is able to reduce or to abolish the interaction between type IV pilus-associated protein and CD147, by at least 10, 20, 30, 40%, more preferably by at least 50, 60, 70%, and most preferably by at least 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100%.
  • polypeptides and nucleic acid includes both the amino acid sequences and nucleic acid sequences disclosed herein and variants of said sequences.
  • Variant proteins may be naturally occurring variants, such as splice variants, alleles and isoforms, or they may be produced by recombinant means. Variations in amino acid sequence may be introduced by substitution, deletion or insertion of one or more codons into the nucleic acid sequence encoding the protein that results in a change in the amino acid sequence of the protein. Optionally the variation is by substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids with any other amino acid in the protein. Additionally or alternatively, the variation may be by addition or deletion of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids within the protein.
  • Variant nucleic acid sequences include sequences capable of specifically hybridizing to the sequence of SEQ ID Nos: 1-5, 9, 10 under moderate or high stringency conditions.
  • Stringent conditions or high stringency conditions may be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5 ⁇ SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5 ⁇ Denhardt's
  • Moderately stringent conditions may be identified as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and % SDS) less stringent that those described above.
  • washing solution and hybridization conditions e.g., temperature, ionic strength and % SDS
  • An example of moderately stringent conditions is overnight incubation at 37° C.
  • fragments of the proteins and variant proteins disclosed herein are also encompassed by the invention. Such fragments may be truncated at the N-terminus or C-terminus, or may lack internal residues, for example, when compared with a full length protein. Preferably, said fragments are at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 150, 250, 300, 350, 400, 450, 500 or more amino acids in length.
  • fragments of the nucleic acid sequences and variants disclosed herein are also encompassed by the invention. Such fragments may be truncated at 3′ or 5′ end, or may lack internal bases, for example, when compared with a full length nucleic acid sequence. Preferably, said fragments are at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 150, 250, 300, 350, 400, 450, 500 or more bases in length.
  • Variant proteins may include proteins encoded by the variant nucleic acid sequences as described hereabove. Variant proteins may also include proteins that have at least about 80% amino acid sequence identity with a polypeptide sequence disclosed herein. Preferably, a variant protein will have at least about 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% amino acid sequence identity to a full-length polypeptide sequence or a fragment of a polypeptide sequence as disclosed herein.
  • Amino acid sequence identity is defined as the percentage of amino acid residues in the variant sequence that are identical with the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence identity may be determined over the full length of the variant sequence, the full length of the reference sequence, or both.
  • Variant nucleic acid sequences may include nucleic acid sequences that have at least about 80% nucleotidic sequence identity with a nucleic acid sequence disclosed herein.
  • a variant nucleic acid sequences will have at least about 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% amino acid sequence identity to a full-length nucleic acid sequence or a fragment of a nucleic acid sequence as disclosed herein.
  • Nucleic acid sequence identity is defined as the percentage of nucleic acids in the variant sequence that are identical with the nucleic acids in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence identity may be determined over the full length of the variant sequence, the full length of the reference sequence, or both.
  • a peptide “substantially homologous” to a reference peptide may derive from the reference sequence by one or more conservative substitutions. Preferably, these homologous peptides do not include two cysteine residues, so that cyclization is prevented.
  • Two amino acid sequences are “substantially homologous” or “substantially similar” when one or more amino acid residue are replaced by a biologically similar residue or when greater than 80% of the amino acids are identical, or greater than about 90%, preferably greater than about 95%, are similar (functionally identical).
  • polypeptide having an amino acid sequence at least, for example, 95% “identical” to a query amino acid sequence of the present invention it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
  • up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
  • the percentage of identity is calculated using a global alignment (i.e. the two sequences are compared over their entire length).
  • Methods for comparing the identity of two or more sequences are well known in the art.
  • the «needle» program which uses the Needleman-Wunsch global alignment algorithm (Needleman and Wunsch, 1970 J. Mol. Biol. 48:443-453) to find the optimum alignment (including gaps) of two sequences when considering their entire length, may for example be used.
  • the needle program is for example available on the ebi.ac.uk world wide web site.
  • the percentage of identity in accordance with the invention is preferably calculated using the EMBOSS:needle (global) program with a “Gap Open” parameter equal to 10.0, a “Gap Extend” parameter equal to 0.5, and a Blosum62 matrix.
  • Proteins consisting of an amino acid sequence “at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical” to a reference sequence may comprise mutations such as deletions, insertions and/or substitutions compared to the reference sequence. In case of substitutions, the protein consisting of an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference sequence may correspond to a homologous sequence derived from another species than the reference sequence.
  • Amino acid substitutions may be conservative or non-conservative.
  • substitutions are conservative substitutions, in which one amino acid is substituted for another amino acid with similar structural and/or chemical properties.
  • the substitution preferably corresponds to a conservative substitution as indicated in the table below.
  • antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which immunospecifically binds an antigen.
  • the term antibody encompasses intact monoclonal antibodies, polyclonal antibodies, chimeric, humanized or human antibodies, antibodies, diabodies, multispecific antibodies (e.g. bispecific antibodies) formed from at least two intact antibodies, nanobodies, camelids antibodies, and also antibody fragments.
  • two heavy chains are linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond. There are two types of light chain, lambda (A) and kappa ( ⁇ ).
  • the heavy chain includes two domains, a variable domain (VL) and a constant domain (CL).
  • the heavy chain includes four domains, a variable domain (VH) and three constant domains (CH1, CH2 and CH3, collectively referred to as CH).
  • VL variable domain
  • VH variable domain
  • CH constant domain
  • the constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR).
  • the Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain.
  • the specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant.
  • Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from non hypervariable or framework regions (FR) influence the overall domain structure and hence the combining site.
  • Complementarity determining regions refer to amino acid sequences which, together, define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding-site.
  • the light and heavy chains of an immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively. Therefore, an antigen-binding site includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region.
  • Framework Regions refer to amino acid sequences interposed between CDRs, i.e. to those portions of immunoglobulin light and heavy chain variable regions that are relatively conserved among different immunoglobulins in a single species, as defined by Kabat, et al (Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1991).
  • a “human framework region” is a framework region that is substantially identical (about 85%, or more, in particular 90%, 95%, or 100%) to the framework region of a naturally occurring human antibody.
  • mAb refers to an antibody molecule of a single amino acid composition, that is directed against a specific antigen and which may be produced by a single clone of B cells or hybridoma. Monoclonal antibodies may also be recombinant, i.e. produced by protein engineering.
  • chimeric antibody refers to an engineered antibody which comprises a VH domain and a VL domain of an antibody derived from a non-human animal, in association with a CH domain and a CL domain of another antibody, in particular a human antibody.
  • non-human animal any animal such as mouse, rat, hamster, rabbit or the like can be used.
  • a chimeric antibody may also denote a multispecific antibody having specificity for at least two different antigens.
  • humanized antibody refers to antibodies in which the framework or “complementarity determining regions” (CDR) have been modified to comprise the CDR from a donor immunoglobulin of different specificity as compared to that of the parent immunoglobulin.
  • CDR complementarity determining regions
  • a mouse CDR is grafted into the framework region of a human antibody to prepare the “humanized antibody”.
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fv, Fab, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, diabodies and multispecific antibodies formed from antibody fragments.
  • Fab denotes an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, in which about a half of the N-terminal side of H chain and the entire L chain, among fragments obtained by treating IgG with a protease, papaine, are bound together through a disulfide bond.
  • F(ab′) 2 refers to an antibody fragment having a molecular weight of about 100,000 and antigen binding activity, which is slightly larger than the Fab bound via a disulfide bond of the hinge region, among fragments obtained by treating IgG with a protease, pepsin.
  • Fab′ refers to an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, which is obtained by cutting a disulfide bond of the hinge region of the F(ab′) 2 .
  • a single chain Fv (“scFv”) polypeptide is a covalently linked VH:VL heterodimer which is usually expressed from a gene fusion including VH and VL encoding genes linked by a peptide-encoding linker.
  • the human scFv fragment of the invention includes CDRs that are held in appropriate conformation, preferably by using gene recombination techniques.
  • “dsFv” is a VH:VL heterodimer stabilised by a disulphide bond.
  • Divalent and multivalent antibody fragments can form either spontaneously by association of monovalent scFvs, or can be generated by coupling monovalent scFvs by a peptide linker, such as divalent sc(Fv) 2 .
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL).
  • VH heavy-chain variable domain
  • VL light-chain variable domain
  • linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • antisense nucleic acid a non-enzymatic nucleic acid molecule that binds to target RNA by means of RNA-RNA or RNA-DNA or RNA-PNA (protein nucleic acid; Egholm et al., 1993, Nature 365, 566) interactions and alters the activity of the target RNA (for a review, see Stein and Cheng, 1993, Science 261, 1004, and Woolf et al., U.S. Pat. No. 5,849,902).
  • antisense molecules are complementary to a target sequence along a single contiguous sequence of the antisense molecule.
  • an antisense molecule can bind to substrate such that the substrate molecule forms a loop or hairpin, and/or an antisense molecule can bind such that the antisense molecule forms a loop or hairpin.
  • the antisense molecule can be complementary to 2, 3, 4, 5, 6, 7, 8, 9, 10 or more non-contiguous substrate sequences or 2, 3, 4, 5, 6, 7, 8, 9, 10 or more non-contiguous sequence portions of an antisense molecule can be complementary to a target sequence or both (for example, see Crooke, 2000, Methods Enzymol., 313, 3-45).
  • antisense DNA can be used to target RNA by means of DNA-RNA interactions, thereby activating RNAse H, which digests the target RNA in the duplex.
  • the antisense oligonucleotides can comprise one or more RNAse H activating region, which is capable of activating RNAse H cleavage of a target RNA.
  • RNA interference refers to selective intracellular degradation of RNA also referred to as gene silencing.
  • RNAi also includes translational repression by small interfering RNAs (siRNAs).
  • RNAi can be initiated by introduction of Long double-stranded RNA (dsRNAs) or siRNAs or production of siRNAs intracellularly, eg from a plasmid or transgene, to silence the expression of one or more target genes.
  • dsRNAs Long double-stranded RNA
  • siRNAs small interfering RNAs
  • RNAi can be initiated by introduction of Long double-stranded RNA (dsRNAs) or siRNAs or production of siRNAs intracellularly, eg from a plasmid or transgene, to silence the expression of one or more target genes.
  • dsRNAs Long double-stranded RNA
  • siRNAs production of siRNAs intracellularly, eg from a plasmid or transgene, to silence the expression
  • the antisense nucleic acid may be Long double-stranded RNAs (dsRNAs), microRNA (miRNA) and/or small interferent RNA (siRNA).
  • dsRNAs Long double-stranded RNAs
  • miRNA microRNA
  • siRNA small interferent RNA
  • dsRNA Long double-stranded RNA
  • dsRNA refers to an oligoribonucleotide or polyribonucleotide, modified or unmodified, and fragments or portions thereof, of genomic or synthetic origin or derived from the expression of a vector, which may be partly or fully double stranded and which may be blunt ended or contain a 5′ and or 3′ overhang, and also may be of a hairpin form comprising a single oligoribonucleotide which folds back upon itself to give a double stranded region.
  • the dsRNA has a size ranging from 150 bp to 3000 bp, preferably ranging from 250 bp to 2000 bp, still more preferably ranging from 300 bp to 1000 bp. In some embodiments, said dsRNA has a size of at least 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1500 bp.
  • said dsRNA has a size of at most 3000, 2500, 2000, 1500, 1000, 950, 900, 850, 800, 750, 700, 650, 600, 550, 500, 450, 400, 350, 300 bp.
  • a “small interfering RNA” or “siRNA” is a RNA duplex of nucleotides that is targeted to a gene interest.
  • a RNA duplex refers to the structure formed by the complementary pairing between two regions of a RNA molecule.
  • siRNA is targeted to a gene in that the nucleotide sequence of the duplex portion of the siRNA is complementary to a nucleotide sequence of the targeted gene.
  • the length of the duplex of siRNAs is ranging from 15 nucleotides to 50 nucleotides, preferably ranging from 20 nucleotides to 35 nucleotides, still more preferably ranging from 21 nucleotides to 29 nucleotides.
  • the duplex can be of at least 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 nucleotides in length. In some embodiments, the duplex can be of at most 45, 40, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15 nucleotides in length.
  • the RNA duplex portion of the siRNA can be part of a hairpin structure.
  • the hairpin structure may contain a loop portion positioned between the two sequences that form the duplex. The loop can vary in length. In some embodiments the loop is 5, 6, 7, 8, 9, 10, 11, 12, or 13 nucleotides in length.
  • the hairpin structure can also contain 3 or 5 overhang portions. In some embodiments, the overhang is a 3′ or a 5′ overhang 0, 1, 2, 3, 4, or 5 nucleotides in length.
  • expression vectors may also be used to continually express antisense nucleic acid in transiently and stably transfected mammalian cells.
  • Brummelkamp et al. 2002, Science, 296:550-553; Paddison et al., 2002, Genes & Dev, 16:948-958.
  • Antisense nucleic acid may be synthesized chemically or expressed via the use of a single stranded DNA expression vector or equivalent thereof using protocols known in the art as described for example in Caruthers et al., 1992, Methods in Enzymology, 211:3-19; International PCT Publication No. WO 99/54459; Brennan et al., 1998, Biotechnol Bioeng, 61:33-45; and U.S. Pat. No. 6,001,311. In a non-limiting example, small scale syntheses are conducted on a 394 Applied Biosystems, Inc. synthesizer.
  • the antisense nucleic acid molecules of the present invention can be synthesized separately and joined together post-synthetically, for example by ligation (International PCT publication No. WO 93/23569; Belton et al., 1997, Bioconjugate Chem, 8:204).
  • the antisense nucleic acid of the invention may be able of decreasing the expression of CD147, by at least 10, 20, 30, 40%, more preferably by at least 50, 60, 70%, and most preferably by at least 75, 80, 85, 90, 95, 96, 97, 98, 99, 100%.
  • meningococcal vaccine antigen is meant a meningococcal antigen that is capable of raising an immune response against N. meningitidis , and that is suitable for use as a vaccine or as an immunogenic compound.
  • immunogenic compound is meant a compound that provokes or immunomodulates immunosuppress or immunostimulate) an immune response when administered to an individual or which induces the production of antibodies when administered to an individual.
  • vaccine refers to a compound, such as the immunogenic compound described herein which is administered to immunomodulate an immune response, that will protect or treat an individual from illness, in particular due to that agent.
  • the vaccine may be a therapeutic (treatment) vaccine, i.e. for administration to the individual after development of the disease with the intention to reduce or arrest disease progression, and/or a preventive (prophylactic) vaccine, for administration to the individual prior to the development of the disease, with the intent to prevent initial (and/or recurrent) infection.
  • subject refers to any subject or a non-human mammal.
  • subject is a man, a woman, or a child.
  • the present invention relates to an inhibitor of an interaction between type IV pilus-associated protein and CD147 receptor for use for preventing or treating a meningococcal bacteraemia and/or infection, wherein said inhibitor is:
  • the CD147 inhibitor is an anti-CD147 antibody or an antisense nucleic acid, wherein said antibody inhibits interaction between type IV pilus-associated protein and CD147 receptor, and said antisense nucleic acid silences CD147 receptor expression.
  • said antisense nucleic acid may comprise or consist of a sequence that is able to inhibit or reduce the expression of a CD147 of sequence SEQ ID NO: 7 or 8, or a CD147 of sequence encoded by the nucleic acid SEQ ID NO: 9 or 10.
  • Said antisense nucleic acid may comprise or consist of a sequence complementary to a nucleic acid encoding a CD147, for example a nucleic acid of sequence SEQ NO: 9 or 10.
  • said antisense nucleic acid comprises or consists of a siRNA, in particular at least one siRNA of sequence SEQ ID NO: 1, 2, 3, 4 or 5.
  • said siRNA comprises or consists of at least 2, 3, 4 or 5 siRNA selected from the group consisting of SEQ ID NOs: 1-5. In one embodiment, said siRNA comprises or consists of at most 5, 4, 3, or 2 siRNA selected from the group consisting of SEQ ID NOs: 1-5. In one embodiment, said siRNA comprises or consists of the four siRNA of sequence SEQ ID NO: 2, 3, 4 and 5.
  • said anti-CD147 receptor antibody is able to prevent or inhibit the interaction between type-IV associated protein and CD147 receptor, thereby preventing or inhibiting the adhesion of meningococci to endothelial cells, and consequently preventing or inhibiting meningococcal bacteraemia and/or infection.
  • said anti-CD147 antibody is an antibody directed against the binding site of CD147 to type IV pilus-associated proteins.
  • said anti-CD147 antibody is directed against C-terminal domain of CD147 or to a fragment thereof.
  • said anti-CD147 antibody is directed to the ectodomain of CD147 or to a fragment thereof.
  • said anti-CD147 is directed to the amino acids 16 to 321 of sequence SEQ ID NO: 7 or to a fragment thereof, or to the amino acids 16 to 205 of sequence SEQ ID NO: 8, or to a fragment thereof.
  • said anti-CD147 antibody is directed to a fragment of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 contiguous amino acids of said ectodomain of CD147.
  • said anti-CD147 is directed to a fragment consisting of the amino acid 221 to 315 of sequence SEQ ID NO:7 or to the amino acids 105 to 199 of sequence SEQ ID NO:8, i.e. to the membrane proximal Immunoglobulin domain of CD147 (Ig-like V type domain).
  • said anti-CD147 antibody is the anti-CD147 antibody MEM-M6/6 (Abcam®).
  • the type IV pilus-associated protein inhibitor is an anti-type IV pilus-associated protein antibody.
  • said anti-type IV pilus-associated protein antibody is an antibody directed against the binding site of type IV pilus-associated protein to CD147 receptor, or to a fragment thereof.
  • said anti-type IV pilus-associated protein antibody is an antibody directed to the binding site of PilE and/or PilV protein to CD147 receptor, or to a fragment thereof.
  • the type IV pilus-associated protein inhibitor is:
  • the type IV pilus-associated protein inhibitor is a CD147 polypeptide.
  • said CD147 polypeptide is able to prevent or inhibit the interaction between said type-IV associated protein and said CD147 receptor, thereby preventing or inhibiting the adhesion of meningococci to endothelial cells, and consequently preventing or inhibiting meningococcal bacteraemia and/or infection.
  • said CD147 polypeptide may be a CD147 amino acid sequence that (i) differs from a complete CD147 of sequence SEQ ID NO: 7 or 8, or from a complete CD147 of sequence encoded by the nucleic acid SEQ ID NO: 9 or 10, by one or several amino acid(s), and (ii) is not able to bind the endothelial cell membrane, or a fragment thereof.
  • said CD147 polypeptide may comprise or consist of the extracellular domain of CD147, or a fragment thereof.
  • said CD147 polypeptide comprises or consist of:
  • said fragment may comprise or consist of 10 to 180 contiguous amino acid of said CD147 polypeptide, preferably 50 to 150 amino acids, still preferably 80 to 120 amino acids.
  • said fragment may comprise or consist of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180 contiguous amino acids of said CD147 polypeptide and/or at most 180, 175, 170, 165, 160, 155, 150, 145, 140, 135, 130, 125, 120, 115, 110, 105, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10 contiguous amino acids of said CD147 polypeptide.
  • the inhibitor according to the invention is for administration in combination with at least one anti-bacterial compound, either sequentially or simultaneously.
  • the inhibitor according to the invention is for administration in combination with at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 anti-bacterial compounds, either sequentially or simultaneously.
  • Sequential administration indicates that the components are administered at different times or time points, which may nonetheless be overlapping. Simultaneous administration indicates that the components are administered at the same time.
  • the anti-bacterial compound may be a biological compound and/or a chemical compound that inhibits or prevents development and/or multiplication of bacteria.
  • said anti-bacterial compound is an anti-bacterial compound effective against Neisseria meningitidis (Nm), preferably a Nm of serogroup A, B, C, Y or W135.
  • Nm Neisseria meningitidis
  • the anti-bacterial compound may include, but is not limited to, antibiotics, such as the beta-lactamines antibiotics.
  • the beta-lactamines antibiotics may be for example, but without limitation, (a) penicillines, such as benzylpenicilline, phenoxyméthylpenicilline, computeticilline, dicloxacilline, flucloxacilline, amoxicilline, ampicilline, co-amoxiclav, pioutheasternracilline, ticarcilline, azlocilline, carbénicilline; (b) cephalosporin, such as cephalexin, cephalotin, cephazolin, cefaclor, cefuroxim, cefamandole, cefotetan, cefoxitin, ceftriaxone, cefixime, cefotaxime, ceftazidime, cefepime, cefpirome; (c) carbapenemes, such as imipeneme, meropeneme,
  • said at least one anti-bacterial compound is (i) a meningococcal vaccine antigen, or (ii) a fusion protein comprising at least two meningococcal vaccine antigens.
  • meningococcal vaccine antigens according to the invention are well-known to the skilled in the art. Indeed, several vaccines against meningococci are commercialized and/or under development.
  • the meningococcal vaccine antigen may comprise or consist of at least one of the polysaccharide or glycoconjugate antigens comprised within the MCV-4 (commercialized under the name of Menactra® or Menveo®), MPSV-4 (Menomune®), Mencevax® or NmVac4-A/C/Y/W-135 vaccines.
  • the meningococcal vaccine antigen may also comprise or consists of the capsule of group B (MenB), A, C, Y, and/or W135 meningococci and/or to the outer membrane vesicle (OMV).
  • group B group B
  • A group B
  • C C
  • Y and/or W135 meningococci
  • OMV outer membrane vesicle
  • the meningococcal vaccine antigen comprises or consists of a polypeptide or polypeptides.
  • the meningococcal vaccine antigen may be any of the proteins of the external surface of the meningococci.
  • the meningococcal vaccine antigen may be for example, the PilE protein (e.g. as described in PCT/EP2011/069463), the PilV protein (e.g.
  • the PilX protein the PilC protein, the ComP protein, Meningococcal Factor H binding protein (fHbp, previously referred to as GNA1870 or Lp2086), the major immunodominant surface porin (PorA), Neisserial Heparin Binding Antigen (NHBA, previously referred to as GNA2132), Neisseria adhesin A (NadA), MafA, Neisserial surface protein A (NspA), Hemoglobin Receptor (HmbR), Transferrin-binding Protein B (TbPB), Autotransporter serine Protease (AusP), or fragments thereof.
  • said fragments are immunogenic fragments.
  • the PilE protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said PilE protein may comprise or consist of the sequence of SEQ ID NO: 11 or SEQ ID NO: 12 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 11 or SEQ ID NO: 12, or an immunogenic fragment thereof.
  • the PilV protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said PilV protein may comprise or consist of the sequence of SEQ ID NO: 13 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 13, or an immunogenic fragment thereof.
  • the PilX protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said PilX protein may comprise or consist of the sequence of SEQ ID NO: 14 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 14, or an immunogenic fragment thereof.
  • the PilC protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said PilC protein may comprise or consist of the sequence of SEQ ID NO: 15 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 15, or an immunogenic fragment thereof.
  • the ComP protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said ComP protein may comprise or consist of the sequence of SEQ ID NO: 16 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 16, or an immunogenic fragment thereof.
  • the fHBP protein may be a fHBP polypeptide of subfamilyB/Variant1 or of subfamilyA/Variant 2.
  • said fHBP polypeptide may comprise or consist of the sequence SEQ ID NO: 17 or SEQ ID NO: 18 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 17 or SEQ ID NO: 18, or an immunogenic fragment thereof.
  • the PorA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said PorA protein may comprise or consist of the sequence SEQ ID NO: 19 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 19, or an immunogenic fragment thereof.
  • the NHBA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said NHBA protein may comprise or consist of the sequence SEQ ID NO: 20 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 20, or an immunogenic fragment thereof.
  • the NadA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said NadA protein may comprise or consist of the sequence SEQ ID NO: 21 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 21, or an immunogenic fragment thereof.
  • the MafA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said MafA protein may comprise or consist of the sequence of SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24, or an immunogenic fragment thereof.
  • the NspA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said NspA protein may comprise or consist of the sequence of SEQ ID NO: 25 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 25, or an immunogenic fragment thereof.
  • the HmbR protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said HmbR protein may comprise or consist of the sequence of SEQ ID NO: 26 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 26, or an immunogenic fragment thereof.
  • the TbpB protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said TbpB protein may comprise or consist of the sequence of SEQ ID NO: 27 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 27, or an immunogenic fragment thereof.
  • the AusP protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • said AusP protein may comprise or consist of the sequence of SEQ ID NO: 28 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 28, or an immunogenic fragment thereof.
  • the immunogenic fragments according to the invention may be a contiguous portion of a meningococcal vaccine antigen as described herein that has the same or substantially the same immunogenic activity as said meningococcal vaccine antigen. That is to say, the fragment is capable of raising an immune response with antibodies that recognizes PilE, PilV, PilX, PilC, ComP, fHBP, NadA, PorA, NHBA, MafA, NspA, HmbR, TbPB, or AusP. Preferably, the fragment is capable of raising an immune response with antibodies that prevent meningococcal infection.
  • said fragment is an immunogenic fragment of PilE or PilV that is capable of raising an immune response with antibodies that prevent meningococci to cross of the BBB or to spread into the meningeal space. Still more preferably, said fragment is an immunogenic fragment of PilE or PilV that is capable of raising an immune response with antibodies that inhibit the interaction between PilE and/or PilV and ⁇ 2AR.
  • said immunogenic fragment of PilE or PilV does not carry the hydrophobic domain of PilE or PilV, respectively. More particularly, said immunogenic fragment of PilE does not carry the hydrophobic domain of sequence FTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYL (SEQ ID NO: 29). More particularly, said immunogenic fragment of PilV does not carry the hydrophobic domain of sequence FTLLELMIAVAILGILTLITYPSYKTYIRRVRLSEVRTTLLHNAQTMERYYRQ (SEQ ID NO: 30).
  • said immunogenic fragment of PilE comprises or consists of:
  • said immunogenic fragment of PilV comprises or consists of:
  • said immunogenic fragment of PilE or PilV carries the recognition domain to the ⁇ 2AR responsible for meningococcal signaling.
  • said immunogenic fragment of PilE comprises or consists of:
  • said immunogenic fragment of PilV comprises or consists of:
  • said fusion protein comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10 or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 meningococcal vaccine antigens as described herein.
  • said fusion protein comprises or consists of:
  • said fusion protein comprises or consists of the immunogenic fragment of PilE of sequence SEQ ID NO: 31 fused with the fHBP polypeptide of sequence SEQ ID NO: 18, or of the immunogenic fragment of PilE of sequence SEQ ID NO: 33 fused with the fHBP polypeptide of sequence SEQ ID NO: 18. Consequently, said fusion protein comprises or consists of the sequence SEQ ID NO: 35 or SEQ ID NO: 36.
  • said fusion protein comprises or consists of the immunogenic fragment of PilV of sequence SEQ ID NO: 32 fused with the fHBP polypeptide of sequence SEQ ID NO: 18, or of the immunogenic fragment of PilV of sequence SEQ ID NO: 34 fused with the fHBP polypeptide of sequence SEQ ID NO: 18. Consequently said fusion protein comprises or consists of the sequence SEQ ID NO: 37 or SEQ ID NO: 38.
  • the fusion protein may further comprise other moieties such as e.g. peptidic linkers allowing linking the different antigens, proteins or fragments comprised within the fusion protein, a tag useful for purification, a leader sequence, a signal peptide, one or more peptidic fragments enhancing the immunogenicity, etc.
  • moieties such as e.g. peptidic linkers allowing linking the different antigens, proteins or fragments comprised within the fusion protein, a tag useful for purification, a leader sequence, a signal peptide, one or more peptidic fragments enhancing the immunogenicity, etc.
  • the invention also relates to a pharmaceutical composition
  • a pharmaceutical composition comprising an inhibitor according to the invention and a pharmaceutical acceptable vehicle, diluent, or carrier.
  • said inhibitor comprises or consists of:
  • said pharmaceutical composition further comprises at least one anti-bacterial compound.
  • the active ingredients may be mixed in the same composition comprising a pharmaceutical acceptable vehicle, diluent, or carrier. They may be conditioned separately, for simultaneous, separate or sequential administration to a mammal, including human. Said pharmaceutical composition may also comprise at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 anti-bacterial compounds.
  • Said at least one anti-bacterial compound may be a compound as defined above.
  • said at least one anti-bacterial compound comprises or consists of:
  • said pharmaceutical composition comprises:
  • compositions according to the invention may be administered orally in the form of a suitable pharmaceutical unit dosage form.
  • the pharmaceutical compositions of the invention may be prepared in many forms that include tablets, hard or soft capsules, especially hard or soft gelatin capsules, aqueous solutions, suspensions, and liposomes and other slow-release formulations, such as shaped polymeric gels.
  • Suitable dosage forms include, but are not limited to, oral, intravenous, rectal, sublingual, mucosal, nasal, ophthalmic, subcutaneous, intramuscular, transdermal, spinal, intrathecal, intra-articular, intra-arterial, sub-arachnoid, bronchial, and lymphatic administration, and other dosage forms for systemic delivery of active ingredients.
  • compositions of the invention may be administered by any method known in the art, including, without limitation, transdermal (passive via patch, gel, cream, ointment or iontophoretic); intravenous (bolus, infusion); subcutaneous (infusion, depot); transmucosal (buccal and sublingual, e.g., orodispersible tablets, wafers, film, and effervescent formulations; conjunctival (eye drops); rectal (suppository, enema)); or intradermal (bolus, infusion, depot).
  • the solid unit dosage forms can be of the conventional type.
  • the solid form can be a capsule, such as an ordinary gelatin type containing the inhibitor of the present invention, and optionnally an anti-bacterial compound of the present invention, and a carrier, for example, lubricants and inert fillers such as, lactose, sucrose, or cornstarch.
  • these compounds are tableted with conventional tablet bases such as lactose, sucrose, or corn starch in combination with binders like acacia, corn starch, or gelatin, disintegrating agents such as, corn starch, potato starch, or alginic acid, and a lubricant like stearic acid or magnesium stearate.
  • Oral liquid pharmaceutical compositions may be in the form of, for example, aqueous or oily suspensions, solutions, emulsions, syrups or elixirs, or may be presented as a dry product for constitution with water or other suitable vehicle before use.
  • Such liquid pharmaceutical compositions may contain conventional additives such as suspending agents, emulsifying agents, non-aqueous vehicles (which may include edible oils), or preservatives.
  • compositions of the invention may also be formulated for parenteral administration (e.g., by injection, for example, bolus injection or continuous infusion) and may be presented in unit dosage form in ampoules, pre-filled syringes, small volume infusion containers or multi-dose containers with an added preservative.
  • the pharmaceutical compositions may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain formulating agents such as suspending, stabilizing and/or dispersing agents.
  • the pharmaceutical compositions of the invention may be in powder form, obtained by aseptic isolation of sterile solid or by lyophilization from solution, for constitution with a suitable vehicle, e.g. sterile, pyrogen-free water, before use.
  • compositions suitable for rectal administration wherein the carrier is a solid are most preferably presented as unit dose suppositories.
  • Suitable carriers include cocoa butter and other materials commonly used in the art, and the suppositories may be conveniently formed by admixture of the pharmaceutical composition with the softened or melted carrier(s) followed by chilling and shaping in molds.
  • the pharmaceutical compositions according to the invention are conveniently delivered from an insufflator, nebulizer or a pressurized pack or other convenient means of delivering an aerosol spray.
  • Pressurized packs may comprise suitable propellant such as dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • the pharmaceutical compositions of the invention may take the form of a dry powder composition, for example, a powder mix of the pharmaceutical composition and a suitable powder base such as lactose or starch.
  • the powder composition may be presented in unit dosage form in, for example, capsules or cartridges or, e.g., gelatin or blister packs from which the powder may be administered with the aid of an inhalator or insufflator.
  • the pharmaceutical compositions of the invention may be administered via a liquid spray, such as via a plastic bottle atomizer.
  • a liquid spray such as via a plastic bottle atomizer.
  • mistometerg isoproterenol inhaler-Wintrop
  • Medihaler® isoproterenol inhaler-Riker
  • the pharmaceutical compositions of the invention may be prepared in forms that include encapsulation in liposomes, microparticles, microcapsules, lipid-based carrier systems.
  • lipid-based carrier systems suitable for use in the present invention include polycationic polymer nucleic acid complexes (see, e.g. US Patent Publication No 20050222064), cyclodextrin polymer nucleic acid complexes (see, e.g. US Patent Publication No 20040087024), biodegradable poly 3 amino ester polymer nucleic acid complexes (see, e.g. US Patent Publication No 20040071654), pH sensitive liposomes (see, e.g.
  • modified siRNA of the present invention can also be delivered as a naked siRNA molecule.
  • compositions of the invention may also contain other adjuvants such as flavorings, colorings, or preservatives.
  • the amount of the pharmaceutical compositions required for use in treatment will vary not only with the therapeutic agent selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician.
  • the inhibitor according to the invention may be used in a method of preventing or inhibiting adhesion of meningococci to an endothelial cell.
  • Said method may be an in vitro or ex vivo method.
  • the invention thus provides the use of an inhibitor as defined herein in an in vitro or in vivo method for preventing or inhibiting adhesion of meningococci to an endothelial cell.
  • said inhibitor is used in combination with at least one anti-bacterial compound as defined hereabove. In some embodiments, said inhibitor is used in combination with at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 anti-bacterial compounds as defined hereabove.
  • Said method may comprise, for example, exposing said cell and/or said meningococcus to said inhibitor.
  • the method may comprise administering said inhibitor to a subject, preferably a patient in need thereof.
  • said endothelial cells may be brain endothelial cells, capillaries endothelial cells, human dermal endothelial cells and/or umbilical vein endothelial cells.
  • the invention also relates to a method for preventing or treating meningococcal bacteraemia or infection in an individual in need thereof comprising administering a therapeutically effective amount of an inhibitor according to the invention or a pharmaceutical composition of the invention.
  • treatment is meant a therapeutic use (i.e. on a patient having a given disease) and by “preventing” is meant a prophylactic use (i.e. on an individual susceptible of developing a given disease).
  • treatment not only includes treatment leading to complete cure of the disease, but also treatments slowing down the progression of the disease and/or prolonging the survival of the patient.
  • an “effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • a therapeutically effective amount of an inhibitor of the invention may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the protein, to elicit a desired therapeutic result.
  • a therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the inhibitor are outweighed by the therapeutically beneficial effects.
  • a therapeutically effective amount also encompasses an amount sufficient to confer benefit, e.g., clinical benefit.
  • preventing a meningococcal bacteraemia or infection may mean prevention of meningococcus adhesion to the endothelial cells of the host.
  • treating a meningococcal bacteraemia or infection may mean reversing, alleviating, or inhibiting meningococcus adhesion to the endothelial cells of the host.
  • meningococcal infection may be reduced by at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100%.
  • the methods of the invention comprise the administration of an inhibitor as defined above, in combination with at least one anti-bacterial compound as defined above, either sequentially or simultaneously.
  • said at least other anti-bacterial compound is (i) a meningococcal vaccine antigen, or (ii) a fusion protein comprising at least two meningococcal vaccine antigens, as described hereabove.
  • said method comprises the administration of a pharmaceutical composition according to the invention.
  • the administration regimen may be a systemic regimen.
  • the mode of administration and dosage forms are closely related to the properties of the therapeutic agents or compositions which are desirable and efficacious for the given treatment application.
  • Suitable dosage forms and routes of administration include, but are not limited to, oral, intravenous, rectal, sublingual, mucosal, nasal, ophthalmic, subcutaneous, intramuscular, transdermal, spinal, intrathecal, intra-articular, intra-arterial, sub-arachnoid, bronchial, and lymphatic administration, and/or other dosage forms and routes of administration for systemic delivery of active ingredients.
  • the dosage forms are for parenteral administration.
  • the administration regimen may be for instance for a period of at least 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 days.
  • the dose range may be between 0.1 mg/kg/day and 100 mg/kg/day. More preferably, the dose range is between 0.5 mg/kg/day and 100 mg/kg/day. Most preferably, the dose range is between 1 mg/kg/day and 80 mg/kg/day. Most preferably, the dose range is between 5 mg/kg/day and 50 mg/kg/day, or between 10 mg/kg/day and 40 mg/kg/day.
  • the dose may be of at least 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 mg/kg/day. In some embodiments, the dose may be of at most 50, 45, 40, 35, 30, 25, 20, 25, 15, 10, 5, 1, 0.5, 0.1 mg/kg/day.
  • the dose range may also be between 10 to 10000 UI/kg/day. More preferably, the dose range is between 50 to 5000 UI/kg/day, or between 100 to 1000 UI/kg/day.
  • the dose may be of at least 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10000 UI/kg/day.
  • the dose may be of at most 10000, 9500, 9000, 8500, 8000, 7500, 7000, 6500, 6000, 5500, 5000, 4500, 4000, 3500, 3000, 2500, 2000, 1500, 1000, 900, 800, 600, 500, 450, 400, 350, 300, 250, 200, 150, 100 UI/kg/day.
  • the invention also relates to a method for screening inhibitors of the interaction between a type IV associated-pilus protein and the CD147 receptor, wherein said method comprises the step consisting of:
  • step b) is performed by adding the candidate compound to the medium of step a).
  • said type IV associated-pilus protein comprises or consists of a PilE or PilV protein or to a fragment thereof that is able to interact with CD147 receptor.
  • said fragment of CD147 receptor comprises or consists of the ectodomain of CD147 or to the membrane proximal Immunoglobulin domain of CD147, or to the extracellular domain of CD147 of sequence SEQ ID NO: 6.
  • the method according to the present invention is characterized in that at step c) the measure of the inhibition of the interaction is carried out by immunoassay (particularly by ELISA or by Immunoradiometric Assay (IRMA)), by Scintillation Proximity Assay (SPA) or by Fluorescence Resonance Energy Transfer (FRET).
  • immunoassay particularly by ELISA or by Immunoradiometric Assay (IRMA)
  • SPA Scintillation Proximity Assay
  • FRET Fluorescence Resonance Energy Transfer
  • the method according to the present invention method is based on the Alphascreen® technology.
  • Alphascreen® is based on Donor (D, photosensitizer) and Acceptor (A, chemiluminescer) microbeads, coated with two molecules of interest, susceptible of binding to each other.
  • Laser excitation of the D beads causes ambient oxygen to be converted to the singlet state by the photosensitizer.
  • Singlet oxygen species in turn activate chemiluminescent agents on the A beads.
  • the chemiluminescent agent Upon activation, the chemiluminescent agent emits light which is detected by the photo-detector in a microplate reader.
  • a signal is produced when the A and D beads are brought into proximity ( ⁇ 200 nm) thus reporting for the interaction between the partners captured on the two beads (Taouji et al., 2009, Curr Genomics, 10(2):93).
  • said type IV associated-pilus protein, or fragment thereof is bound to an acceptor bead and said CD147 receptor, or fragment thereof, is bound to a donor bead.
  • said type IV associated-pilus protein, or fragment thereof is bound to a donor bead and said CD147 receptor, or fragment thereof, is bound to an acceptor bead.
  • Said type IV associated-pilus protein, or fragment thereof, and CD147, or fragment thereof may be directly or indirectly bound to said beads.
  • Step a) is performed in conditions that allow the interaction between said type IV associated-pilus protein and said CD147 receptor. Accordingly, the binding of said type IV associated-pilus protein and said CD147 receptor will result in bringing the donor and acceptor particle at a distance less than 200 nm from each other, thereby providing an energy transfer between the donor and acceptor molecules.
  • the donor bead contains phtalocyanine and the acceptor bead contains rubren.
  • the donor bead is submitted to a laser excitation at 680 nm, inducing the conversion of ambient oxygen to a singlet state oxygen.
  • the singlet state oxygen reacts with the chemiluminescent agent, i.e. rubren, on the acceptor bead.
  • activated rubrene emits light at 520-620 which is detected by the photodetector in a microplate reader.
  • the luminescence can for example be measured with a photodetector in a microwell plate reader, such as the EnVision® multilabel plate reader from Perkin-Elmer.
  • the donor and acceptor beads are bound to fluorophores and the energy transfer amounts to fluorescence is emitted upon excitation by a first donor fluorophore, towards a second acceptor fluorophore.
  • the acceptor fluorophore is, thus, activated and emits a second fluorescence.
  • the fluorescence of the second acceptor fluorophore can be measured for example by a spectrofluorometer.
  • step a If energy transfer is detected at step a), it is considered that there is an interaction between said type IV associated-pilus protein, or fragment thereof, and said CD147 receptor, or fragment thereof.
  • the candidate compounds include but are not limited to peptides, small molecules, antibodies, aptamers and nucleic acids such as antisense nucleic acids.
  • Measuring the inhibition of interaction between said type IV pilus-associated protein, or fragment thereof, and said CD147 receptor, or fragment thereof, at step c) may be performed by measuring the luminescence or the fluorescence. If the level of luminescence or fluorescence at step c) is lower than the level of luminescence or fluorescence at step a), it indicates that the candidate compound is an inhibitor of the interaction of said type IV associated-pilus protein, or fragment thereof, and said CD147 receptor, or fragment thereof.
  • FIG. 1 Identification of CD147 as N. meningitidis receptor candidate.
  • TPA treatment induces Nm adhesion to BB19 cells: cells were untreated (white) or treated with TPA (10 ng/ml, black) in the absence (-) or in the presence of Actinomycin D (1 ⁇ g/ml). Adhesion of wild type meningococci (WT) was measured 48 h after treatment. Mean ⁇ s.e.m, n>_3;***P ⁇ 0.0001; Two-way Anova.
  • FIG. 2 Identification of CD147 as N. meningitidis receptor candidate.
  • TPA treatment induces Nm adhesion to BB19 cells: cells were untreated (white) or treated with TPA (10 ng/ml, black). Adhesion of wild type meningococci (WT) or of the bacterial mutants dpilE, dpilC1 or dpilC2 was measured 48 h after treatment. Mean ⁇ s.e.m, n>_3;***P ⁇ 0.0001; Two-way Anova.
  • FIG. 16 The pilus of Neisseria meningitidis is required for targeting human skin xenografts if SCID mice (Intraperitoneal route, 106 CFUs, 3 mice per group).
  • FIG. 17 Impact of human skin xenograft on bacteraemia in SCID mice (Intraveinous route, 10 5 CFUs, 3 mice per group).
  • FIG. 18 Survival of Neisseria meningitidis infected SCID mice (Intraveinous route, 10 5 CFUs, 3 mice per group).
  • SEQ ID Nos: 1 to 5 show the sequences of the siRNA against CD147.
  • SEQ ID NO: 6 shows the sequence of the extracellular domain of CD147.
  • SEQ ID NO: 7 shows the amino acid sequence of CD147 referenced under the NCBI Reference Sequence Number NP_001719.2.
  • SEQ ID NO: 8 shows the amino acid sequence of CD147 referenced under the NCBI Reference Sequence Number NP_940991.1.
  • SEQ ID NO: 9 shows the nucleotidic sequence of CD147 referenced under the NCBI Reference Sequence Number NM_001728.2.
  • SEQ ID NO: 10 shows the nucleotidic sequence of CD147 referenced under the NCBI Reference Sequence Number NM_198589.1.
  • SEQ ID Nos: 11 and 12 show amino acid sequences of PilE.
  • SEQ ID NO: 13 shows the amino acid sequence of PilV.
  • SEQ ID NO: 14 shows the amino acid sequence of PilX.
  • SEQ ID NO: 15 shows the amino acid sequence of PilC.
  • SEQ ID NO: 16 shows the amino acid sequence of ComP.
  • SEQ ID NOs: 17 and 18 show amino acid sequences of fHBP.
  • SEQ ID NO: 19 shows the amino acid sequence of PorA.
  • SEQ ID NO: 20 shows the amino acid sequence of NHBA.
  • SEQ ID NO: 21 shows the amino acid sequence of NadA.
  • SEQ ID Nos: 22 to 24 show amino acid sequences of MafA.
  • SEQ ID NO: 25 shows the amino acid sequence of NspA.
  • SEQ ID NO: 26 shows the amino acid sequence of HmbR.
  • SEQ ID NO: 27 shows the amino acid sequence of TbpB.
  • SEQ ID NO: 28 shows the amino acid sequence of AusP.
  • SEQ ID NO: 29 shows the sequence of the hydrophobic domain of PilE.
  • SEQ ID NO: 30 shows the sequence of the hydrophobic domain of PilV.
  • SEQ ID Nos: 31 and 33 show the sequences of immunogenic fragments of PilE.
  • SEQ ID Nos: 32 and 34 show the sequences of immunogenic fragments of PilV.
  • SEQ ID NOs: 35 and 36 show the sequences of the fusion proteins between PilE and fHBP polypeptides.
  • SEQ ID NOs: 37 and 38 show the sequences of the fusion proteins between PilV and fHBP polypeptides.
  • SEQ ID NO: 39 shows the sequence of a control siRNA.
  • RNA extracted from 2 ⁇ 107 untreated or TPA treated BB19 cells 16 hours after treatment with TPA was used as a substrate for SADE.
  • the SADE screen was carried out as described in Virlon et al., 1999, Proc Natl Acad Sci USA, 96:15286-15291. Briefly, total RNA was extracted from cells, poly-adenylated RNA was selected on oligo-dT columns and tagged cDNA was synthesized from the poly-A RNAs. Concatemers of DNA tags were sequenced and the number of sequenced tags differentially represented in the two libraries was determined and analysed using Monte Carlo statistical analysis.
  • Anti-hCD147 antibodies were purchased from AbD Serotec, anti-hCD44 mAb from Immunotech, antihlCAM-1 from R&D Systems, anti-GFAP and anti-vimentin from Sigma Aldrich. Polyclonal antiserum raised against ezrin was obtained from P. Mangeat (CNRS UMR 5539, Montpelier, France). mAb raised against PilE (20D9) and polyclonal antiserum raised against meningococcal 2C4.3 strain were described previously (Coureuil et al., 2010, Cell, 143:1149-1160). Secondary antibodies used for immunofluorescence labeling, chromogenic immunohistochemistry and immunoblotting were from Jackson ImmunoResearch Laboratories.
  • Soluble chimeric CD147-Fc and ICAM-1-Fc molecules were purchased from R&D Systems.
  • DAPI Rhoda mine-phalloidin
  • TPA Actinomycin D
  • Isoproterenol Isoproterenol
  • DAB Peroxidase Substrate NBT/BCIP phosphatase alkaline substrate
  • BB19 a human brain endothelial cell line transformed by papilloma virus was kindly provided by Dr JA. Nelson (Oregon Health and Science University, Beaverton, USA) (Prudencies et al., 1996, Int J Parasitol, 26:647-655).
  • TPA 10 ng/ml, for 10′
  • meningococcal adhesion was measured.
  • Actinomycin D was added (1 ⁇ g/ml, for 4h), cells were washed and adhesion was measured 42h later.
  • hCMEC/D3 and hBMEC cell lines were transfected and infected as previously described (Coureuil et al., 2010, Cell, 143:1149-1160; Doulet et al., 2006, J Cell Biol, 173-627-637).
  • Plasmid encoding human CD147 was kindly provided by Dr Bukrinsky and plasmid encoding ß2-Adrenergic receptor fused to YFP (p2AR-YFP) was described previously (Angers et al., 2000, Proc Natl Acad Sci USA, 97:3684-3689).
  • siRNA duplexes ON-TARGET plus SMARTpool siRNA from Dharmacon
  • the siCONTROL siRNA were used as control. Two days after transfection, efficiency of knockdown was assessed by FACS analysis and cells were infected concurrently.
  • hBMEC cells When indicated hBMEC cells were transfected with siRNA targeting the 3′ untranslated region of CD147, 3′-GCUGUCUGGUUGCGCCAUUUU-5′ (SEQ ID NO: 1) or control siRNA 3′-AUGUAUUGGCCUGUAUAG-5′ (SEQ ID NO: 39) (Eurogentech) and 40h later, cells were again either mock transfected (-) or transfected with CD147 coding region cDNA. 8 hours later, surface expression of CD147 was quantified by FACS analysis and cells were infected concurrently with Nm 8013 clone 12, capsulated, Opa-, Opc-serogroup C clinical isolate expressing a class I SB pilin.
  • Mutants of this strain Api1C1, ⁇ pilC2, ⁇ pilE, ⁇ pilV, ⁇ pilX, AcomP and wild type Nm expressing GFP were derived and cultured as described previously (Nassif et al., 1994, Proc Natl Acad Sci USA, 91:3769-3773; Mikaty et al., 2009, PloS Pathog, 5:e1000314; Helaine et al., 2005, Mol Microbiol, 55:65-77; Mairey et al., 2006, J Exp Med, 203:1939-1950).
  • meningococci When indicated meningococci were pre-incubated with 5 ⁇ g/ml soluble recombinant recombinant human CD147-Fc and ICAM-1-Fc chimera (comprising the Ig domains of CD147 or of ICAM-1 fused to the Fc domain of human IgG1 and produced as disulfide-linked homodimers) before interaction with hBMECs with additional 2 ⁇ g/ml soluble proteins. Meningococcal adhesion was quantified following a 30 min infection in static conditions.
  • hBMECs were grown on IBIDI chambers, pretreated for 1h with 10 ⁇ g/ml antibodies targeting ICAM-1 (11C81) or CD147 (MEM-M6/1 and MEM-M6/6) and submitted to laminar flow (0.04 dynes/cm 2 ) under an inverted microscope. GFP-expressing bacteria were introduced in the chamber under flow. After 20 min, the number of adherent bacteria was determined.
  • recombinant human CD147-Fc and ICAM1-Fc chimera were immobilised on glass slides using a modification of the technique described in Steffen et al., 2008, Curr Biol, 18:926-931.
  • slides were coated with 0.1% Poly-L Lysine, washed with PBS, crosslinked with glutaraldehyde (0.5%), washed, incubated with anti-Fc in assay buffer (PBS with 3% BSA) for 2h, washed in assay buffer, and incubated overnight at 4° C. with 2 ⁇ g/ml chimeric protein.
  • Slides were washed before infection with meningococcal suspension of OD 600 0.05. After incubation with bacteria, slides were washed three times and fixed. Bacteria were labelled and visualized with a Leica DM16000 microscope using a 63 ⁇ oil-immersion objective. The number of adherent bacteria per field was quantified for 30 fields using ImageJ software.
  • hCMEC/D3, BB19 or hBMEC were grown to confluence on permanox coverslips or on transwell filters. After the indicated treatments and/or infection, cells were fixed and labelled as previously described (Lambotin et al., 2005, J Cell Sci, 118:3805-3816; Hoffmann et al., 2001, J Cell Biol, 155:133-143). Image acquisition and analysis were performed with a DM16000 microscope (Leica, 63 ⁇ ). Series of optical sections were obtained with a confocal spinning disk microscope (Leica, 63 ⁇ ). 3D reconstructions were obtained using Imaris software and quantification histograms with ImageJ software (NIH). Quantitative analysis of protein recruitment under bacterial colonies was determined as the proportion of colonies positive for the protein of interest indicated. At least 50 colonies were observed per coverslip. Each experiment was repeated at least 3 times in duplicate or triplicate.
  • Fresh human brain sections were obtained from frontal lobe specimens of macroscopically and histologically normal brain (confirmed by a neuropathologist) of individuals referred to the Department of Forensic Medicine for unexplained out-of-hospital sudden death (consent forms ML1094, PFS 10-008, ClinicalTrials.gov NCT00320099 from The Institutional Review Boards of the Poincaré Hospital, Paris-Saint Quentin University and the French “ influence de la Biomédecine”).
  • the sections, 7 ⁇ m thick, containing leptomeninges, cortical ribbon and the underlying white matter were immobilised on SuperfrostTM plus microscope slides and store at ⁇ 80° C.
  • Defrosted sections were rehydrated in PBS for 5 minutes and incubated for 1h with medium containing 0.1% BSA prior to infection with suspensions of bacteria (2.10 7 bacteria in 150 ⁇ l of medium containing 0.1% BSA) for 1 h at 37° C. Sections were then gently washed horizontally 5 times and fixed in PAF 4% for 10 min at RT.
  • sections were treated for 1h with 10 ⁇ g/ml of antibodies targeting CD147 or ICAM-1 and then washed 3 times prior to infection by bacteria.
  • Adherent meningococci were detected by chromogenic immunohistochemistry and immunofluorescence analysis.
  • To perform chromogenic immunohistochemistry after tissue rehydratation, sections were incubated overnight with the indicated primary antibodies and revealed using horseradish peroxidase coupled secondary donkey anti-mouse antibody and an alkaline phosphatase donkey anti-rabbit. DAB (brown color) and NBT/BCIP (blue color) were used as chromogens.
  • brain sections were incubated with the primary antibodies indicated for 2h in PBS/BSA 0.1%.
  • Alexa-conjugated phalloidin and DAPI were added to Alexa-conjugated secondary antibodies for 1 h. After additional washing, coverslips were mounted in glycergel (Dako). Entire samples were scanned using Nanozoomer 2.0 (Hamamatsu) and were further analysed using optical microscopy, epifluorescence (Zeiss Axiovert, 40 ⁇ ) and confocal (spinning disk Leica, 63 ⁇ ) microscopy. The marker specificities were systematically confirmed by examining sections in which primary antibody was replaced with isotype control Ig at the same concentration, and by immunostaining of non infected tissues from the same donor.
  • the AlphaScreen® technology was used to assess the interaction between MBP-Pilin recombinant fusion proteins and CD147-Fc-His or ALCAM-1-Fc-His as a control.
  • the binding reaction was performed using white 384-well Optiplates (PerkinElmer, Whalham, Mass., USA) in 20 ⁇ l (total reaction volume).
  • the AlphaScreen® reagents anti-MBP-coated Acceptor beads and Nickel chelate-coated Donor beads
  • CD147-Fc-His (or ALCAM-1-Fc-His) and Pilin-MBP were prepared in 20 mM Tris, pH 7.4, 20 mM NaCl.
  • Donor beads (20 ⁇ g/ml) were incubated with CD147-His (0, 100 or 500 nM) for 45 min at room temperature.
  • Acceptor beads (20 ⁇ g/ml) were incubated with Pilin-MBP (0, 50 or 500 nM) for 1h at room temperature in the Alphascreen® reaction buffer (25 mM Tris, pH 7.4 at 20° C., 20 mM NaCl, 0.1% BSA and 0.05% Tween 20). Then, 10 ⁇ l of each of the interacting partners were added to the plate, allowed for incubation for either 2 h or overnight in the dark and at room temperature.
  • CD147 a well known marker of the blood brain barrier (BBB), highly enriched on brain endothelial cells to which Nm preferentially adhere.
  • CD147 is a member of the immunoglobulin (Ig) superfamily, containing two glycosylated Ig-like domains, involved in various physiological and pathological processes. It has been confirmed that TPA treatment of BB19 cells up-regulated the expression of CD147. Furthermore adhesion of Nm to TPA-treated cells induced a massive recruitment of CD147 to sites of bacterial adhesion. CD147 thus appeared to be an attractive receptor candidate for type IV pilus-mediated Nm adhesion.
  • Ig immunoglobulin
  • hCMEC/D3 is a fully differentiated human brain endothelial cell line derived from brain capillaries, which recapitulates the major phenotypic features of the BBB, and hBMEC, a human endothelial cell line isolated from bone marrow capillaries.
  • CD147 was predominantly enriched at cell-cell junctions of a polarized monolayer of hCMEC/D3 cells and a significant fraction of CD147 was present at the luminal surface.
  • CD147 In cells infected by Nm, CD147 accumulated at sites of meningococcal adhesion and co-localised with the ⁇ 2-adrenergic receptor. Importantly, CD147 was recruited independently of the ⁇ 2-adrenergic receptor expression and associated-coupled signalling events, as expected of a putative receptor mediating the initial bacterial adhesion ( FIG. 3 ).
  • hCMEC/D3 and hBMEC cells were transfected with CD147-specific small interfering RNAs (siRNA) that knocked down 60 to 70% of the surface expression of CD147 relative to control siRNA.
  • siRNA small interfering RNAs
  • FIGS. 4 and 5 Bacterial adhesion to cells in which CD147 was knocked down was drastically reduced. This effect was restored by the re-expression of exogenous CD147 ( FIG. 5 ).
  • CD147 depletion also affected bacterial adhesion under flow conditions, in a quantitative assay of the initial adhesion events ( FIG. 6 ), indicating that CD147 is essential to promote the initial attachment of meningococci to human endothelial cells.
  • CD147-Fc a recombinant soluble form of the extracellular domain of CD147
  • FIG. 7 An independent approach relied on the use of two CD147-specific antibodies, MEM-M6/1 and MEMM6/6, binding to the N-terminal and the C-terminal Ig domain of CD147, respectively.
  • MEM-M6/6 inhibited by 75% the initial attachment of Nm under flow conditions compared to cells pre-treated with anti-ICAM-1 control antibody (11C81), whereas MEM-M6/1 only reduced initial attachment by 20% ( FIG. 8 ).
  • MEM-M6/1 and MEM-M6/6 both labelled CD147 expressed on hCMEC/D3 cells similarly.
  • MEM-M6/1 efficiently labelled CD147 molecules accumulated at sites of bacterial adhesion, indicating that MEM-M6/6 and meningococci compete for the same binding motif on CD147.
  • CD147 is a critical endothelial receptor for the primary attachment of Nm to human endothelial cells.
  • Wild type bacteria formed colonies on the luminal side of meningeal and cortical brain vessels which are lined with endothelial cells expressing CD147.
  • bacterial colonies were found in association with CD147+ leptomeningeal cells, but not with glial nor neuronal cells that do not express CD147, demonstrating that bacterial adhesion to fresh human brain tissues closely correlated with CD147 expression.
  • pre-treatment of brain sections with MEM-M6/6 prior to infection by Nm drastically reduced brain colonisation, whereas MEM-M6/1 and 11C81 antibodies were ineffective ( FIG. 15 ).
  • CD147 is an essential receptor for the initial adhesion of Nm to brain and peripheral human endothelial cells by interacting directly with the pilus components PilE and PilV. Importantly, it provides the first demonstration in situ of an elective targeting of cerebral blood vessels by pathogenic meningococci, relying on specific interactions between microbial ligands and a brain receptor. Because of its key position in the pathophysiological cascade of tissue colonization by Nm, CD147 becomes a major pharmacological target to inhibit meningococcal blood-borne infection of the brain and of peripheral capillaries. The lack of animal model of meningococcal infection has hampered the understanding of meningococcal pathogenesis. N. meningitidis interacts only with cells of human origin and only adheres to human cells, thus preventing the study of the role of meningococcal cell interaction in meningococcal pathogenesis using animal models.
  • FIG. 16 clearly shows that in SCID mice grafted with human skin, piliated capsulated bacteria which are able to interact with cells are in much higher number in the human skin than non piliated capsulated bacteria unable to interact with human skin. This was confirmed by histological examination. Indeed non piliated bacteria were unable to adhere in vivo to the human endothelial cells of the graft. These data demonstrate that piliation is required for bacterial interaction in vivo with human cells.
  • the high level of the bacteraemia is believed to be of the utmost importance for meningococcal pathogenesis.
  • the virulence factors known to allow the establishment of this bacteraemia are the capsule, the lipooligosaccharide, the factor H binding proteins and the iron chelation systems. These virulence factors allow the bacteria to survive in the extracellular fluids.
  • SCID mice model we tested the hypothesis that the ability of the bacteria to interact and to multiply within the blood vessels was also participating in the establishment of the bacteraemia. As shown FIG.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Endocrinology (AREA)
  • Plant Pathology (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Oncology (AREA)

Abstract

The present invention concerns the use of an inhibitor of an interaction between type IV pilus-associated protein and CD147 for preventing or treating meningoccal bacteraemia and/or infection. The present invention also relates to the combined use of such inhibitor and of an anti-bacterial compound, such as one used to prevent or treat a meningococcal infection. The invention also relates to a method for the prevention and/or treatment of meningococcal bacteraemia and/or infection, and to a method for screening inhibitors of the interaction between type IV pilus-associated protein and CD147.

Description

    CROSS-REFERENCE TO RELATED APPLICATIONS
  • This application is a divisional application of U.S. Ser. No. 14/405,444, having a filing date of Dec. 4, 2014, which was a 371 application of International application PCT/EP2013/064900 filed on Jul. 15, 2013, which claimed the benefit of European patent application 12305920.6, filed Jul. 27, 2012, all of said applications incorporated herein by reference.
    • FIELD OF THE INVENTION
  • The present invention concerns the use of an inhibitor of an interaction between type IV pilus-associated protein and CD147 for preventing or treating meningococcal bacteraemia and/or infection. The present invention also relates to the combined use of such inhibitor and of an anti-bacterial compound, such as one used to prevent or treat a meningococcal infection. The invention also relates to a method for the prevention and/or treatment of meningococcal bacteraemia and/or infection, and to a method for screening inhibitors of the interaction between type IV pilus-associated protein and CD147.
    • BACKGROUND TO THE INVENTION
  • Meningococcus (N. meningitidis, Nm), a cause of epidemic meningitis and sepsis, is a commensal Gram-negative bacterium of the human nasopharynx. After bloodstream invasion, virulent encapsulated bacteria adhere to brain endothelial cells and proliferate onto the apical surface of host cells to form microcolonies at the site of initial bacterial attachment, then cross the Blood Brain Barrier (BBB) to colonize meninges (Nassif et al., 2002, Trends Microbiol, 10:227-232).
  • The main clinical feature of meningococcal infection is meningitis. Paradoxically, Neisseria meningitidis is a frequent asymptomatic colonizer of the human nasopharynx, and only a very small proportion of infections proceed to a sustained bacteraemia. In the majority of bacteremic patients the presence of N. meningitidis in the bloodstream will remain asymptomatic. However during the blood phase, the bacteria will interact with the brain endothelial cells and invade the meninges to be responsible for meningitis, which is the first clinical complication of meningococcal dissemination in 70% of patients. In 30% of bacteremic patients the presence of meningococci in the bloodstream will lead to clinical symptoms of septicemia with in some cases a purpura fulminans. In the latter case the bacteria cross the blood brain barrier; however, the meningitis symptoms are not at the forefront of the clinical presentation.
  • The emergence and epidemic potential of Nm are related to the expression of outer membrane components (capsular polysaccharide and lipooligosaccharide [endotoxin]), while the propensity of Nm to interact tightly with peripheral and brain vascular cells relies on the expression of type IV pili. These long filamentous structures, which extend from the bacterial cell surface, exhibit astonishing multifunctionality, including the attachment of virulent capsulated meningococci to cells and the triggering of host signalling events that contribute to the stabilization of bacterial colonies at the endothelial cell surface and promote subsequent translocation through endothelial barriers. Type IV pili are composed of hetero-multimeric pilin subunits, which are assembled into helical fibers by a complex machinery. They are comprised of the major pilin PilE required for piliation, and other low-abundance pilins (such as PilV, PilX or Comp) that structurally resemble PilE and modulate the pilus adhesive and signalling functions. The adhesive properties of type IV pili are also modulated by components of the pilus machinery such as the PilC1 allele, making it difficult to identify the molecular determinants involved in direct interaction with host cell receptors using a genetic approach. As a consequence, the precise adhesive components of the complex pilus structure remain undefined. However, it has been recently identified that the host G-protein-coupled β2-adrenergic receptor is an essential endothelial receptor for meningococcal type IV pili to trigger signalling events (Coureuil et al., 2010, Cell, 143:1149-1160; Lecuyer et al., 2011, Infect Immun, 80:175-186). Moreover, it has been identified that Nm colonies at the cell surface of a human brain endothelial cell line promote the translocation of Barrs to the inner surface of plasma membrane, facing bacteria. Barrs translocated under the colonies serve as a scaffolding platform for signaling events elicited by Nm. Among the GPCRs expressed in the cell line, only the β2-adrenoceptor (β2AR) plays a permissive role in the formation of cortical plaques under colonies and in bacterial crossing of cell monolayers. These observations reveal the requisition of a β2-adrenergic/β-arrestin signaling pathway by Nm to promote stable adhesion onto human brain endothelial cells and subsequent crossing of the BBB. More specifically, it has been shown that interaction of β2AR, in particular of the N-terminus of β2AR, with type IV pilus-associated proteins such as PilE or PilV, initiates the process allowing N. meningitidis to open and to traverse the BBB.
  • However, endothelial cells depleted of β2-adrenergic receptors still support bacterial adhesion, indicating that type IV pili promote the primary attachment of meningococci by interaction with another as yet unknown receptor.
  • Thus, preventing the primary attachment of meningococci to endothelial cells will prevent meningeal dissemination in the bloodstream, i.e. meningococcal bacteraemia, and/or meningococcal infection and, thereby will prevent bacterial meningitis and/or purpura fulminans.
    • SUMMARY OF THE INVENTION
  • The inventors have found that primary meningococcal adhesion to endothelial cells is mediated by the interaction between type IV pilus-associated proteins present at the surface of the meningococci and CD147 present at the surface of the host endothelial cells, and that such interaction can be blocked, thereby inhibiting meningococcal bacteraemia, and consequently meningococcal infection.
  • Thus, the invention relates to an inhibitor of an interaction between type IV pilus-associated proteins and CD147 for use for preventing or treating meningococcal bacteraemia and/or infection. Said inhibitor is preferably (i) a CD147 inhibitor and/or (ii) a type IV pilus-associated protein inhibitor. Preferably, said interaction is a direct interaction.
  • In an embodiment, said inhibitor comprises a CD147 inhibitor which is a polypeptide able to interact with the CD147 receptor and thereby inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • In an embodiment, this polypeptide is an anti-CD147 antibody or antibody fragment, preferably directed against an extracellular portion of CD147, and by this interaction, in particular binding, said antibody inhibits interaction between type IV pilus-associated protein and CD147 receptor or prevent or abolish attachment of the type IV pilus-associated protein to the CD147. In an embodiment, said anti-CD147 antibody is the MEM-M6/6 antibody.
  • In another embodiment, the polypeptide may be a type IV pilus-associated protein fragment which is able to bind to the CD147 receptor and compete with the bacteria, thereby inhibiting interaction between type IV pilus-associated protein and CD147 receptor or prevent or abolish attachment of the type IV pilus-associated protein to the CD147.
  • In another embodiment, said inhibitor comprises a CD147 inhibitor which is a nucleic acid, preferably a dsRNA which silences CD147 expression. Said CD147 inhibitor may comprise a siRNA or several siRNA silencing CD47 expression, preferably at least one siRNA of sequence SEQ ID NO: 1, 2, 3, 4 or 5.
  • In another embodiment, said inhibitor comprises a type IV pilus-associated protein inhibitor which is a polypeptide able to interact with the type IV pilus-associated protein and thereby inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • In an embodiment, this polypeptide is an anti-type IV pilus-associated protein antibody or antibody fragment, preferably directed against the binding site to the CD147 receptor, and by this interaction, in particular binding, said antibody inhibits interaction between type IV pilus-associated protein and CD147 receptor or prevents or abolishes attachment of the type IV pilus-associated protein to the CD147.
  • In another embodiment, this polypeptide is a CD147 polypeptide, preferably a polypeptide comprising CD147 amino acid sequence or a fragment thereof able to bind to a type IV pilus-associated protein, wherein said antibody or polypeptide inhibits interaction between type IV pilus-associated protein and CD147 receptor.
  • In an embodiment, said CD147 polypeptide comprises or consists of the soluble form of the extracellular domain of CD147, or a fragment thereof wherein said soluble form or fragment inhibits interaction between type IV pilus-associated protein and CD147 receptor. Said soluble form of the extracellular domain of CD147 may comprise or consist of the sequence SEQ ID NO: 6, or a fragment thereof.
  • Also provided is a pharmaceutical composition comprising an inhibitor of an interaction between type IV pilus-associated proteins and CD147 and a pharmaceutically acceptable vehicle, diluent or carrier.
  • Also provided is a pharmaceutical composition comprising an inhibitor of an interaction between type IV pilus-associated proteins and CD147 and additionally at least one anti-bacterial compound. Said composition comprises a pharmaceutically acceptable vehicle, diluent or carrier. According to a feature, the composition is for a simultaneous, separate or sequential administration to a mammal, including human. Preferably, said at least one anti-bacterial compound is (i) a meningococcal vaccine antigen, or (ii) a fusion protein comprising at least two meningococcal vaccine antigens. Said meningococcal vaccine antigen may comprise or consist of a meningococcal PilE, PilV, PilX, PilC, ComP, fHbp, PorA, NHBA, NadA, MafA, NspA, HmbR, TbpB, AusP, or a fragment thereof.
  • Further provided is the use of an inhibitor of an interaction between type IV pilus-associated proteins and CD147 in a method of preventing the adhesion of a meningococcus to endothelial cells. This method may be used in vivo or in vitro.
  • Also provided is a method for preventing or treating meningococcal bacteraemia and/or meningococcal infection comprising administering to an individual in need thereof (mammal, preferably human) a therapeutically effective amount of an inhibitor of an interaction between type IV pilus-associated proteins and CD147, or a composition as disclosed and provided herein.
  • Also provided is the use of an inhibitor of an interaction between type IV pilus-associated proteins and CD147 for the manufacture of a medicament for preventing or treating meningococcal bacteraemia and/or meningococcal infection.
  • Also provided is a method for screening inhibitors of the interaction between a type IV associated-pilus protein and the CD147 receptor, wherein said method comprises the step consisting of:
      • a) having a medium containing a type IV associated-pilus protein, or a fragment thereof, and CD147 receptor, or a fragment thereof, wherein said type IV associated-pilus protein, or a fragment thereof, and said CD147 receptor, or a fragment thereof, are able to specifically interact together to form a binding pair,
      • b) contacting said medium with a candidate compound,
      • c) measuring the inhibition of the interaction between said type IV associated-pilus protein, or a fragment thereof, and said CD147 receptor, or a fragment thereof.
    Definitions
  • By “meningococcal bacteraemia” is meant the transient passage of a viable meningococcus in the blood of the host without any clinical symptoms.
  • By “meningococcal infection” it is meant the sustained presence of viable meningococcus in a host with clinical symptoms.
  • By “a meningococcus” is meant the Neisseria meningitidis (Nm) bacteria, preferably a Nm of serogroup A, B, C, Y or W135.
  • By “type IV pilus-associated protein”, is meant a protein that is present at the surface of the pilus of a bacterium. For example, said type IV pilus-associated protein may be the PilE, the PilV, the PilX, the PilC, or the ComP protein. Preferably, said type IV pilus-associated protein is a PilE or PilV protein, and more preferably a PilE or PilV protein derived from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135.
  • By “CD147”, also called Basigin (BSG) or extracellular matrix metalloproteinase inducer (EMMPRIN), is a member of the immunoglobulin superfamily that contains two heavily glycosylated C2 type immunoglobulin-like domains at the N-terminal extracellular portion. In some embodiments, the CD147 comprises or consists of:
      • a) the sequence SEQ ID NO: 7 (NCBI Reference Sequence NP_001719.2, update Feb. 26, 2012),
      • b) the sequence SEQ ID NO: 8 (NCBI Reference Sequence NP_940991.1, update Feb. 26, 2012),
      • c) the sequence encoded by the nucleic acid SEQ ID NO: 9 (NCBI Reference Sequence NM_001728.2, update Feb. 26, 2012),
      • d) the sequence encoded by the nucleic acid SEQ ID NO: 10 (NCBI Reference Sequence NM_198589.1, update Feb. 26, 2012),
      • e) a sequence at least 80, 85, 90, 95, 96, 97, 98, 99% identical to the sequence of a) to d).
  • By “interaction between type IV pilus-associated protein and CD147” is meant the direct interaction between type IV pilus-associated protein present at the surface of the meningococcus and CD147 present at the surface of the endothelial cells, such as peripheral or brain endothelial cells, of the host. In fact, the inventors have found that the direct interaction between type IV pilus-associated protein and CD147 allows the adhesion of meningococcus to the endothelial cells, thereby allowing the meningococcus to infect blood vessels, such as brain blood vessels and peripheral vessels.
  • By “inhibitor” is meant an agent that is able to reduce or to abolish the interaction between type IV pilus-associated protein and CD147. Said inhibitor may also be able to reduce or abolish the expression of CD147. According to the invention, said inhibitor is (i) a CD147 inhibitor and/or (ii) a type IV pilus-associated protein inhibitor.
  • Preferably, said inhibitor is able to reduce or to abolish the interaction between type IV pilus-associated protein and CD147, by at least 10, 20, 30, 40%, more preferably by at least 50, 60, 70%, and most preferably by at least 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100%.
  • Reference herein to polypeptides and nucleic acid includes both the amino acid sequences and nucleic acid sequences disclosed herein and variants of said sequences.
  • Variant proteins may be naturally occurring variants, such as splice variants, alleles and isoforms, or they may be produced by recombinant means. Variations in amino acid sequence may be introduced by substitution, deletion or insertion of one or more codons into the nucleic acid sequence encoding the protein that results in a change in the amino acid sequence of the protein. Optionally the variation is by substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids with any other amino acid in the protein. Additionally or alternatively, the variation may be by addition or deletion of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acids within the protein.
  • Variant nucleic acid sequences include sequences capable of specifically hybridizing to the sequence of SEQ ID Nos: 1-5, 9, 10 under moderate or high stringency conditions. Stringent conditions or high stringency conditions may be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5×SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5×Denhardt's solution, sonicated salmon sperm DNA (50 μg/ml), 0.1% SDS, and 10% dextran sulfate at 42° C., with washes at 42° C. in 0.2×SSC (sodium chloride/sodium citrate) and 50% formamide at 55° C., followed by a high-stringency wash consisting of 0.1×SSC containing EDTA at 55° C. Moderately stringent conditions may be identified as described by Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and % SDS) less stringent that those described above. An example of moderately stringent conditions is overnight incubation at 37° C. in a solution comprising: 20% formamide, 5×SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5×Denhardt's solution, 10% dextran sulfate, and 20 mg/ml denatured sheared salmon sperm DNA, followed by washing the filters in 1×SSC at about 37-50° C.
  • Fragments of the proteins and variant proteins disclosed herein are also encompassed by the invention. Such fragments may be truncated at the N-terminus or C-terminus, or may lack internal residues, for example, when compared with a full length protein. Preferably, said fragments are at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 150, 250, 300, 350, 400, 450, 500 or more amino acids in length.
  • Fragments of the nucleic acid sequences and variants disclosed herein are also encompassed by the invention. Such fragments may be truncated at 3′ or 5′ end, or may lack internal bases, for example, when compared with a full length nucleic acid sequence. Preferably, said fragments are at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 150, 250, 300, 350, 400, 450, 500 or more bases in length.
  • Variant proteins may include proteins encoded by the variant nucleic acid sequences as described hereabove. Variant proteins may also include proteins that have at least about 80% amino acid sequence identity with a polypeptide sequence disclosed herein. Preferably, a variant protein will have at least about 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% amino acid sequence identity to a full-length polypeptide sequence or a fragment of a polypeptide sequence as disclosed herein. Amino acid sequence identity is defined as the percentage of amino acid residues in the variant sequence that are identical with the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence identity may be determined over the full length of the variant sequence, the full length of the reference sequence, or both.
  • Variant nucleic acid sequences may include nucleic acid sequences that have at least about 80% nucleotidic sequence identity with a nucleic acid sequence disclosed herein. Preferably, a variant nucleic acid sequences will have at least about 50%, 55%, 60%, 65%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% amino acid sequence identity to a full-length nucleic acid sequence or a fragment of a nucleic acid sequence as disclosed herein. Nucleic acid sequence identity is defined as the percentage of nucleic acids in the variant sequence that are identical with the nucleic acids in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Sequence identity may be determined over the full length of the variant sequence, the full length of the reference sequence, or both.
  • A peptide “substantially homologous” to a reference peptide may derive from the reference sequence by one or more conservative substitutions. Preferably, these homologous peptides do not include two cysteine residues, so that cyclization is prevented. Two amino acid sequences are “substantially homologous” or “substantially similar” when one or more amino acid residue are replaced by a biologically similar residue or when greater than 80% of the amino acids are identical, or greater than about 90%, preferably greater than about 95%, are similar (functionally identical).
  • By a polypeptide having an amino acid sequence at least, for example, 95% “identical” to a query amino acid sequence of the present invention, it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a query amino acid sequence, up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
  • In the context of the present application, the percentage of identity is calculated using a global alignment (i.e. the two sequences are compared over their entire length). Methods for comparing the identity of two or more sequences are well known in the art. The «needle» program, which uses the Needleman-Wunsch global alignment algorithm (Needleman and Wunsch, 1970 J. Mol. Biol. 48:443-453) to find the optimum alignment (including gaps) of two sequences when considering their entire length, may for example be used. The needle program is for example available on the ebi.ac.uk world wide web site. The percentage of identity in accordance with the invention is preferably calculated using the EMBOSS:needle (global) program with a “Gap Open” parameter equal to 10.0, a “Gap Extend” parameter equal to 0.5, and a Blosum62 matrix.
  • Proteins consisting of an amino acid sequence “at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical” to a reference sequence may comprise mutations such as deletions, insertions and/or substitutions compared to the reference sequence. In case of substitutions, the protein consisting of an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference sequence may correspond to a homologous sequence derived from another species than the reference sequence.
  • Amino acid substitutions may be conservative or non-conservative. Preferably, substitutions are conservative substitutions, in which one amino acid is substituted for another amino acid with similar structural and/or chemical properties. The substitution preferably corresponds to a conservative substitution as indicated in the table below.
  • Conservative substitutions Type of Amino Acid
    Ala, Val, Leu, Ile, Met, Amino acids with aliphatic hydrophobic
    Pro, Phe, Trp side chains
    Ser, Tyr, Asn, Gln, Cys Amino acids with uncharged but polar
    side chains
    Asp, Glu Amino acids with acidic side chains
    Lys, Arg, His Amino acids with basic side chains
    Gly Neutral side chain
  • The term “antibody” refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site which immunospecifically binds an antigen. As such, the term antibody encompasses intact monoclonal antibodies, polyclonal antibodies, chimeric, humanized or human antibodies, antibodies, diabodies, multispecific antibodies (e.g. bispecific antibodies) formed from at least two intact antibodies, nanobodies, camelids antibodies, and also antibody fragments. In natural antibodies, two heavy chains are linked to each other by disulfide bonds and each heavy chain is linked to a light chain by a disulfide bond. There are two types of light chain, lambda (A) and kappa (κ). There are five main heavy chain classes (or isotypes) which determine the functional activity of an antibody molecule: IgM, IgD, IgG, IgA and IgE. Each chain contains distinct sequence domains. The light chain includes two domains, a variable domain (VL) and a constant domain (CL). The heavy chain includes four domains, a variable domain (VH) and three constant domains (CH1, CH2 and CH3, collectively referred to as CH). The variable regions of both light (VL) and heavy (VH) chains determine binding recognition and specificity to the antigen. The constant region domains of the light (CL) and heavy (CH) chains confer important biological properties such as antibody chain association, secretion, trans-placental mobility, complement binding, and binding to Fc receptors (FcR). The Fv fragment is the N-terminal part of the Fab fragment of an immunoglobulin and consists of the variable portions of one light chain and one heavy chain. The specificity of the antibody resides in the structural complementarity between the antibody combining site and the antigenic determinant. Antibody combining sites are made up of residues that are primarily from the hypervariable or complementarity determining regions (CDRs). Occasionally, residues from non hypervariable or framework regions (FR) influence the overall domain structure and hence the combining site. Complementarity determining regions (CDRs) refer to amino acid sequences which, together, define the binding affinity and specificity of the natural Fv region of a native immunoglobulin binding-site. The light and heavy chains of an immunoglobulin each have three CDRs, designated L-CDR1, L-CDR2, L-CDR3 and H-CDR1, H-CDR2, H-CDR3, respectively. Therefore, an antigen-binding site includes six CDRs, comprising the CDR set from each of a heavy and a light chain V region.
  • Framework Regions (FRs) refer to amino acid sequences interposed between CDRs, i.e. to those portions of immunoglobulin light and heavy chain variable regions that are relatively conserved among different immunoglobulins in a single species, as defined by Kabat, et al (Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md., 1991). As used herein, a “human framework region” is a framework region that is substantially identical (about 85%, or more, in particular 90%, 95%, or 100%) to the framework region of a naturally occurring human antibody.
  • The term “monoclonal antibody” or “mAb” as used herein refers to an antibody molecule of a single amino acid composition, that is directed against a specific antigen and which may be produced by a single clone of B cells or hybridoma. Monoclonal antibodies may also be recombinant, i.e. produced by protein engineering.
  • The term “chimeric antibody” refers to an engineered antibody which comprises a VH domain and a VL domain of an antibody derived from a non-human animal, in association with a CH domain and a CL domain of another antibody, in particular a human antibody. As the non-human animal, any animal such as mouse, rat, hamster, rabbit or the like can be used. A chimeric antibody may also denote a multispecific antibody having specificity for at least two different antigens.
  • The term “humanized antibody” refers to antibodies in which the framework or “complementarity determining regions” (CDR) have been modified to comprise the CDR from a donor immunoglobulin of different specificity as compared to that of the parent immunoglobulin. In a preferred embodiment, a mouse CDR is grafted into the framework region of a human antibody to prepare the “humanized antibody”.
  • “Antibody fragments” comprise a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody. Examples of antibody fragments include Fv, Fab, F(ab′)2, Fab′, dsFv, scFv, sc(Fv)2, diabodies and multispecific antibodies formed from antibody fragments.
  • The term “Fab” denotes an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, in which about a half of the N-terminal side of H chain and the entire L chain, among fragments obtained by treating IgG with a protease, papaine, are bound together through a disulfide bond.
  • The term “F(ab′)2” refers to an antibody fragment having a molecular weight of about 100,000 and antigen binding activity, which is slightly larger than the Fab bound via a disulfide bond of the hinge region, among fragments obtained by treating IgG with a protease, pepsin.
  • The term “Fab′” refers to an antibody fragment having a molecular weight of about 50,000 and antigen binding activity, which is obtained by cutting a disulfide bond of the hinge region of the F(ab′)2.
  • A single chain Fv (“scFv”) polypeptide is a covalently linked VH:VL heterodimer which is usually expressed from a gene fusion including VH and VL encoding genes linked by a peptide-encoding linker. The human scFv fragment of the invention includes CDRs that are held in appropriate conformation, preferably by using gene recombination techniques. “dsFv” is a VH:VL heterodimer stabilised by a disulphide bond. Divalent and multivalent antibody fragments can form either spontaneously by association of monovalent scFvs, or can be generated by coupling monovalent scFvs by a peptide linker, such as divalent sc(Fv)2.
  • The term “diabodies” refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) in the same polypeptide chain (VH-VL). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • By “antisense nucleic acid”, it is meant a non-enzymatic nucleic acid molecule that binds to target RNA by means of RNA-RNA or RNA-DNA or RNA-PNA (protein nucleic acid; Egholm et al., 1993, Nature 365, 566) interactions and alters the activity of the target RNA (for a review, see Stein and Cheng, 1993, Science 261, 1004, and Woolf et al., U.S. Pat. No. 5,849,902). Typically, antisense molecules are complementary to a target sequence along a single contiguous sequence of the antisense molecule. However, in certain embodiments, an antisense molecule can bind to substrate such that the substrate molecule forms a loop or hairpin, and/or an antisense molecule can bind such that the antisense molecule forms a loop or hairpin. Thus, the antisense molecule can be complementary to 2, 3, 4, 5, 6, 7, 8, 9, 10 or more non-contiguous substrate sequences or 2, 3, 4, 5, 6, 7, 8, 9, 10 or more non-contiguous sequence portions of an antisense molecule can be complementary to a target sequence or both (for example, see Crooke, 2000, Methods Enzymol., 313, 3-45). In addition, antisense DNA can be used to target RNA by means of DNA-RNA interactions, thereby activating RNAse H, which digests the target RNA in the duplex. The antisense oligonucleotides can comprise one or more RNAse H activating region, which is capable of activating RNAse H cleavage of a target RNA.
  • Upon introduction, the antisense nucleic acid enters a cellular pathway that is commonly referred to as the RNA interference (RNAi) pathway. The term “RNA interference” or “RNAi” refers to selective intracellular degradation of RNA also referred to as gene silencing. RNAi also includes translational repression by small interfering RNAs (siRNAs). RNAi can be initiated by introduction of Long double-stranded RNA (dsRNAs) or siRNAs or production of siRNAs intracellularly, eg from a plasmid or transgene, to silence the expression of one or more target genes. Alternatively RNAi occurs in cells naturally to remove foreign RNAs, eg viral RNAs. Natural RNAi proceeds via dicer directed fragmentation of precursor dsRNA which direct the degradation mechanism to other cognate RNA sequences.
  • In some embodiments, the antisense nucleic acid may be Long double-stranded RNAs (dsRNAs), microRNA (miRNA) and/or small interferent RNA (siRNA).
  • As used herein “Long double-stranded RNA” or “dsRNA” refers to an oligoribonucleotide or polyribonucleotide, modified or unmodified, and fragments or portions thereof, of genomic or synthetic origin or derived from the expression of a vector, which may be partly or fully double stranded and which may be blunt ended or contain a 5′ and or 3′ overhang, and also may be of a hairpin form comprising a single oligoribonucleotide which folds back upon itself to give a double stranded region. In some embodiments, the dsRNA has a size ranging from 150 bp to 3000 bp, preferably ranging from 250 bp to 2000 bp, still more preferably ranging from 300 bp to 1000 bp. In some embodiments, said dsRNA has a size of at least 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1500 bp. In some embodiments, said dsRNA has a size of at most 3000, 2500, 2000, 1500, 1000, 950, 900, 850, 800, 750, 700, 650, 600, 550, 500, 450, 400, 350, 300 bp.
  • A “small interfering RNA” or “siRNA” is a RNA duplex of nucleotides that is targeted to a gene interest. A RNA duplex refers to the structure formed by the complementary pairing between two regions of a RNA molecule. siRNA is targeted to a gene in that the nucleotide sequence of the duplex portion of the siRNA is complementary to a nucleotide sequence of the targeted gene. In some embodiments, the length of the duplex of siRNAs is ranging from 15 nucleotides to 50 nucleotides, preferably ranging from 20 nucleotides to 35 nucleotides, still more preferably ranging from 21 nucleotides to 29 nucleotides. In some embodiments, the duplex can be of at least 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 nucleotides in length. In some embodiments, the duplex can be of at most 45, 40, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15 nucleotides in length. The RNA duplex portion of the siRNA can be part of a hairpin structure. In addition to the duplex portion, the hairpin structure may contain a loop portion positioned between the two sequences that form the duplex. The loop can vary in length. In some embodiments the loop is 5, 6, 7, 8, 9, 10, 11, 12, or 13 nucleotides in length. The hairpin structure can also contain 3 or 5 overhang portions. In some embodiments, the overhang is a 3′ or a 5′ overhang 0, 1, 2, 3, 4, or 5 nucleotides in length.
  • Injection and transfection antisense nucleic acid into cells and organisms has been the main method of delivery. However, expression vectors may also be used to continually express antisense nucleic acid in transiently and stably transfected mammalian cells. (See for example, e.g., Brummelkamp et al., 2002, Science, 296:550-553; Paddison et al., 2002, Genes & Dev, 16:948-958).
  • Antisense nucleic acid may be synthesized chemically or expressed via the use of a single stranded DNA expression vector or equivalent thereof using protocols known in the art as described for example in Caruthers et al., 1992, Methods in Enzymology, 211:3-19; International PCT Publication No. WO 99/54459; Brennan et al., 1998, Biotechnol Bioeng, 61:33-45; and U.S. Pat. No. 6,001,311. In a non-limiting example, small scale syntheses are conducted on a 394 Applied Biosystems, Inc. synthesizer. Alternatively, the antisense nucleic acid molecules of the present invention can be synthesized separately and joined together post-synthetically, for example by ligation (International PCT publication No. WO 93/23569; Belton et al., 1997, Bioconjugate Chem, 8:204).
  • The antisense nucleic acid of the invention may be able of decreasing the expression of CD147, by at least 10, 20, 30, 40%, more preferably by at least 50, 60, 70%, and most preferably by at least 75, 80, 85, 90, 95, 96, 97, 98, 99, 100%.
  • By “meningococcal vaccine antigen” is meant a meningococcal antigen that is capable of raising an immune response against N. meningitidis, and that is suitable for use as a vaccine or as an immunogenic compound.
  • By “immunogenic compound” is meant a compound that provokes or immunomodulates immunosuppress or immunostimulate) an immune response when administered to an individual or which induces the production of antibodies when administered to an individual.
  • By “vaccine” as used herein refers to a compound, such as the immunogenic compound described herein which is administered to immunomodulate an immune response, that will protect or treat an individual from illness, in particular due to that agent. The vaccine may be a therapeutic (treatment) vaccine, i.e. for administration to the individual after development of the disease with the intention to reduce or arrest disease progression, and/or a preventive (prophylactic) vaccine, for administration to the individual prior to the development of the disease, with the intent to prevent initial (and/or recurrent) infection.
  • The terms “subject”, “individual” or “host” are used interchangeably and may be, for example, a human or a non-human mammal. Preferably, the subject is a man, a woman, or a child.
    • Inhibitor of Interaction Between Type IV Pilus-Associated Protein and CD147
  • The present invention relates to an inhibitor of an interaction between type IV pilus-associated protein and CD147 receptor for use for preventing or treating a meningococcal bacteraemia and/or infection, wherein said inhibitor is:
      • (i) a CD147 inhibitor, and/or
      • (ii) a type IV pilus-associated protein inhibitor.
  • In some embodiments, the CD147 inhibitor is an anti-CD147 antibody or an antisense nucleic acid, wherein said antibody inhibits interaction between type IV pilus-associated protein and CD147 receptor, and said antisense nucleic acid silences CD147 receptor expression.
  • In one embodiment, said antisense nucleic acid may comprise or consist of a sequence that is able to inhibit or reduce the expression of a CD147 of sequence SEQ ID NO: 7 or 8, or a CD147 of sequence encoded by the nucleic acid SEQ ID NO: 9 or 10. Said antisense nucleic acid may comprise or consist of a sequence complementary to a nucleic acid encoding a CD147, for example a nucleic acid of sequence SEQ NO: 9 or 10. Preferably, said antisense nucleic acid comprises or consists of a siRNA, in particular at least one siRNA of sequence SEQ ID NO: 1, 2, 3, 4 or 5. In one embodiment, said siRNA comprises or consists of at least 2, 3, 4 or 5 siRNA selected from the group consisting of SEQ ID NOs: 1-5. In one embodiment, said siRNA comprises or consists of at most 5, 4, 3, or 2 siRNA selected from the group consisting of SEQ ID NOs: 1-5. In one embodiment, said siRNA comprises or consists of the four siRNA of sequence SEQ ID NO: 2, 3, 4 and 5.
  • Preferably, said anti-CD147 receptor antibody is able to prevent or inhibit the interaction between type-IV associated protein and CD147 receptor, thereby preventing or inhibiting the adhesion of meningococci to endothelial cells, and consequently preventing or inhibiting meningococcal bacteraemia and/or infection. Preferably, said anti-CD147 antibody is an antibody directed against the binding site of CD147 to type IV pilus-associated proteins. Preferably, said anti-CD147 antibody is directed against C-terminal domain of CD147 or to a fragment thereof. Still more preferably, said anti-CD147 antibody is directed to the ectodomain of CD147 or to a fragment thereof. Accordingly, said anti-CD147 is directed to the amino acids 16 to 321 of sequence SEQ ID NO: 7 or to a fragment thereof, or to the amino acids 16 to 205 of sequence SEQ ID NO: 8, or to a fragment thereof. Preferably, said anti-CD147 antibody is directed to a fragment of at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 contiguous amino acids of said ectodomain of CD147. Still preferably, said anti-CD147 is directed to a fragment consisting of the amino acid 221 to 315 of sequence SEQ ID NO:7 or to the amino acids 105 to 199 of sequence SEQ ID NO:8, i.e. to the membrane proximal Immunoglobulin domain of CD147 (Ig-like V type domain). Still preferably, said anti-CD147 antibody is the anti-CD147 antibody MEM-M6/6 (Abcam®).
  • In still another embodiment, the type IV pilus-associated protein inhibitor is an anti-type IV pilus-associated protein antibody. Preferably, said anti-type IV pilus-associated protein antibody is an antibody directed against the binding site of type IV pilus-associated protein to CD147 receptor, or to a fragment thereof. Still preferably, said anti-type IV pilus-associated protein antibody is an antibody directed to the binding site of PilE and/or PilV protein to CD147 receptor, or to a fragment thereof.
  • In still another embodiment, the type IV pilus-associated protein inhibitor is:
      • an immunogenic fragment of a type IV pilus-associated protein, or
      • a fusion protein comprising or consisting of at least 2, 3, 4, 5, 6, 7, 8, 9, 10 immunogenic fragments of a type IV pilus-associated protein,
        wherein said immunogenic fragment or said fusion protein is capable of raising an immune response with antibodies that prevent the interaction between said type IV pilus-associated protein and the CD147 receptor. Preferably, said immunogenic fragment is an immunogenic fragment of PilE or PilV. Consequently, said fusion protein may, for example, comprise or consist of (i) at least 2, 3, 4, 5, 6, 7, 8, 9, 10 immunogenic fragments of PilE, (ii) at least 2, 3, 4, 5, 6, 7, 8, 9, 10 immunogenic fragments of PilV, (iii) one immunogenic fragment of PilE and one immunogenic fragment of PilV, (iv) 2 immunogenic fragments of PilE and 2 immunogenic fragments of PilV, (v) one immunogenic fragment of PilE and 2 immunogenic fragments of PilV, etc.
  • In still another embodiment, the type IV pilus-associated protein inhibitor is a CD147 polypeptide. Preferably, said CD147 polypeptide is able to prevent or inhibit the interaction between said type-IV associated protein and said CD147 receptor, thereby preventing or inhibiting the adhesion of meningococci to endothelial cells, and consequently preventing or inhibiting meningococcal bacteraemia and/or infection. Accordingly, said CD147 polypeptide may be a CD147 amino acid sequence that (i) differs from a complete CD147 of sequence SEQ ID NO: 7 or 8, or from a complete CD147 of sequence encoded by the nucleic acid SEQ ID NO: 9 or 10, by one or several amino acid(s), and (ii) is not able to bind the endothelial cell membrane, or a fragment thereof.
  • In some embodiment, said CD147 polypeptide may comprise or consist of the extracellular domain of CD147, or a fragment thereof.
  • Preferably, said CD147 polypeptide comprises or consist of:
      • a) the amino acid sequence SEQ ID NO: 6, or
      • b) an amino acid sequence substantially homologous to SEQ ID NO:6, preferably at least 80, 85, 90, 95, 96, 97, 98, or 99% identical to SEQ ID NO:6.
  • For example, said fragment may comprise or consist of 10 to 180 contiguous amino acid of said CD147 polypeptide, preferably 50 to 150 amino acids, still preferably 80 to 120 amino acids. For example, said fragment may comprise or consist of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180 contiguous amino acids of said CD147 polypeptide and/or at most 180, 175, 170, 165, 160, 155, 150, 145, 140, 135, 130, 125, 120, 115, 110, 105, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 20, 15, 10 contiguous amino acids of said CD147 polypeptide.
    • Anti-Bacterial Compounds
  • In some embodiments, the inhibitor according to the invention is for administration in combination with at least one anti-bacterial compound, either sequentially or simultaneously.
  • In some embodiments, the inhibitor according to the invention is for administration in combination with at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 anti-bacterial compounds, either sequentially or simultaneously.
  • Sequential administration indicates that the components are administered at different times or time points, which may nonetheless be overlapping. Simultaneous administration indicates that the components are administered at the same time.
  • The anti-bacterial compound may be a biological compound and/or a chemical compound that inhibits or prevents development and/or multiplication of bacteria. Preferably, said anti-bacterial compound is an anti-bacterial compound effective against Neisseria meningitidis (Nm), preferably a Nm of serogroup A, B, C, Y or W135.
  • The anti-bacterial compound may include, but is not limited to, antibiotics, such as the beta-lactamines antibiotics. The beta-lactamines antibiotics may be for example, but without limitation, (a) penicillines, such as benzylpenicilline, phenoxyméthylpenicilline, méticilline, dicloxacilline, flucloxacilline, amoxicilline, ampicilline, co-amoxiclav, pipéracilline, ticarcilline, azlocilline, carbénicilline; (b) cephalosporin, such as cephalexin, cephalotin, cephazolin, cefaclor, cefuroxim, cefamandole, cefotetan, cefoxitin, ceftriaxone, cefixime, cefotaxime, ceftazidime, cefepime, cefpirome; (c) carbapenemes, such as imipeneme, meropeneme, ertapeneme, doripeneme, aztreonam, clanulanic acid, tazobactam, sulbactam.
  • Preferably, said at least one anti-bacterial compound is (i) a meningococcal vaccine antigen, or (ii) a fusion protein comprising at least two meningococcal vaccine antigens.
  • The meningococcal vaccine antigens according to the invention are well-known to the skilled in the art. Indeed, several vaccines against meningococci are commercialized and/or under development.
  • The meningococcal vaccine antigen may comprise or consist of at least one of the polysaccharide or glycoconjugate antigens comprised within the MCV-4 (commercialized under the name of Menactra® or Menveo®), MPSV-4 (Menomune®), Mencevax® or NmVac4-A/C/Y/W-135 vaccines.
  • The meningococcal vaccine antigen may also comprise or consists of the capsule of group B (MenB), A, C, Y, and/or W135 meningococci and/or to the outer membrane vesicle (OMV).
  • In some embodiments, the meningococcal vaccine antigen comprises or consists of a polypeptide or polypeptides. Several such polypeptides or polypeptidic antigens are currently investigated for their vaccinal potency. The meningococcal vaccine antigen may be any of the proteins of the external surface of the meningococci. Thus the meningococcal vaccine antigen may be for example, the PilE protein (e.g. as described in PCT/EP2011/069463), the PilV protein (e.g. as described in PCT/EP2011/069463), the PilX protein, the PilC protein, the ComP protein, Meningococcal Factor H binding protein (fHbp, previously referred to as GNA1870 or Lp2086), the major immunodominant surface porin (PorA), Neisserial Heparin Binding Antigen (NHBA, previously referred to as GNA2132), Neisseria adhesin A (NadA), MafA, Neisserial surface protein A (NspA), Hemoglobin Receptor (HmbR), Transferrin-binding Protein B (TbPB), Autotransporter serine Protease (AusP), or fragments thereof. Preferably, said fragments are immunogenic fragments.
  • The PilE protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said PilE protein may comprise or consist of the sequence of SEQ ID NO: 11 or SEQ ID NO: 12 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 11 or SEQ ID NO: 12, or an immunogenic fragment thereof.
  • The PilV protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said PilV protein may comprise or consist of the sequence of SEQ ID NO: 13 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 13, or an immunogenic fragment thereof.
  • The PilX protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said PilX protein may comprise or consist of the sequence of SEQ ID NO: 14 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 14, or an immunogenic fragment thereof.
  • The PilC protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said PilC protein may comprise or consist of the sequence of SEQ ID NO: 15 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 15, or an immunogenic fragment thereof.
  • The ComP protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said ComP protein may comprise or consist of the sequence of SEQ ID NO: 16 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 16, or an immunogenic fragment thereof.
  • The fHBP protein may be a fHBP polypeptide of subfamilyB/Variant1 or of subfamilyA/Variant 2. For example, said fHBP polypeptide may comprise or consist of the sequence SEQ ID NO: 17 or SEQ ID NO: 18 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 17 or SEQ ID NO: 18, or an immunogenic fragment thereof.
  • The PorA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said PorA protein may comprise or consist of the sequence SEQ ID NO: 19 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 19, or an immunogenic fragment thereof.
  • The NHBA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said NHBA protein may comprise or consist of the sequence SEQ ID NO: 20 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 20, or an immunogenic fragment thereof.
  • The NadA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said NadA protein may comprise or consist of the sequence SEQ ID NO: 21 or a sequence at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 21, or an immunogenic fragment thereof.
  • The MafA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said MafA protein may comprise or consist of the sequence of SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24, or an immunogenic fragment thereof.
  • The NspA protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said NspA protein may comprise or consist of the sequence of SEQ ID NO: 25 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 25, or an immunogenic fragment thereof.
  • The HmbR protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said HmbR protein may comprise or consist of the sequence of SEQ ID NO: 26 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 26, or an immunogenic fragment thereof.
  • The TbpB protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said TbpB protein may comprise or consist of the sequence of SEQ ID NO: 27 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 27, or an immunogenic fragment thereof.
  • The AusP protein may derive from any meningococcal serogroup, e.g. from a meningococcus of serogroup A, B, C, Y or W135. For example, said AusP protein may comprise or consist of the sequence of SEQ ID NO: 28 or a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence SEQ ID NO: 28, or an immunogenic fragment thereof.
  • The immunogenic fragments according to the invention may be a contiguous portion of a meningococcal vaccine antigen as described herein that has the same or substantially the same immunogenic activity as said meningococcal vaccine antigen. That is to say, the fragment is capable of raising an immune response with antibodies that recognizes PilE, PilV, PilX, PilC, ComP, fHBP, NadA, PorA, NHBA, MafA, NspA, HmbR, TbPB, or AusP. Preferably, the fragment is capable of raising an immune response with antibodies that prevent meningococcal infection. More preferably, said fragment is an immunogenic fragment of PilE or PilV that is capable of raising an immune response with antibodies that prevent meningococci to cross of the BBB or to spread into the meningeal space. Still more preferably, said fragment is an immunogenic fragment of PilE or PilV that is capable of raising an immune response with antibodies that inhibit the interaction between PilE and/or PilV and β2AR.
  • In some embodiment, said immunogenic fragment of PilE or PilV does not carry the hydrophobic domain of PilE or PilV, respectively. More particularly, said immunogenic fragment of PilE does not carry the hydrophobic domain of sequence FTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYL (SEQ ID NO: 29). More particularly, said immunogenic fragment of PilV does not carry the hydrophobic domain of sequence FTLLELMIAVAILGILTLITYPSYKTYIRRVRLSEVRTTLLHNAQTMERYYRQ (SEQ ID NO: 30).
  • In some embodiments, said immunogenic fragment of PilE comprises or consists of:
      • a) the sequence SAVTEYYLNHGEWPGDNSSAGVATSADIKGKYVQSVTVANGVITAQMASSNVNNEIKSKKLS LWAKRQNGSVKWFCGQPVTRTTATATDVAAANGKTDDKINTKHLPSTCRDDSSAS (SEQ ID NO:31), or
      • b) a fragment of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115 consecutive amino acids of the sequence SEQ ID NO:31, or
      • c) a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence of (a) or (b).
  • In some embodiments, said immunogenic fragment of PilV comprises or consists of:
      • a) the sequence TMERYYRQKGTFKTYDKNKLKQNKYFNVTLSKVSPDHFTLQADPNPTTNDGETCWTLDGG TIAASGTNQSCPGFD (SEQ ID NO:32), or
      • b) a fragment of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75 consecutive amino acids of the sequence SEQ ID NO:32, or
      • c) a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence of (a) or (b).
  • In some embodiments, said immunogenic fragment of PilE or PilV carries the recognition domain to the β2AR responsible for meningococcal signaling.
  • More particularly, said immunogenic fragment of PilE comprises or consists of:
      • a) the sequence CGQPVTRTTATATDVAAANGKTDDKINTKHLPSTC (SEQ ID NO: 33), or
      • b) a fragment of at least 10, 15, 20, 25, 30 consecutive amino acids of the sequence SEQ ID NO:33, or
      • c) a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence of (a) or (b).
  • More particularly, said immunogenic fragment of PilV comprises or consists of:
      • a) the sequence GETCWTLNDGGTIAASGTNQSCPGFD (SEQ ID NO:34), or
      • b) a fragment of at least 10, 15, 20, 25 consecutive amino acids of the sequence SEQ ID NO:34, or
      • c) a sequence that is at least 80, 85, 90, 95 or 99% identical to the sequence of (a) or (b).
  • In some embodiments, said fusion protein comprises at least 2, 3, 4, 5, 6, 7, 8, 9, 10 or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 meningococcal vaccine antigens as described herein.
  • For example, said fusion protein comprises or consists of:
      • a meningococcal PilE protein or an immunogenic fragment thereof, fused in frame with a meningococcal PilV protein or an immunogenic fragment thereof;
      • or
      • a meningococcal PilE protein or an immunogenic fragment thereof, fused in frame with a PilX, PilC, ComP, fHBP, NadA, PorA, NHBA, MafA, NspA, HmbR, TbpB, or AusP protein or an immunogenic fragment thereof; or
      • a meningococcal PilV protein or an immunogenic fragment thereof, fused in frame with a PilX, PilC, ComP, fHBP, NadA, PorA, NHBA, MafA, NspA, HmbR, TbpB, or AusP protein or an immunogenic fragment thereof; or
      • a meningococcal PilE protein or an immunogenic fragment thereof, fused in frame with (i) a meningococcal PilV protein or an immunogenic fragment thereof, and (ii) a PilX, PilC, ComP, fHBP, NadA, PorA, NHBA, MafA, NspA, HmbR, TbpB, or AusP protein or an immunogenic fragment thereof.
  • For example, said fusion protein comprises or consists of the immunogenic fragment of PilE of sequence SEQ ID NO: 31 fused with the fHBP polypeptide of sequence SEQ ID NO: 18, or of the immunogenic fragment of PilE of sequence SEQ ID NO: 33 fused with the fHBP polypeptide of sequence SEQ ID NO: 18. Consequently, said fusion protein comprises or consists of the sequence SEQ ID NO: 35 or SEQ ID NO: 36.
  • For example, said fusion protein comprises or consists of the immunogenic fragment of PilV of sequence SEQ ID NO: 32 fused with the fHBP polypeptide of sequence SEQ ID NO: 18, or of the immunogenic fragment of PilV of sequence SEQ ID NO: 34 fused with the fHBP polypeptide of sequence SEQ ID NO: 18. Consequently said fusion protein comprises or consists of the sequence SEQ ID NO: 37 or SEQ ID NO: 38.
  • The fusion protein may further comprise other moieties such as e.g. peptidic linkers allowing linking the different antigens, proteins or fragments comprised within the fusion protein, a tag useful for purification, a leader sequence, a signal peptide, one or more peptidic fragments enhancing the immunogenicity, etc.
    • Pharmaceutical Compositions
  • The invention also relates to a pharmaceutical composition comprising an inhibitor according to the invention and a pharmaceutical acceptable vehicle, diluent, or carrier.
  • Preferably, said inhibitor comprises or consists of:
      • (i) at least 1, 2, 3, 4 or 5, or at most 5, 4, 3, 2, or 1 siRNA selected from the group consisting of siRNA of sequence SEQ ID NOs: 1, 2, 3, 4 and 5 as defined hereabove,
      • (ii) the 4 siRNA of sequence SEQ ID NOs: 2, 3, 4, and 5 as defined hereabove,
      • (iii) the anti-CD147 antibody MEM-M6/6 as defined hereabove, or
      • (iv) the variant CD147 of sequence SEQ ID NO: 6 as defined hereabove.
  • In some embodiments, said pharmaceutical composition further comprises at least one anti-bacterial compound. The active ingredients may be mixed in the same composition comprising a pharmaceutical acceptable vehicle, diluent, or carrier. They may be conditioned separately, for simultaneous, separate or sequential administration to a mammal, including human. Said pharmaceutical composition may also comprise at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 anti-bacterial compounds.
  • Said at least one anti-bacterial compound may be a compound as defined above. Preferably, said at least one anti-bacterial compound comprises or consists of:
      • (a) at least a PilE, PilV, PilX, PilC, ComP, fHBP, NadA, PorA, NHBA, MafA, NspA, HmbR, TbpB, or AusP protein or an immunogenic fragment thereof as defined hereabove, or
      • (b) a fusion protein as defined hereabove.
  • In some embodiments, said pharmaceutical composition comprises:
      • the inhibitor (i) and the anti-bacterial compound (a),
      • the inhibitor (ii) and the anti-bacterial compound (a),
      • the inhibitor (iii) and the anti-bacterial compound (a),
      • the inhibitor (iv) and the anti-bacterial compound (a),
      • the inhibitor (i) and the anti-bacterial compound (b),
      • the inhibitor (ii) and the anti-bacterial compound (b),
      • the inhibitor (iii) and the anti-bacterial compound (b),
      • the inhibitor (iv) and the anti-bacterial compound (b),
      • the inhibitors (i) and (iii), and the anti-bacterial compound (a),
      • the inhibitors (i) and (iv) and the anti-bacterial compound (a),
      • the inhibitors (i) and (iii), and the anti-bacterial compound (b),
      • the inhibitors (i) and (iv) and the anti-bacterial compound (b),
      • the inhibitors (ii) and (iii), and the anti-bacterial compound (a),
      • the inhibitors (ii) and (iv) and the anti-bacterial compound (a),
      • the inhibitors (ii) and (iii), and the anti-bacterial compound (b),
      • the inhibitors (ii) and (iv) and the anti-bacterial compound (b),
      • the inhibitors (i), (iii) and (iv), and the anti-bacterial compound (a),
      • the inhibitors (ii), (iii) and (iv), and the anti-bacterial compound (a),
      • the inhibitors (i), (iii) and (iv), and the anti-bacterial compound (b), or
      • the inhibitors (ii), (iii) and (iv), and the anti-bacterial compound (b).
  • The pharmaceutical compositions according to the invention may be administered orally in the form of a suitable pharmaceutical unit dosage form. The pharmaceutical compositions of the invention may be prepared in many forms that include tablets, hard or soft capsules, especially hard or soft gelatin capsules, aqueous solutions, suspensions, and liposomes and other slow-release formulations, such as shaped polymeric gels.
  • The mode of administration and dosage forms are closely related to the properties of the therapeutic agents or compositions which are desirable and efficacious for the given treatment application. Suitable dosage forms include, but are not limited to, oral, intravenous, rectal, sublingual, mucosal, nasal, ophthalmic, subcutaneous, intramuscular, transdermal, spinal, intrathecal, intra-articular, intra-arterial, sub-arachnoid, bronchial, and lymphatic administration, and other dosage forms for systemic delivery of active ingredients.
  • Pharmaceutical compositions of the invention may be administered by any method known in the art, including, without limitation, transdermal (passive via patch, gel, cream, ointment or iontophoretic); intravenous (bolus, infusion); subcutaneous (infusion, depot); transmucosal (buccal and sublingual, e.g., orodispersible tablets, wafers, film, and effervescent formulations; conjunctival (eye drops); rectal (suppository, enema)); or intradermal (bolus, infusion, depot).
  • The solid unit dosage forms can be of the conventional type. The solid form can be a capsule, such as an ordinary gelatin type containing the inhibitor of the present invention, and optionnally an anti-bacterial compound of the present invention, and a carrier, for example, lubricants and inert fillers such as, lactose, sucrose, or cornstarch. In another embodiment, these compounds are tableted with conventional tablet bases such as lactose, sucrose, or corn starch in combination with binders like acacia, corn starch, or gelatin, disintegrating agents such as, corn starch, potato starch, or alginic acid, and a lubricant like stearic acid or magnesium stearate.
  • Oral liquid pharmaceutical compositions may be in the form of, for example, aqueous or oily suspensions, solutions, emulsions, syrups or elixirs, or may be presented as a dry product for constitution with water or other suitable vehicle before use. Such liquid pharmaceutical compositions may contain conventional additives such as suspending agents, emulsifying agents, non-aqueous vehicles (which may include edible oils), or preservatives.
  • Pharmaceutical compositions of the invention may also be formulated for parenteral administration (e.g., by injection, for example, bolus injection or continuous infusion) and may be presented in unit dosage form in ampoules, pre-filled syringes, small volume infusion containers or multi-dose containers with an added preservative. The pharmaceutical compositions may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain formulating agents such as suspending, stabilizing and/or dispersing agents. Alternatively, the pharmaceutical compositions of the invention may be in powder form, obtained by aseptic isolation of sterile solid or by lyophilization from solution, for constitution with a suitable vehicle, e.g. sterile, pyrogen-free water, before use.
  • Pharmaceutical compositions suitable for rectal administration wherein the carrier is a solid are most preferably presented as unit dose suppositories. Suitable carriers include cocoa butter and other materials commonly used in the art, and the suppositories may be conveniently formed by admixture of the pharmaceutical composition with the softened or melted carrier(s) followed by chilling and shaping in molds.
  • For administration by inhalation, the pharmaceutical compositions according to the invention are conveniently delivered from an insufflator, nebulizer or a pressurized pack or other convenient means of delivering an aerosol spray. Pressurized packs may comprise suitable propellant such as dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol, the dosage unit may be determined by providing a valve to deliver a metered amount. Alternatively, for administration by inhalation or insufflation, the pharmaceutical compositions of the invention may take the form of a dry powder composition, for example, a powder mix of the pharmaceutical composition and a suitable powder base such as lactose or starch. The powder composition may be presented in unit dosage form in, for example, capsules or cartridges or, e.g., gelatin or blister packs from which the powder may be administered with the aid of an inhalator or insufflator.
  • For intra-nasal administration, the pharmaceutical compositions of the invention may be administered via a liquid spray, such as via a plastic bottle atomizer. Typical of these are the Mistometerg (isoproterenol inhaler-Wintrop) and the Medihaler® (isoproterenol inhaler-Riker).
  • For antisense nucleic acid administration, the pharmaceutical compositions of the invention may be prepared in forms that include encapsulation in liposomes, microparticles, microcapsules, lipid-based carrier systems. Non limiting examples of alternative lipid based carrier systems suitable for use in the present invention include polycationic polymer nucleic acid complexes (see, e.g. US Patent Publication No 20050222064), cyclodextrin polymer nucleic acid complexes (see, e.g. US Patent Publication No 20040087024), biodegradable poly 3 amino ester polymer nucleic acid complexes (see, e.g. US Patent Publication No 20040071654), pH sensitive liposomes (see, e.g. US Patent Publication No 20020192274), anionic liposomes (see, e.g. US Patent Publication No 20030026831), cationic liposomes (see, e.g. US Patent Publication No 20030229040), reversibly masked lipoplexes (see, e.g. US Patent Publication No 20030180950), cell type specific liposomes (see, e.g. US Patent Publication No 20030198664), microparticles containing polymeric matrices (see, e.g. US Patent Publication No 20040142475), pH sensitive lipoplexes (see, e.g. US Patent Publication No 20020192275), liposomes containing lipids derivatized with releasable hydrophilic polymers (see, e.g. US Patent Publication No 20030031704), lipid en trapped nucleic acid (see, e.g. PCT Patent Publication No WO 03/057190), lipid encapsulated nucleic acid (see, e.g. US Patent Publication No 20030129221), polycationic sterol derivative nucleic acid complexes (see, e.g. U.S. Pat. No. 6,756,054), other liposomal compositions (see, e.g. US Patent Publication No 20030035829), other microparticle compositions (see, e.g. US Patent Publication No 20030157030), poly-plexes (see, e.g. PCT Patent Publication No WO 03/066069), emulsion compositions (see, e.g. U.S. Pat. No. 6,747,014), condensed nucleic acid complexes (see, e.g. US Patent Publication No 20050123600), other polycationic nucleic acid complexes (see, e.g. US Patent Publication No 20030125281), polyvinylether nucleic acid complexes (see, e.g. US Patent Publication No 20040156909), polycyclic amidinium nucleic acid complexes (see, e.g. US Patent Publication No 20030220289), nanocapsule and microcapsule compositions (see, e.g. PCT Patent Publication No WO 02/096551), stabilized mixtures of liposomes and emulsions (see, e.g. EP1304160), porphyrin nucleic acid complexes (see, e.g. U.S. Pat. No. 6,620,805), lipid nucleic acid complexes (see, e.g. US Patent Publication No 20030203865), nucleic acid micro emulsions (see, e.g. US Patent Publication No 20050037086), and cationic lipid based compositions (see, e.g. US Patent Publication No 20050234232). One skilled in the art will appreciate that modified siRNA of the present invention can also be delivered as a naked siRNA molecule.
  • Pharmaceutical compositions of the invention may also contain other adjuvants such as flavorings, colorings, or preservatives.
  • It will be further appreciated that the amount of the pharmaceutical compositions required for use in treatment will vary not only with the therapeutic agent selected but also with the route of administration, the nature of the condition being treated and the age and condition of the patient and will be ultimately at the discretion of the attendant physician or clinician.
    • Method for Preventing Adhesion of Meningococci to an Endothelial Cell
  • The inhibitor according to the invention may be used in a method of preventing or inhibiting adhesion of meningococci to an endothelial cell.
  • Said method may be an in vitro or ex vivo method.
  • The invention thus provides the use of an inhibitor as defined herein in an in vitro or in vivo method for preventing or inhibiting adhesion of meningococci to an endothelial cell.
  • In some embodiments, said inhibitor is used in combination with at least one anti-bacterial compound as defined hereabove. In some embodiments, said inhibitor is used in combination with at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and/or at most 10, 9, 8, 7, 6, 5, 4, 3, 2 anti-bacterial compounds as defined hereabove.
  • Said method may comprise, for example, exposing said cell and/or said meningococcus to said inhibitor. Where the method is an in vivo method, the method may comprise administering said inhibitor to a subject, preferably a patient in need thereof.
  • In some embodiments, said endothelial cells may be brain endothelial cells, capillaries endothelial cells, human dermal endothelial cells and/or umbilical vein endothelial cells.
    • Administration and Methods of Treatment
  • The invention also relates to a method for preventing or treating meningococcal bacteraemia or infection in an individual in need thereof comprising administering a therapeutically effective amount of an inhibitor according to the invention or a pharmaceutical composition of the invention.
  • By “treatment” is meant a therapeutic use (i.e. on a patient having a given disease) and by “preventing” is meant a prophylactic use (i.e. on an individual susceptible of developing a given disease). The term “treatment” not only includes treatment leading to complete cure of the disease, but also treatments slowing down the progression of the disease and/or prolonging the survival of the patient.
  • An “effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • A therapeutically effective amount of an inhibitor of the invention may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the protein, to elicit a desired therapeutic result. A therapeutically effective amount encompasses an amount in which any toxic or detrimental effects of the inhibitor are outweighed by the therapeutically beneficial effects. A therapeutically effective amount also encompasses an amount sufficient to confer benefit, e.g., clinical benefit.
  • In the context of the present invention, “preventing a meningococcal bacteraemia or infection” may mean prevention of meningococcus adhesion to the endothelial cells of the host.
  • In the context of the present invention, “treating a meningococcal bacteraemia or infection”, may mean reversing, alleviating, or inhibiting meningococcus adhesion to the endothelial cells of the host.
  • In the context of the invention, meningococcal infection may be reduced by at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100%.
  • In some embodiments, the methods of the invention comprise the administration of an inhibitor as defined above, in combination with at least one anti-bacterial compound as defined above, either sequentially or simultaneously. For example, said at least other anti-bacterial compound is (i) a meningococcal vaccine antigen, or (ii) a fusion protein comprising at least two meningococcal vaccine antigens, as described hereabove.
  • In another embodiment, said method comprises the administration of a pharmaceutical composition according to the invention.
  • The administration regimen may be a systemic regimen. The mode of administration and dosage forms are closely related to the properties of the therapeutic agents or compositions which are desirable and efficacious for the given treatment application. Suitable dosage forms and routes of administration include, but are not limited to, oral, intravenous, rectal, sublingual, mucosal, nasal, ophthalmic, subcutaneous, intramuscular, transdermal, spinal, intrathecal, intra-articular, intra-arterial, sub-arachnoid, bronchial, and lymphatic administration, and/or other dosage forms and routes of administration for systemic delivery of active ingredients. In a preferred embodiment, the dosage forms are for parenteral administration.
  • The administration regimen may be for instance for a period of at least 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 days.
  • The dose range may be between 0.1 mg/kg/day and 100 mg/kg/day. More preferably, the dose range is between 0.5 mg/kg/day and 100 mg/kg/day. Most preferably, the dose range is between 1 mg/kg/day and 80 mg/kg/day. Most preferably, the dose range is between 5 mg/kg/day and 50 mg/kg/day, or between 10 mg/kg/day and 40 mg/kg/day.
  • In some embodiments, the dose may be of at least 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50 mg/kg/day. In some embodiments, the dose may be of at most 50, 45, 40, 35, 30, 25, 20, 25, 15, 10, 5, 1, 0.5, 0.1 mg/kg/day.
  • The dose range may also be between 10 to 10000 UI/kg/day. More preferably, the dose range is between 50 to 5000 UI/kg/day, or between 100 to 1000 UI/kg/day.
  • In some embodiments, the dose may be of at least 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10000 UI/kg/day. In some embodiments, the dose may be of at most 10000, 9500, 9000, 8500, 8000, 7500, 7000, 6500, 6000, 5500, 5000, 4500, 4000, 3500, 3000, 2500, 2000, 1500, 1000, 900, 800, 600, 500, 450, 400, 350, 300, 250, 200, 150, 100 UI/kg/day.
    • Screening Method
  • The invention also relates to a method for screening inhibitors of the interaction between a type IV associated-pilus protein and the CD147 receptor, wherein said method comprises the step consisting of:
      • a) having a medium containing a type IV associated-pilus protein, or a fragment thereof, and CD147 receptor, or a fragment thereof, wherein said type IV associated-pilus protein, or a fragment thereof, and said CD147 receptor, or a fragment thereof, are able to specifically interact together to form a binding pair,
      • b) contacting said medium with a candidate compound,
      • c) measuring the inhibition of the interaction between said type IV associated-pilus protein, or a fragment thereof, and said CD147 receptor, or a fragment thereof.
  • Preferably, step b) is performed by adding the candidate compound to the medium of step a).
  • Compounds that inhibits the interaction are selected. This selection may be performed if the measuring in step c) demonstrates a significant inhibition of said interaction.
  • In some embodiments, said type IV associated-pilus protein comprises or consists of a PilE or PilV protein or to a fragment thereof that is able to interact with CD147 receptor.
  • In some embodiments, said fragment of CD147 receptor comprises or consists of the ectodomain of CD147 or to the membrane proximal Immunoglobulin domain of CD147, or to the extracellular domain of CD147 of sequence SEQ ID NO: 6.
  • In some embodiments, the method according to the present invention is characterized in that at step c) the measure of the inhibition of the interaction is carried out by immunoassay (particularly by ELISA or by Immunoradiometric Assay (IRMA)), by Scintillation Proximity Assay (SPA) or by Fluorescence Resonance Energy Transfer (FRET).
  • Preferably, the method according to the present invention method is based on the Alphascreen® technology. Alphascreen® is based on Donor (D, photosensitizer) and Acceptor (A, chemiluminescer) microbeads, coated with two molecules of interest, susceptible of binding to each other. Laser excitation of the D beads causes ambient oxygen to be converted to the singlet state by the photosensitizer. Singlet oxygen species in turn activate chemiluminescent agents on the A beads. Upon activation, the chemiluminescent agent emits light which is detected by the photo-detector in a microplate reader. A signal is produced when the A and D beads are brought into proximity (<200 nm) thus reporting for the interaction between the partners captured on the two beads (Taouji et al., 2009, Curr Genomics, 10(2):93).
  • Accordingly, in an embodiment, at step a) said type IV associated-pilus protein, or fragment thereof, is bound to an acceptor bead and said CD147 receptor, or fragment thereof, is bound to a donor bead. In another embodiment, at step a) said type IV associated-pilus protein, or fragment thereof, is bound to a donor bead and said CD147 receptor, or fragment thereof, is bound to an acceptor bead. Said type IV associated-pilus protein, or fragment thereof, and CD147, or fragment thereof, may be directly or indirectly bound to said beads.
  • Step a) is performed in conditions that allow the interaction between said type IV associated-pilus protein and said CD147 receptor. Accordingly, the binding of said type IV associated-pilus protein and said CD147 receptor will result in bringing the donor and acceptor particle at a distance less than 200 nm from each other, thereby providing an energy transfer between the donor and acceptor molecules.
  • In some embodiments, the donor bead contains phtalocyanine and the acceptor bead contains rubren. The donor bead is submitted to a laser excitation at 680 nm, inducing the conversion of ambient oxygen to a singlet state oxygen. The singlet state oxygen reacts with the chemiluminescent agent, i.e. rubren, on the acceptor bead. Upon energy transfer, activated rubrene emits light at 520-620 which is detected by the photodetector in a microplate reader. The luminescence can for example be measured with a photodetector in a microwell plate reader, such as the EnVision® multilabel plate reader from Perkin-Elmer.
  • In some embodiments, the donor and acceptor beads are bound to fluorophores and the energy transfer amounts to fluorescence is emitted upon excitation by a first donor fluorophore, towards a second acceptor fluorophore. The acceptor fluorophore is, thus, activated and emits a second fluorescence. The fluorescence of the second acceptor fluorophore can be measured for example by a spectrofluorometer.
  • If energy transfer is detected at step a), it is considered that there is an interaction between said type IV associated-pilus protein, or fragment thereof, and said CD147 receptor, or fragment thereof.
  • The candidate compounds include but are not limited to peptides, small molecules, antibodies, aptamers and nucleic acids such as antisense nucleic acids.
  • Measuring the inhibition of interaction between said type IV pilus-associated protein, or fragment thereof, and said CD147 receptor, or fragment thereof, at step c) may be performed by measuring the luminescence or the fluorescence. If the level of luminescence or fluorescence at step c) is lower than the level of luminescence or fluorescence at step a), it indicates that the candidate compound is an inhibitor of the interaction of said type IV associated-pilus protein, or fragment thereof, and said CD147 receptor, or fragment thereof.
  • The invention will now be described in more detail with reference to the following figures and examples. All literature and patent documents cited herein are hereby incorporated by reference.
    • FIGURES
  • FIG. 1. Identification of CD147 as N. meningitidis receptor candidate. TPA treatment induces Nm adhesion to BB19 cells: cells were untreated (white) or treated with TPA (10 ng/ml, black) in the absence (-) or in the presence of Actinomycin D (1 μg/ml). Adhesion of wild type meningococci (WT) was measured 48 h after treatment. Mean±s.e.m, n>_3;***P<0.0001; Two-way Anova.
  • FIG. 2. Identification of CD147 as N. meningitidis receptor candidate. TPA treatment induces Nm adhesion to BB19 cells: cells were untreated (white) or treated with TPA (10 ng/ml, black). Adhesion of wild type meningococci (WT) or of the bacterial mutants dpilE, dpilC1 or dpilC2 was measured 48 h after treatment. Mean±s.e.m, n>_3;***P<0.0001; Two-way Anova.
  • FIG. 3. CD147 accumulates at sites of bacterial adhesion independently of the 02-adrenergic receptor-coupled signalling events. Isoproterenol-induced ß2-adrenergic receptor endocytosis inhibited type IV pilus-induced signaling events, but did not affect CD147 accumulation at sites of bacterial adhesion. Quantification of Ezrin, Actin, CD44 or CD147 recruitment at sites of Nm adhesion upon cell pretreatement with 10 laM isoproterenol. Mean±s.e.m, n=3;***P<0.001; **P<0.01; NS P>0.05; Two-way Anova.
  • FIG. 4. CD147 knockdown reduced Nm adhesion to hCMEC/D3s relative to control siRNA (CTL). Mean±s.e.m, n=4;**P<0.05; Two-tailed t test.
  • FIG. 5. Expression of exogenous CD147 restored bacterial adhesion to CD147 knock-down hBMEC cells. Mean±s.e.m, n=3;**P=0.0025; One-way Anova.
  • FIG. 6. CD147 knockdown reduced the initial attachment of Nm to hBMEC cells under shear stress. Mean±s.e.m, n=3;**P<0.01. One-way Anova.
  • FIG. 7. CD147-Fc but not ICAM-1-Fc (both 5 μg/ml) reduced Nm adhesion to hBMEC cells. Mean±s.e.m, n=3;**P<0.01; One-way Anova.
  • FIG. 8. AntiCD147 MEM-M6/6 [10 μg/ml] potently inhibited Nm adhesion to hBMEC cells, other antibodies [10 μg/ml] scarcely (MEM-M6/1) or did not (anti-ICAM-1, 11C81) affect adhesion. Mean±s.e.m, n=3;***P<0.001; **P<0.001; One-way Anova.
  • FIG. 9. Nm directly adhere on immobilised CD147-Fc, but not ICAM-1-Fc. Negative: no immobilised proteins. Bar: mean per field. Mean±s.e.m, n=3;***P<0.001; One-way Anova.
  • FIG. 10. Wild type (WT), dpilE, dpilC1 or dpilC2 meningococci adhering to immobilised CD147-Fc. Bar: mean per field. Mean±s.e.m, n=4;***P<0.001; One-way Anova.
  • FIG. 11. Purified MBP-PilE and MBP-PilV chimera interact directly with CD147-Fc, whereas MBP-PilX, MBP-ComP and MBP did not. Top: CD147-Fc co-precipitating with staphylococci carrying the MBP-Pilins indicated. Bottom: Quantification of bound CD147-Fc. Mean±s.e.m, n=4;***P<0.001;**P<0.01; One-way Anova.
  • FIG. 12. Soluble MBP-PilE and MBP-PilV potently inhibited bacterial adhesion to hCMEC/D3 cells, whereas MBP-PilX, MBP-ComP and MBP were ineffective. Mean±s.e.m, n=4;***P<0.001; **P<0.01; One-way Anova.
  • FIG. 13. Bacterial mutants ΔpilE and ΔpilV failed to adhere to hCMEC/D3 cells. Mean±s.e.m, n=4;***P<0.001; One-way Anova.
  • FIG. 14. Quantification of adherent fluorescent meningococci/100 μm2 section, expressed as % of adherent WT. Mean±s.e.m n=3, brain sections from 3 different donors, ***P<0.001; One-way Anova.
  • FIG. 15. In Situ infection of fresh human brain sections by N. meningitidis required pilus interaction with CD147. Mean±s.e.m of total fluorescence/100 μm2 relative to fluorescence in absence of antibody, n=4, brain sections from 3 different donors, *P<0.05; One-way Anova.
  • FIG. 16. The pilus of Neisseria meningitidis is required for targeting human skin xenografts if SCID mice (Intraperitoneal route, 106 CFUs, 3 mice per group).
  • FIG. 17. Impact of human skin xenograft on bacteraemia in SCID mice (Intraveinous route, 105 CFUs, 3 mice per group).
  • FIG. 18. Survival of Neisseria meningitidis infected SCID mice (Intraveinous route, 105 CFUs, 3 mice per group).
    •  BRIEF DESCRIPTION OF THE SEQUENCE LISTING
  • SEQ ID NOs: 1 to 5 show the sequences of the siRNA against CD147.
  • SEQ ID NO: 6 shows the sequence of the extracellular domain of CD147.
  • SEQ ID NO: 7 shows the amino acid sequence of CD147 referenced under the NCBI Reference Sequence Number NP_001719.2.
  • SEQ ID NO: 8 shows the amino acid sequence of CD147 referenced under the NCBI Reference Sequence Number NP_940991.1.
  • SEQ ID NO: 9 shows the nucleotidic sequence of CD147 referenced under the NCBI Reference Sequence Number NM_001728.2.
  • SEQ ID NO: 10 shows the nucleotidic sequence of CD147 referenced under the NCBI Reference Sequence Number NM_198589.1.
  • SEQ ID NOs: 11 and 12 show amino acid sequences of PilE.
  • SEQ ID NO: 13 shows the amino acid sequence of PilV.
  • SEQ ID NO: 14 shows the amino acid sequence of PilX.
  • SEQ ID NO: 15 shows the amino acid sequence of PilC.
  • SEQ ID NO: 16 shows the amino acid sequence of ComP.
  • SEQ ID NOs: 17 and 18 show amino acid sequences of fHBP.
  • SEQ ID NO: 19 shows the amino acid sequence of PorA.
  • SEQ ID NO: 20 shows the amino acid sequence of NHBA.
  • SEQ ID NO: 21 shows the amino acid sequence of NadA.
  • SEQ ID NOs: 22 to 24 show amino acid sequences of MafA.
  • SEQ ID NO: 25 shows the amino acid sequence of NspA.
  • SEQ ID NO: 26 shows the amino acid sequence of HmbR.
  • SEQ ID NO: 27 shows the amino acid sequence of TbpB.
  • SEQ ID NO: 28 shows the amino acid sequence of AusP.
  • SEQ ID NO: 29 shows the sequence of the hydrophobic domain of PilE.
  • SEQ ID NO: 30 shows the sequence of the hydrophobic domain of PilV.
  • SEQ ID NOs: 31 and 33 show the sequences of immunogenic fragments of PilE.
  • SEQ ID NOs: 32 and 34 show the sequences of immunogenic fragments of PilV.
  • SEQ ID NOs: 35 and 36 show the sequences of the fusion proteins between PilE and fHBP polypeptides.
  • SEQ ID NOs: 37 and 38 show the sequences of the fusion proteins between PilV and fHBP polypeptides.
  • SEQ ID NO: 39 shows the sequence of a control siRNA.
    • EXAMPLES Material and Methods Serial Analysis of Gene Expression Adapted for Downsized Extracts (SADE).
  • 200 μg of RNA extracted from 2×107 untreated or TPA treated BB19 cells 16 hours after treatment with TPA, was used as a substrate for SADE. The SADE screen was carried out as described in Virlon et al., 1999, Proc Natl Acad Sci USA, 96:15286-15291. Briefly, total RNA was extracted from cells, poly-adenylated RNA was selected on oligo-dT columns and tagged cDNA was synthesized from the poly-A RNAs. Concatemers of DNA tags were sequenced and the number of sequenced tags differentially represented in the two libraries was determined and analysed using Monte Carlo statistical analysis.
    • Antibodies and Reagents
  • Anti-hCD147 antibodies were purchased from AbD Serotec, anti-hCD44 mAb from Immunotech, antihlCAM-1 from R&D Systems, anti-GFAP and anti-vimentin from Sigma Aldrich. Polyclonal antiserum raised against ezrin was obtained from P. Mangeat (CNRS UMR 5539, Montpelier, France). mAb raised against PilE (20D9) and polyclonal antiserum raised against meningococcal 2C4.3 strain were described previously (Coureuil et al., 2010, Cell, 143:1149-1160). Secondary antibodies used for immunofluorescence labeling, chromogenic immunohistochemistry and immunoblotting were from Jackson ImmunoResearch Laboratories. Soluble chimeric CD147-Fc and ICAM-1-Fc molecules were purchased from R&D Systems. DAPI, Rhoda mine-phalloidin, TPA, Actinomycin D, Isoproterenol, DAB Peroxidase Substrate and NBT/BCIP phosphatase alkaline substrate were purchased from Sigma Aldrich.
    • Cell Culture, Transfection and Infection
  • BB19, a human brain endothelial cell line transformed by papilloma virus was kindly provided by Dr JA. Nelson (Oregon Health and Science University, Beaverton, USA) (Prudhomme et al., 1996, Int J Parasitol, 26:647-655). To induce bacterial adhesion, BB19 were treated with TPA (10 ng/ml, for 10′), washed and 48h after treatment, meningococcal adhesion was measured. When indicated 2h after TPA treatment the transcriptional inhibitor Actinomycin D was added (1 μg/ml, for 4h), cells were washed and adhesion was measured 42h later. The hCMEC/D3 and hBMEC cell lines were transfected and infected as previously described (Coureuil et al., 2010, Cell, 143:1149-1160; Doulet et al., 2006, J Cell Biol, 173-627-637). Plasmid encoding human CD147 was kindly provided by Dr Bukrinsky and plasmid encoding ß2-Adrenergic receptor fused to YFP (p2AR-YFP) was described previously (Angers et al., 2000, Proc Natl Acad Sci USA, 97:3684-3689). To silence the expression of CD147, CD44 and ICAM-1, pools of four siRNA duplexes (ON-TARGET plus SMARTpool siRNA from Dharmacon) were used. The siCONTROL siRNA (Dharmacon) were used as control. Two days after transfection, efficiency of knockdown was assessed by FACS analysis and cells were infected concurrently. When indicated hBMEC cells were transfected with siRNA targeting the 3′ untranslated region of CD147, 3′-GCUGUCUGGUUGCGCCAUUUU-5′ (SEQ ID NO: 1) or control siRNA 3′-AUGUAUUGGCCUGUAUAG-5′ (SEQ ID NO: 39) (Eurogentech) and 40h later, cells were again either mock transfected (-) or transfected with CD147 coding region cDNA. 8 hours later, surface expression of CD147 was quantified by FACS analysis and cells were infected concurrently with Nm 8013 clone 12, capsulated, Opa-, Opc-serogroup C clinical isolate expressing a class I SB pilin. Mutants of this strain Api1C1, ΔpilC2, ΔpilE, ΔpilV, ΔpilX, AcomP and wild type Nm expressing GFP were derived and cultured as described previously (Nassif et al., 1994, Proc Natl Acad Sci USA, 91:3769-3773; Mikaty et al., 2009, PloS Pathog, 5:e1000314; Helaine et al., 2005, Mol Microbiol, 55:65-77; Mairey et al., 2006, J Exp Med, 203:1939-1950).
    • Adhesion Assays
  • Meningococcal adhesion on hCMEC/D3, hBMEC and BB19 was assayed under both static and shear stress conditions, as previously described (Coureuil et al., 2010, Cell, 143:1149-1160; Mairey et al., 2006, J Exp Med, 203:1939-1950; Lambotin et al., 2005, J Cell Sci, 118:3805-3816). When indicated meningococci were pre-incubated with 5 μg/ml soluble recombinant recombinant human CD147-Fc and ICAM-1-Fc chimera (comprising the Ig domains of CD147 or of ICAM-1 fused to the Fc domain of human IgG1 and produced as disulfide-linked homodimers) before interaction with hBMECs with additional 2 μg/ml soluble proteins. Meningococcal adhesion was quantified following a 30 min infection in static conditions. To address the inhibitory effect of antibodies, hBMECs were grown on IBIDI chambers, pretreated for 1h with 10 μg/ml antibodies targeting ICAM-1 (11C81) or CD147 (MEM-M6/1 and MEM-M6/6) and submitted to laminar flow (0.04 dynes/cm2) under an inverted microscope. GFP-expressing bacteria were introduced in the chamber under flow. After 20 min, the number of adherent bacteria was determined. For adhesion assays on immobilised proteins, recombinant human CD147-Fc and ICAM1-Fc chimera were immobilised on glass slides using a modification of the technique described in Steffen et al., 2008, Curr Biol, 18:926-931. Briefly, slides were coated with 0.1% Poly-L Lysine, washed with PBS, crosslinked with glutaraldehyde (0.5%), washed, incubated with anti-Fc in assay buffer (PBS with 3% BSA) for 2h, washed in assay buffer, and incubated overnight at 4° C. with 2 μg/ml chimeric protein. Slides were washed before infection with meningococcal suspension of OD600 0.05. After incubation with bacteria, slides were washed three times and fixed. Bacteria were labelled and visualized with a Leica DM16000 microscope using a 63× oil-immersion objective. The number of adherent bacteria per field was quantified for 30 fields using ImageJ software.
    • Expression, Purification and Immobilisation of MBP-Pilin Recombinant Proteins
  • Fragments of PilE, PilV, PilX and Comp lacking the region coding for amino acid residues 1 to 28 of the full-length proteins fused to the maltose-binding protein (MBP) were produced in E. Coli, purified on amylose resin (New England Biolabs) and immobilised on Staphylococcus aureus (ATCC 25923) expressing specific receptors for the Fc domain of IgG as described before (Coureuil et al., 2010, Cell, 143:1149-1160). Coated bacteria were incubated with 1 μg of recombinant human CD147-Fc chimera for 30 min on ice. After 3 washes, bacteria were lysed with Laemmli buffer and the quantity of co-precipitated CD147-Fc protein was assessed by immunoblot analysis. Bound CD147-Fc was quantified using Image J software. When indicated, hCMEC/D3 cells were pretreated with 10 μg/ml of MBP-Pilins for 15 min prior to infection with meningococcal suspension of OD600 0.05 for 30 min. After incubation with bacteria, cells were washed three times and the number of adherent bacteria was determined as described above.
    • Confocal Immunofluorescence Microscopy
  • hCMEC/D3, BB19 or hBMEC were grown to confluence on permanox coverslips or on transwell filters. After the indicated treatments and/or infection, cells were fixed and labelled as previously described (Lambotin et al., 2005, J Cell Sci, 118:3805-3816; Hoffmann et al., 2001, J Cell Biol, 155:133-143). Image acquisition and analysis were performed with a DM16000 microscope (Leica, 63×). Series of optical sections were obtained with a confocal spinning disk microscope (Leica, 63×). 3D reconstructions were obtained using Imaris software and quantification histograms with ImageJ software (NIH). Quantitative analysis of protein recruitment under bacterial colonies was determined as the proportion of colonies positive for the protein of interest indicated. At least 50 colonies were observed per coverslip. Each experiment was repeated at least 3 times in duplicate or triplicate.
    • Infection of Human Brain Tissues
  • Fresh human brain sections were obtained from frontal lobe specimens of macroscopically and histologically normal brain (confirmed by a neuropathologist) of individuals referred to the Department of Forensic Medicine for unexplained out-of-hospital sudden death (consent forms ML1094, PFS 10-008, ClinicalTrials.gov NCT00320099 from The Institutional Review Boards of the Poincaré Hospital, Versailles-Saint Quentin University and the French “Agence de la Biomédecine”).
  • After freezing of the brain tissue with isopentane cooled in liquid nitrogen, the sections, 7 μm thick, containing leptomeninges, cortical ribbon and the underlying white matter were immobilised on Superfrost™ plus microscope slides and store at −80° C. Defrosted sections were rehydrated in PBS for 5 minutes and incubated for 1h with medium containing 0.1% BSA prior to infection with suspensions of bacteria (2.107 bacteria in 150 μl of medium containing 0.1% BSA) for 1 h at 37° C. Sections were then gently washed horizontally 5 times and fixed in PAF 4% for 10 min at RT. When indicated, sections were treated for 1h with 10 μg/ml of antibodies targeting CD147 or ICAM-1 and then washed 3 times prior to infection by bacteria. Adherent meningococci were detected by chromogenic immunohistochemistry and immunofluorescence analysis. To perform chromogenic immunohistochemistry, after tissue rehydratation, sections were incubated overnight with the indicated primary antibodies and revealed using horseradish peroxidase coupled secondary donkey anti-mouse antibody and an alkaline phosphatase donkey anti-rabbit. DAB (brown color) and NBT/BCIP (blue color) were used as chromogens. For immunofluorescence analysis, brain sections were incubated with the primary antibodies indicated for 2h in PBS/BSA 0.1%. Alexa-conjugated phalloidin and DAPI (0.5 mg/ml) were added to Alexa-conjugated secondary antibodies for 1 h. After additional washing, coverslips were mounted in glycergel (Dako). Entire samples were scanned using Nanozoomer 2.0 (Hamamatsu) and were further analysed using optical microscopy, epifluorescence (Zeiss Axiovert, 40×) and confocal (spinning disk Leica, 63×) microscopy. The marker specificities were systematically confirmed by examining sections in which primary antibody was replaced with isotype control Ig at the same concentration, and by immunostaining of non infected tissues from the same donor. Quantification analysis of the fluorescently labelled bacteria that adhered on a 1 mm2 surface area was performed using ImageJ software (NIH). Results are presented as a mean of fluorescence per 100μ2, from two independent experiments. 3D reconstructions were performed on deconvoluted confocal stacks using Imaris software.
    • AlphaScreen® Assay
  • The AlphaScreen® technology was used to assess the interaction between MBP-Pilin recombinant fusion proteins and CD147-Fc-His or ALCAM-1-Fc-His as a control. The binding reaction was performed using white 384-well Optiplates (PerkinElmer, Whalham, Mass., USA) in 20 μl (total reaction volume). The AlphaScreen® reagents (anti-MBP-coated Acceptor beads and Nickel chelate-coated Donor beads) were obtained from PerkinElmer. CD147-Fc-His (or ALCAM-1-Fc-His) and Pilin-MBP were prepared in 20 mM Tris, pH 7.4, 20 mM NaCl. Donor beads (20 μg/ml) were incubated with CD147-His (0, 100 or 500 nM) for 45 min at room temperature. In parallel Acceptor beads (20 μg/ml) were incubated with Pilin-MBP (0, 50 or 500 nM) for 1h at room temperature in the Alphascreen® reaction buffer (25 mM Tris, pH 7.4 at 20° C., 20 mM NaCl, 0.1% BSA and 0.05% Tween 20). Then, 10 μl of each of the interacting partners were added to the plate, allowed for incubation for either 2 h or overnight in the dark and at room temperature. To perform antibody competition assay, 5 μl of MEM-M-6/6 antibody (at various concentrations) were added to CD147-Fc-His-Donor beads for 30 min at room temperature before incubation with the Pilin-MBP Acceptor beads. Light signal was detected by using the EnVision® multilabel plate reader (PerkinElmer). All manipulations involving AlphaScreen® beads were performed under subdued lighting.
    • Results and Discussion
  • To identify candidate receptors responsible for the initial attachment of Nm Type IV pili expressed by endothelial cells, it has been taken advantage of the inducible expression of a functional receptor on BB19, a transformed human brain endothelial cell line that is poorly permissive to Nm adhesion. Treatment of BB19 cells with phorbol ester 12-O-Tetradecanoylphorbol-13-acetate (TPA) strongly potentiated adhesion of Nm 8013 clone 12, a capsulated piliated clinical isolate of serogroup C (FIG. 1). This effect was inhibited by treatment with the transcription inhibitor actinomycin D (FIG. 1). Furthermore, only the wild type strain and the bacterial pilC2 deletion mutant that harbour adhesive pili, adhered to TPA treated cells, in sharp contrast to the non piliated pilE and the non adhesive pilC1 mutants, which failed to do so (FIG. 2). These data highlighted the transcriptional regulation of a putative adhesion receptor for meningococcal type IV pili. Using a differential and quantitative large-scale analysis of expression of 10 478 genes (see Methods), 211 up-regulated and 194 down-regulated genes were identified in TPA-treated BB19 cells compared to untreated cells. Of the up-regulated genes, six encoded membrane-associated proteins, including CD147, a well known marker of the blood brain barrier (BBB), highly enriched on brain endothelial cells to which Nm preferentially adhere. CD147 is a member of the immunoglobulin (Ig) superfamily, containing two glycosylated Ig-like domains, involved in various physiological and pathological processes. It has been confirmed that TPA treatment of BB19 cells up-regulated the expression of CD147. Furthermore adhesion of Nm to TPA-treated cells induced a massive recruitment of CD147 to sites of bacterial adhesion. CD147 thus appeared to be an attractive receptor candidate for type IV pilus-mediated Nm adhesion.
  • To investigate the role of CD147 in the adhesion of Nm to endothelial cells, two cell lines were used as models. hCMEC/D3 is a fully differentiated human brain endothelial cell line derived from brain capillaries, which recapitulates the major phenotypic features of the BBB, and hBMEC, a human endothelial cell line isolated from bone marrow capillaries. As expected, CD147 was predominantly enriched at cell-cell junctions of a polarized monolayer of hCMEC/D3 cells and a significant fraction of CD147 was present at the luminal surface. In cells infected by Nm, CD147 accumulated at sites of meningococcal adhesion and co-localised with the β2-adrenergic receptor. Importantly, CD147 was recruited independently of the β2-adrenergic receptor expression and associated-coupled signalling events, as expected of a putative receptor mediating the initial bacterial adhesion (FIG. 3).
  • To establish whether CD147 was required for meningococcal adhesion, hCMEC/D3 and hBMEC cells were transfected with CD147-specific small interfering RNAs (siRNA) that knocked down 60 to 70% of the surface expression of CD147 relative to control siRNA. Bacterial adhesion to cells in which CD147 was knocked down was drastically reduced (FIGS. 4 and 5). This effect was restored by the re-expression of exogenous CD147 (FIG. 5). Importantly, CD147 depletion also affected bacterial adhesion under flow conditions, in a quantitative assay of the initial adhesion events (FIG. 6), indicating that CD147 is essential to promote the initial attachment of meningococci to human endothelial cells. In contrast, a similar depletion of CD44 or ICAM-1 expression, two adhesion molecules recruited at sites of bacterial adhesion upon type-IV mediated signalling events, did not affect meningococcal adhesion to either hCMEC/D3 or hBMEC cells, therefore supporting the specific effect of CD147 depletion on meningococcal adhesion to human endothelial cells.
  • To further confirm the role of CD147 in Nm adhesion to endothelial cells, a recombinant soluble form of the extracellular domain of CD147 (CD147-Fc) was used to specifically compete with the membrane-bound receptor. Addition of CD147-Fc reduced bacterial adhesion to hBMEC cells by 50% compared to non-treated cells or cells treated with control soluble ICAM-1-Fc (FIG. 7). An independent approach relied on the use of two CD147-specific antibodies, MEM-M6/1 and MEMM6/6, binding to the N-terminal and the C-terminal Ig domain of CD147, respectively. Interestingly, when added to hBMECs before infection, MEM-M6/6 inhibited by 75% the initial attachment of Nm under flow conditions compared to cells pre-treated with anti-ICAM-1 control antibody (11C81), whereas MEM-M6/1 only reduced initial attachment by 20% (FIG. 8). Importantly, MEM-M6/1 and MEM-M6/6 both labelled CD147 expressed on hCMEC/D3 cells similarly. However only MEM-M6/1 efficiently labelled CD147 molecules accumulated at sites of bacterial adhesion, indicating that MEM-M6/6 and meningococci compete for the same binding motif on CD147. Overall, our data indicate that CD147 is a critical endothelial receptor for the primary attachment of Nm to human endothelial cells.
  • Next, we examined whether Nm could directly adhere on purified CD147-Fc molecules immobilised on glass support. Remarkably, the number of meningococci adhering to CD147-Fc was 4 to 5 fold higher than the number of bacteria adhering to ICAM-Fc or to the control condition with no immobilised protein (negative) (FIG. 9). Consistent with a role for meningococcal type IV pili in this direct interaction, wild type and pilC2 mutant strains adhere to immobilised CD147-Fc, in contrast to pilE and pilC1 mutants (FIG. 10). To identify the CD147 ‘ligand(s)’ among pilus components, we assessed the interaction between soluble CD147-Fc molecules and purified recombinant pilins produced as fusion proteins with the maltose binding protein (MBP) and immobilised on staphylococci (as described in Coureuil et al., 2010, Cell, 143:1149-1160) (FIG. 11). Interestingly, purified PilE interacted with CD147-Fc molecules. A similar interaction was observed with the minor pilin PilV, while no significant interaction was detected with the minor pilins PilX or ComP. To further analyse the relative contribution of each pilin to meningococcal adhesion to endothelial cells, infections of hCMEC/D3 cells with wild-type Nm were performed in the presence of purified pilins, to assess their ability to compete for binding to the membrane receptor (FIG. 12). Remarkably, addition of PilE or PilV reduced bacterial adhesion by 60% and 50%, respectively, whereas addition of PilX or ComP proteins had no effect (FIG. 12). Consistently, a pilV deletion mutant, which remains piliated unlike a pilE mutant, abolished bacterial adhesion to hCMEC/D3 cells (FIG. 13). Altogether, these results point to a key role for a selective interaction between PilE and PilV with CD147 in meningococcal initial adhesion to endothelial cells.
  • To assess the relevance of this finding in Nm infection in humans, the ability of live pathogenic meningococci to adhere on fresh brain sections obtained from frontal specimens of normal human brains was explored. Remarkably, bacteria predominantly established tight association with brain vessels of the leptomeninges (within Virchow-Robin spaces) and of cortical region. Importantly, this localisation, highly reminiscent of neuropathological observations in bacterial meningitis, relied on the expression of both pilins PilE and PilV. Indeed, pilE or pilV deletion mutants adhered poorly to brain sections from the same donor compared to wild type Nm (FIG. 14). Wild type bacteria formed colonies on the luminal side of meningeal and cortical brain vessels which are lined with endothelial cells expressing CD147. In addition, bacterial colonies were found in association with CD147+ leptomeningeal cells, but not with glial nor neuronal cells that do not express CD147, demonstrating that bacterial adhesion to fresh human brain tissues closely correlated with CD147 expression. Finally, pre-treatment of brain sections with MEM-M6/6 prior to infection by Nm drastically reduced brain colonisation, whereas MEM-M6/1 and 11C81 antibodies were ineffective (FIG. 15). These results, in line with our data using cultured endothelial cells, confirmed that the C-terminal domain of CD147 is essential for in situ infection of cerebral blood vessels.
  • Overall, this study demonstrates that CD147 is an essential receptor for the initial adhesion of Nm to brain and peripheral human endothelial cells by interacting directly with the pilus components PilE and PilV. Importantly, it provides the first demonstration in situ of an elective targeting of cerebral blood vessels by pathogenic meningococci, relying on specific interactions between microbial ligands and a brain receptor. Because of its key position in the pathophysiological cascade of tissue colonization by Nm, CD147 becomes a major pharmacological target to inhibit meningococcal blood-borne infection of the brain and of peripheral capillaries. The lack of animal model of meningococcal infection has hampered the understanding of meningococcal pathogenesis. N. meningitidis interacts only with cells of human origin and only adheres to human cells, thus preventing the study of the role of meningococcal cell interaction in meningococcal pathogenesis using animal models.
  • A model using severe combined immunodeficient (SCID) mouse grafted with human skin have been set up. Previous reports have shown that 4-6 weeks after engraftment the human skin graft maintained characteristics of normal human skin, including its micro-vasculature (Yan et al., 1993, J Clin Invest, 91: 986; Gilet et al., 2009, J Invest Dermatol, 129: 879. Briefly, normal human adult skin removed during plastic surgery was grafted on the back of SCID mice. One month later, mice are infected by intraperitoneal or intravenous injection of capsulated piliated meningococci. Histopathological examination revealed that N. meningitidis specifically targets draining vessels of the xenograft (but not that of normal mice skin), adhere to the endothelium and form obliterating colonies within the lumen of vessels. FIG. 16 clearly shows that in SCID mice grafted with human skin, piliated capsulated bacteria which are able to interact with cells are in much higher number in the human skin than non piliated capsulated bacteria unable to interact with human skin. This was confirmed by histological examination. Indeed non piliated bacteria were unable to adhere in vivo to the human endothelial cells of the graft. These data demonstrate that piliation is required for bacterial interaction in vivo with human cells.
  • The high level of the bacteraemia is believed to be of the utmost importance for meningococcal pathogenesis. The virulence factors known to allow the establishment of this bacteraemia are the capsule, the lipooligosaccharide, the factor H binding proteins and the iron chelation systems. These virulence factors allow the bacteria to survive in the extracellular fluids. Using the SCID mice model, we tested the hypothesis that the ability of the bacteria to interact and to multiply within the blood vessels was also participating in the establishment of the bacteraemia. As shown FIG. 17, when piliated bacteria are injected in grafted human skin mice, the bacteraemia remains much higher than when similar bacteria are injected in non-grafted mice, thus suggesting that the interaction of the bacteria with the human skin allows the establishment of the bacteraemia. The role of the type IV pili was confirmed by the fact that injection of non piliated meningococci (unable to adhere to endothelial cells) are clearing the bacteria from the bloodstream unlike what is observed with piliated bacteria. To confirm the role of this interaction in meningococcal pathogenesis, the virulence of piliated meningococci between injected grafted mice or injected non-grafted mice has been compared. As shown FIG. 18, 2 out of 3 grafted mice died whereas all non grafted mice survived.
  • Altogether these data demonstrate that the establishment of a meningococcal bacteraemia requires not only the capsule, lipooligosaccharide, factor H binding proteins and iron chelation system, but also pili which promote the interaction of the bacteria with the endothelial cells. In addition, this interaction with endothelial cells is essential for meningococcal pathogenesis (FIG. 18). These data suggest that inhibiting this interaction will prevent meningococcal infection, and that a vaccine aiming at decreasing the meningococcal cell interaction will be efficient at preventing meningococcal infection.
  • Finally, an Alphascreen test allowing to measure the interaction between pilins and CD147 ectodomain has been developped. A dose dependent interaction between CD147-Fc and both PilE and PilV, and not with the other minor pilins PilX and Comp, was detected using Alphascreen® technology, while no interaction was detected between PilE or PilV with a control protein. As expected, purified MBP-PilE-SA and MBP-PilE-SB chimera similarly interacted with CD147-Fc. Furthermore, interaction between CD147 and PilE can be successfully inhibited by the addition of the MEM-M6/6 antibody directed against the Ig proximal domain of CD147. These results suggest that the Alphascreen test can be used for the high-throughput screening of inhibitors of the interaction between type IV pilus-associated proteins and CD147.

Claims (9)

What is claimed is:
1. A method for preventing or treating a meningococcal bacteremia and/or infection in an individual in need thereof, comprising administering a therapeutically effective amount of an immunogenic PilV polypeptide comprising SEQ ID NO: 32, or a fragment thereof, or SEQ ID NO: 34, or a fragment thereof, capable of raising in the individual an immune response with antibodies that prevent the interaction between said type IV pilus-associated protein and the CD147 receptor.
2. The method according to claim 1, wherein the immunogenic PilV polypeptide comprises or consists of a) SEQ ID NO: 32, or b) a fragment of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75 consecutive amino acids of the sequence SEQ ID NO: 32, or c) a sequence that is at least 80, 85 or 90% identical to the sequence of (a) or (b).
3. The method according to claim 1, wherein the immunogenic PilV polypeptide comprises or consists of a) SEQ ID NO: 32, or b) a fragment of at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75 consecutive amino acids of the sequence SEQ ID NO: 32, or c) a sequence that is at least, 95 or 99% identical to the sequence of (a) or (b).
4. The method according to claim 1, wherein the immunogenic PilV fragment comprises or consists of a) SEQ ID NO: 34, or b) a fragment of at least 10, 15, 20, 25 consecutive amino acids of the sequence SEQ ID NO: 34, or c) a sequence that is at least 80, 85, 90% identical to the sequence of (a) or (b).
5. The method according to claim 1, wherein the immunogenic PilV fragment comprises or consists of a) SEQ ID NO: 34, or b) a fragment of at least 10, 15, 20, 25 consecutive amino acids of the sequence SEQ ID NO: 34, or c) a sequence that is at least 95 or 99% identical to the sequence of (a) or (b).
6. The method according to claim 1, further comprising administering at least one anti-bacterial compound, either sequentially or simultaneously.
7. The method according to claim 6, wherein said anti-bacterial compound is selected from the group consisting of meningococcal PilE, PilV, PilX, PilC, ComP, fHbp, PorA, NHBA, NadA, MafA, NspA, HmbR, TbpB, and AusP, or an immunogenic fragment thereof.
8. The method according to claim 6, wherein said anti-bacterial compound comprises or consists of PilE or an immunogenic fragment thereof.
9. The method according to claim 1, wherein said immunogenic PilV polypeptide is formulated in a pharmaceutically acceptable composition.
US15/990,170 2012-07-27 2018-05-25 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia Abandoned US20180340017A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US15/990,170 US20180340017A1 (en) 2012-07-27 2018-05-25 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia
US16/397,196 US20190389927A1 (en) 2012-07-27 2019-04-29 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
EP12305920 2012-07-27
EP12305920.6 2012-07-27
PCT/EP2013/064900 WO2014016152A1 (en) 2012-07-27 2013-07-15 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia
US201414405444A 2014-12-04 2014-12-04
US15/990,170 US20180340017A1 (en) 2012-07-27 2018-05-25 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US14/405,444 Division US10000545B2 (en) 2012-07-27 2013-07-15 CD147 as receptor for pilus-mediated adhesion of Meningococci to vascular endothelia
PCT/EP2013/064900 Division WO2014016152A1 (en) 2012-07-27 2013-07-15 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/397,196 Continuation US20190389927A1 (en) 2012-07-27 2019-04-29 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Publications (1)

Publication Number Publication Date
US20180340017A1 true US20180340017A1 (en) 2018-11-29

Family

ID=48875004

Family Applications (3)

Application Number Title Priority Date Filing Date
US14/405,444 Expired - Fee Related US10000545B2 (en) 2012-07-27 2013-07-15 CD147 as receptor for pilus-mediated adhesion of Meningococci to vascular endothelia
US15/990,170 Abandoned US20180340017A1 (en) 2012-07-27 2018-05-25 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia
US16/397,196 Abandoned US20190389927A1 (en) 2012-07-27 2019-04-29 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US14/405,444 Expired - Fee Related US10000545B2 (en) 2012-07-27 2013-07-15 CD147 as receptor for pilus-mediated adhesion of Meningococci to vascular endothelia

Family Applications After (1)

Application Number Title Priority Date Filing Date
US16/397,196 Abandoned US20190389927A1 (en) 2012-07-27 2019-04-29 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Country Status (8)

Country Link
US (3) US10000545B2 (en)
EP (1) EP2877492A1 (en)
JP (1) JP2015524418A (en)
CN (1) CN104736563A (en)
AU (1) AU2013295242C1 (en)
CA (1) CA2875391A1 (en)
HK (1) HK1205138A1 (en)
WO (1) WO2014016152A1 (en)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012059593A1 (en) * 2010-11-05 2012-05-10 Institut National De La Sante Et De La Recherche Medicale (Inserm) Vaccines for preventing meningococcal infections
CN104736563A (en) * 2012-07-27 2015-06-24 国家健康与医学研究院 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia
WO2017073232A1 (en) * 2015-10-29 2017-05-04 国立大学法人山口大学 Neural vascular barrier failure inhibitor and therapeutic agent for neurological disorder
WO2022032099A2 (en) * 2020-08-06 2022-02-10 Children's Hospital & Research Center At Oakland Neisserial surface protein a (nspa) variants and methods of use thereof

Family Cites Families (132)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS60240730A (en) 1984-05-15 1985-11-29 Chisso Corp Soluble imide oligomer and its production
US4622223A (en) 1984-06-21 1986-11-11 The Board Of Trustees For The Leland Stanford University Broad spectrum vaccine against gonorrhea
US7118757B1 (en) 1988-12-19 2006-10-10 Wyeth Holdings Corporation Meningococcal class 1 outer-membrane protein vaccine
AU687736B2 (en) 1992-05-11 1998-03-05 Ribozyme Pharmaceuticals, Inc. Method and reagent for inhibiting viral replication
US6479055B1 (en) 1993-06-07 2002-11-12 Trimeris, Inc. Methods for inhibition of membrane fusion-associated events, including respiratory syncytial virus transmission
US20070202127A1 (en) 1993-06-07 2007-08-30 Duke University Nucleic acids encoding DP-178 and other viral fusion inhibitor peptides useful for treating aids
US5464933A (en) 1993-06-07 1995-11-07 Duke University Synthetic peptide inhibitors of HIV transmission
US6017536A (en) 1993-06-07 2000-01-25 Trimeris, Inc. Simian immunodeficiency virus peptides with antifusogenic and antiviral activities
US6518013B1 (en) 1993-06-07 2003-02-11 Trimeris, Inc. Methods for the inhibition of epstein-barr virus transmission employing anti-viral peptides capable of abrogating viral fusion and transmission
DE4336530C1 (en) * 1993-10-26 1995-04-13 Max Planck Gesellschaft Recombinant PilC proteins, process for their preparation and their use
US6620805B1 (en) 1996-03-14 2003-09-16 Yale University Delivery of nucleic acids by porphyrins
AU2911197A (en) 1996-05-24 1998-01-05 Imperial College Of Science, Technology And Medicine Polycationic sterol derivatives as transfection agents
FR2751000B1 (en) 1996-07-12 1998-10-30 Inst Nat Sante Rech Med SPECIFIC DNA FROM NEISSERIA MENINGITIDIS BACTERIA, PROCESSES FOR OBTAINING THEM AND BIOLOGICAL APPLICATIONS
US5849902A (en) 1996-09-26 1998-12-15 Oligos Etc. Inc. Three component chimeric antisense oligonucleotides
US6001311A (en) 1997-02-05 1999-12-14 Protogene Laboratories, Inc. Apparatus for diverse chemical synthesis using two-dimensional array
US20030229040A1 (en) 1997-03-21 2003-12-11 Georgetown University Cationic liposomal delivery system and therapeutic use thereof
JP4656675B2 (en) 1997-05-14 2011-03-23 ユニバーシティー オブ ブリティッシュ コロンビア High rate encapsulation of charged therapeutic agents in lipid vesicles
ATE321882T1 (en) 1997-07-01 2006-04-15 Isis Pharmaceuticals Inc COMPOSITIONS AND METHODS FOR ADMINISTRATION OF OLIGONUCLEOTIDES VIA THE ESOPHAUS
US20030073640A1 (en) 1997-07-23 2003-04-17 Ribozyme Pharmaceuticals, Inc. Novel compositions for the delivery of negatively charged molecules
WO1999004819A1 (en) 1997-07-24 1999-02-04 Inex Pharmaceuticals Corporation Liposomal compositions for the delivery of nucleic acid catalysts
US6914131B1 (en) 1998-10-09 2005-07-05 Chiron S.R.L. Neisserial antigens
KR20010034554A (en) * 1998-03-03 2001-04-25 레이몬드, 엠. 위티 Cd147 binding molecules as therapeutics
AU3751299A (en) 1998-04-20 1999-11-08 Ribozyme Pharmaceuticals, Inc. Nucleic acid molecules with novel chemical compositions capable of modulating gene expression
KR20060118629A (en) 1998-04-29 2006-11-23 와이어쓰 홀딩스 코포레이션 Vaccines containing recombinant pilin against neisseria gonorrhoeae or neisseria meningitidis
WO2001031019A2 (en) 1999-10-29 2001-05-03 Chiron Spa Neisserial antigenic peptides
US20070026021A1 (en) 1998-05-01 2007-02-01 Chiron S.R.I. Neisseria meningitidis antigens and compositions
JP5102414B2 (en) 1998-05-01 2012-12-19 ノバルティス バクシンズ アンド ダイアグノスティックス，インコーポレーテッド Meningococcal antigens and compositions
GB9811260D0 (en) 1998-05-26 1998-07-22 Smithkline Beecham Biolog Novel compounds
EP1144998A3 (en) 1998-10-09 2002-08-07 Chiron Corporation Neisseria genomic sequences and methods of their use
FR2785293B1 (en) 1998-10-30 2002-07-05 Pasteur Merieux Serums Vacc NUCLEIC ACIDS AND POLYPEPTIDES SPECIFIC TO NEISSERIA PATHOGENIC STRAINS
US10967045B2 (en) 1998-11-02 2021-04-06 Secretary of State for Health and Social Care Multicomponent meningococcal vaccine
US20030215469A1 (en) 1998-11-02 2003-11-20 Microbiological Research Authority Multicomponent meningococcal vaccine
GB9823978D0 (en) 1998-11-02 1998-12-30 Microbiological Res Authority Multicomponent meningococcal vaccine
US7112337B2 (en) 1999-04-23 2006-09-26 Alza Corporation Liposome composition for delivery of nucleic acid
CN100392082C (en) 1999-04-30 2008-06-04 启龙股份公司 Conserved neisserial antigens
BR0010361A (en) 1999-04-30 2003-06-10 Chiron Corp Genetic sequences of neisseria and use of these
DK2270173T3 (en) 1999-05-19 2016-03-07 Glaxosmithkline Biolog Sa Neisserial combination compositions
US7098032B2 (en) 2001-01-02 2006-08-29 Mirus Bio Corporation Compositions and methods for drug delivery using pH sensitive molecules
US6750008B1 (en) 1999-07-09 2004-06-15 Trimeris, Inc. Methods and compositions for inhibition of membrane fusion-associated events, including HIV transmission
US20050037086A1 (en) 1999-11-19 2005-02-17 Zycos Inc., A Delaware Corporation Continuous-flow method for preparing microparticles
CN1416352B (en) 2000-01-17 2011-05-25 启龙股份公司 Outer membrane vesicle (OMV) vaccine comprising N. Meningitidis serogroup B outer membrane
MXPA02008314A (en) 2000-02-28 2002-12-09 Chiron Spa Heterologous expression of neisserial proteins.
JP2003535122A (en) 2000-06-02 2003-11-25 ザイコス インク． Delivery system for bioactive substances
AU2001283295A1 (en) * 2000-08-10 2002-02-25 Cytokine Pharmasciences, Inc Treatment of HIV-1 infection and inflammatory disease using cyclophilin receptor antagonists
US7427394B2 (en) 2000-10-10 2008-09-23 Massachusetts Institute Of Technology Biodegradable poly(β-amino esters) and uses thereof
GB0103424D0 (en) 2001-02-12 2001-03-28 Chiron Spa Gonococcus proteins
GB0107219D0 (en) 2001-03-22 2001-05-16 Microbiological Res Authority Immunogenic commensal neisseria sequences
WO2002076427A2 (en) 2001-03-26 2002-10-03 Thomas Jefferson University Ph sensitive liposomal drug delivery
CN1294991C (en) 2001-03-26 2007-01-17 阿尔扎公司 Liposome composition for improved intracellular delivery of therapeutic agent
US20030026831A1 (en) 2001-04-20 2003-02-06 Aparna Lakkaraju Anionic liposomes for delivery of bioactive agents
JP2004535388A (en) 2001-04-30 2004-11-25 ターゲティッド ジェネティクス コーポレイション Lipid-containing drug delivery conjugates and methods for their production
DE10127526A1 (en) 2001-05-31 2002-12-12 Novosom Ag Process for the preparation and dissolution of nano- and microcapsules
GB0114940D0 (en) 2001-06-19 2001-08-08 Chiron Spa Gene expression during meningococcus adhesion
MXPA04000653A (en) 2001-07-27 2004-11-22 Chiron Srl Meningococcus adhesins nada, app and orf 40.
GB0121591D0 (en) 2001-09-06 2001-10-24 Chiron Spa Hybrid and tandem expression of neisserial proteins
US7101995B2 (en) 2001-08-27 2006-09-05 Mirus Bio Corporation Compositions and processes using siRNA, amphipathic compounds and polycations
US7838015B2 (en) 2001-10-03 2010-11-23 Novartis Vaccines And Diagnostics, Inc. Adjuvanted meningococcus compositions
MX339524B (en) 2001-10-11 2016-05-30 Wyeth Corp Novel immunogenic compositions for the prevention and treatment of meningococcal disease.
DE10152145A1 (en) 2001-10-19 2003-05-22 Novosom Ag Stabilization of liposomes and emulsions
WO2004033620A2 (en) 2001-11-02 2004-04-22 Insert Therapeutics, Inc. Methods and compositions for therapeutic use of rna interference
GB0129007D0 (en) 2001-12-04 2002-01-23 Chiron Spa Adjuvanted antigenic meningococcal compositions
WO2003057190A1 (en) 2001-12-31 2003-07-17 Elan Pharmaceuticals, Inc. Efficient nucleic acid encapsulation into medium sized liposomes
FR2834297A1 (en) 2001-12-31 2003-07-04 Inst Nat Sante Rech Med MEANS FOR IDENTIFYING SPECIFIC GENES OF NEISSERIA MENINGITIDIS
EP1480657A4 (en) 2002-02-01 2006-07-05 Intradigm Corp Polymers for delivering peptides and small molecules i in vivo /i
US20050222064A1 (en) 2002-02-20 2005-10-06 Sirna Therapeutics, Inc. Polycationic compositions for cellular delivery of polynucleotides
US20040087024A1 (en) 2002-02-22 2004-05-06 Insert Therapeutics, Inc. Carbohydrate-modified polymers, compositions and uses related thereto
US7037520B2 (en) 2002-03-22 2006-05-02 Baylor College Of Medicine Reversible masking of liposomal complexes for targeted delivery
WO2003083443A2 (en) 2002-03-29 2003-10-09 University Of Florida Lipid mediated screening of drug candidates for identification of active compounds
DE60328383D1 (en) 2002-05-24 2009-08-27 Mirus Bio Corp COMPOSITIONS FOR THE INTRODUCTION OF NUCLEIC ACIDS IN CELLS
US7785608B2 (en) 2002-08-30 2010-08-31 Wyeth Holdings Corporation Immunogenic compositions for the prevention and treatment of meningococcal disease
GB0220194D0 (en) 2002-08-30 2002-10-09 Chiron Spa Improved vesicles
CA2501812C (en) 2002-10-11 2012-07-10 Mariagrazia Pizza Polypeptide-vaccines for broad protection against hypervirulent meningococcal lineages
ATE466875T1 (en) 2002-11-15 2010-05-15 Novartis Vaccines & Diagnostic UNEXPECTED SURFACE PROTEINS IN NEISSERIA MENINGITIDIS
GB0227346D0 (en) 2002-11-22 2002-12-31 Chiron Spa 741
CA2512917A1 (en) 2003-01-15 2004-08-05 Wyeth Holdings Corporation Methods for increasing neisseria protein expression
ES2411080T3 (en) 2003-01-30 2013-07-04 Novartis Ag Injectable vaccines against multiple serogroups of meningococci
US7682626B2 (en) 2003-02-07 2010-03-23 Roche Madison Inc. Polyvinylethers for delivery of polynucleotides to mammalian cells
ES2529736T3 (en) 2003-04-10 2015-02-25 Novartis Vaccines And Diagnostics, Inc. Immunogenic composition comprising a SARS coronavirus spicular protein
MXPA05011110A (en) 2003-04-16 2006-01-24 Wyeth Corp Novel immunogenic compositions for the prevention and treatment of meningococcal disease.
GB0315022D0 (en) 2003-06-26 2003-07-30 Chiron Srl Virulence-associated adhesins
RU2378010C2 (en) 2003-10-02 2010-01-10 Новартис Вэксинес Энд Дайэгностикс С.Р.Л. Liquid vaccines for multiple meningococcal serogroups
AR045815A1 (en) 2003-10-09 2005-11-16 Ct Ingenieria Genetica Biotech PHARMACEUTICAL COMPOSITIONS CONTAINING ANTIGENS OF THE HUMAN PAPILOMA VIRUS
CU23459A1 (en) 2003-11-19 2009-12-01 Ct Ingenieria Genetica Biotech METHOD OF SELECTIVE INSULATION OF PEPTIDES FOR THE IDENTIFICATION AND QUANTITATIVE ANALYSIS OF PROTEINS IN COMPLEX MIXTURES
EP1721283B1 (en) 2004-02-06 2022-11-30 Council of Scientific and Industrial Research Computational method for identifying adhesin and adhesin-like proteins of therapeutic potential
GB0408977D0 (en) 2004-04-22 2004-05-26 Chiron Srl Immunising against meningococcal serogroup Y using proteins
GB0409748D0 (en) 2004-04-30 2004-06-09 Chiron Srl Lactoferrin cleavage
GB0415160D0 (en) 2004-07-06 2004-08-11 Chiron Srl Inhibitors of bacterial infection
DE602005025647D1 (en) 2004-07-23 2011-02-10 Novartis Vaccines & Diagnostic POLYPEPTIDES FOR THE OLIGOMERIZATION OF ANTIGENES
GB0419408D0 (en) 2004-09-01 2004-10-06 Chiron Srl 741 chimeric polypeptides
US20090162400A1 (en) 2004-12-21 2009-06-25 Powell Thomas J Compositions of influenza viral proteins and methods of use thereof
MY157941A (en) 2005-01-19 2016-08-15 Vaxinnate Corp Compositions of pathogen-associated molecular patterns and methods of use
HUE033196T2 (en) 2005-01-27 2017-11-28 Children's Hospital & Res Center At Oakland GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis
JP2009502135A (en) 2005-07-19 2009-01-29 ザ・ボード・オブ・トラスティーズ・オブ・ザ・ユニバーシティ・オブ・イリノイ Transport factors for crossing the blood-brain barrier and into brain cancer cells and methods of use thereof
GB0524066D0 (en) 2005-11-25 2006-01-04 Chiron Srl 741 ii
WO2007066226A2 (en) 2005-12-06 2007-06-14 Universita Degli Studi Di Padova Methods and compositions relating to adhesins as adjuvants
ES2534332T3 (en) 2006-03-07 2015-04-21 Vaxinnate Corporation Compositions that include hemagglutinin, preparation methods and methods of use thereof
CN101479293A (en) 2006-06-29 2009-07-08 诺华有限公司 Polypeptides from neisseria meningitidis
AR064642A1 (en) 2006-12-22 2009-04-15 Wyeth Corp POLINUCLEOTIDE VECTOR THAT INCLUDES IT RECOMBINATING CELL THAT UNDERSTANDS THE VECTOR POLYPEPTIDE, ANTIBODY, COMPOSITION THAT UNDERSTANDS THE POLINUCLEOTIDE, VECTOR, RECOMBINATING CELL POLYPEPTIDE OR ANTIBODY, USE OF THE COMPOSITION AND A COMPOSITION AND A METHOD
US20100150912A1 (en) 2007-04-11 2010-06-17 Novartis Ag Blocking interaction between pathogen factors and factor h to inhibit hemorrhagic syndromes
CA2702871A1 (en) 2007-10-19 2009-04-23 Novartis Ag Meningococcal vaccine formulations
US20100029168A1 (en) 2007-10-26 2010-02-04 Fleming James S Toy block
WO2009073133A1 (en) 2007-11-29 2009-06-11 Vaxinnate Corporation Compositions of toll-like receptor agonists and papillomavirus antigens and uses thereof
CA2708585A1 (en) 2007-12-10 2009-06-18 Novartis Ag Analysis of mixtures including proteins
WO2009082440A2 (en) 2007-12-18 2009-07-02 Vaxinnate Corporation Compositions of toll-like receptor agonists and malaria antigens and methods of use
EP2245048B1 (en) 2008-02-21 2014-12-31 Novartis AG Meningococcal fhbp polypeptides
WO2009111337A1 (en) 2008-03-03 2009-09-11 Irm Llc Compounds and compositions as tlr activity modulators
EP2265640B1 (en) 2008-03-10 2015-11-04 Children's Hospital & Research Center at Oakland Chimeric factor h binding proteins (fhbp) containing a heterologous b domain and methods of use
WO2009128950A2 (en) 2008-04-18 2009-10-22 Vaxinnate Corporation Deletion mutants of flagellin and methods of use
GB0809659D0 (en) 2008-05-28 2008-07-02 Univ Nottingham Polypeptides
US20100105875A1 (en) 2008-06-09 2010-04-29 Maria Scarselli Antibodies against neisserial factor H binding protein
JP5781929B2 (en) 2008-07-15 2015-09-24 ノバルティス アーゲー Immunogenic amphiphilic peptide composition
WO2010017330A1 (en) 2008-08-06 2010-02-11 Novartis Ag Microparticles for use in immunogenic compositions
JP2012502296A (en) 2008-09-09 2012-01-26 デ スタート デル ネダーランデン、フェルト．ドール デ ミニスター ファン フォルクスヘーゾンドハイド、フェルジイン アン スポルト LCMS technology and use thereof
IT1394288B1 (en) 2008-09-12 2012-06-06 Novartis Vaccines & Diagnostic PROTEIN IMMUNOGENES THAT LINK THE FACTOR H.
GB0819633D0 (en) 2008-10-25 2008-12-03 Isis Innovation Composition
US20100151151A1 (en) 2008-12-11 2010-06-17 Asm Japan K.K. Method of forming low-k film having chemical resistance
CN102300585A (en) 2008-12-17 2011-12-28 诺华有限公司 Meningococcal vaccines including hemoglobin receptor
JP5806204B2 (en) 2009-03-24 2015-11-10 ノバルティス アーゲー Combination containing pneumococcal serotype 14 sugar
WO2010109323A1 (en) 2009-03-24 2010-09-30 Novartis Ag Adjuvanting meningococcal factor h binding protein
WO2010109324A1 (en) 2009-03-24 2010-09-30 Novartis Ag Combinations of meningococcal factor h binding protein and pneumococcal saccharide conjugates
US20100318782A1 (en) 2009-06-12 2010-12-16 Microsoft Corporation Secure and private backup storage and processing for trusted computing and data services
CA2772103A1 (en) 2009-08-27 2011-03-03 Novartis Ag Adjuvant comprising aluminium, oligonucleotide and polycation
AU2010288240B2 (en) 2009-08-27 2014-03-27 Novartis Ag Hybrid polypeptides including meningococcal fHBP sequences
CN102844047B (en) 2009-09-02 2017-04-05 诺华股份有限公司 Immunogenic composition containing TLR active regulators
TWI445708B (en) 2009-09-02 2014-07-21 Irm Llc Compounds and compositions as tlr activity modulators
GB0915403D0 (en) 2009-09-04 2009-10-07 London School Hygiene & Tropical Medicine Protein glycosylation
WO2011039631A2 (en) 2009-09-30 2011-04-07 Novartis Ag Expression of meningococcal fhbp polypeptides
AU2010310985B2 (en) 2009-10-27 2014-11-06 Glaxosmithkline Biologicals S.A. Modified meningococcal fHBP polypeptides
US20120070457A1 (en) 2010-09-10 2012-03-22 J. Craig Venter Institute, Inc. Polypeptides from neisseria meningitidis
WO2012059593A1 (en) * 2010-11-05 2012-05-10 Institut National De La Sante Et De La Recherche Medicale (Inserm) Vaccines for preventing meningococcal infections
WO2013113326A1 (en) 2012-01-31 2013-08-08 Curevac Gmbh Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen
CN104736563A (en) 2012-07-27 2015-06-24 国家健康与医学研究院 Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia

Also Published As

Publication number Publication date
AU2013295242A1 (en) 2015-01-15
US10000545B2 (en) 2018-06-19
EP2877492A1 (en) 2015-06-03
AU2013295242B9 (en) 2018-05-17
WO2014016152A1 (en) 2014-01-30
AU2013295242C1 (en) 2018-08-09
US20150110806A1 (en) 2015-04-23
CA2875391A1 (en) 2014-01-30
JP2015524418A (en) 2015-08-24
CN104736563A (en) 2015-06-24
US20190389927A1 (en) 2019-12-26
HK1205138A1 (en) 2015-12-11
AU2013295242B2 (en) 2018-04-05

Similar Documents

Publication Publication Date Title
US20190389927A1 (en) Cd147 as receptor for pilus-mediated adhesion of meningococci to vascular endothelia
Bernard et al. Pathogenic Neisseria meningitidis utilizes CD147 for vascular colonization
Xiao et al. RGMb is a novel binding partner for PD-L2 and its engagement with PD-L2 promotes respiratory tolerance
US8080245B2 (en) Anti-pathogen immunoadhesins
JP2020141708A (en) Mrgprx2/mrgprb2 expressing cell-based assay to detect pseudo-allergic drug reactions and to identify blockers to prevent adverse reactions
US9758573B2 (en) Methods to protect against and treat multiple sclerosis
US20130171236A1 (en) Prevention and Treatment of Ischemia-Reperfusion Injury and Related Conditions
JP2017143841A (en) Composition and method for treatment of burkholderia infection
KR102513989B1 (en) How to treat or prevent liver disease
KR20190071000A (en) Cd20-binding immunotoxins for inducing cellular internalization and methods using same
US20200397855A1 (en) Modulation of pla2-g1b in therapy
US20190315849A1 (en) Method of treating or preventing stroke
JP2021529180A (en) Compositions and methods for mediating EPS
US20190211066A1 (en) Vaccines for preventing meningococcal infections
RU2672377C1 (en) Method of treating wounds
CA2954518C (en) Compositions and methods for targeting of the surfactant protein a receptor
EP4159237A1 (en) Improved granzyme b variant
WO2023069971A2 (en) Cd24-loaded vesicles for treatment of cytokine storm and other conditions

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION