US20180327782A1 - Lentiviral vectors and uses thereof - Google Patents

Lentiviral vectors and uses thereof Download PDF

Info

Publication number
US20180327782A1
US20180327782A1 US15/935,939 US201815935939A US2018327782A1 US 20180327782 A1 US20180327782 A1 US 20180327782A1 US 201815935939 A US201815935939 A US 201815935939A US 2018327782 A1 US2018327782 A1 US 2018327782A1
Authority
US
United States
Prior art keywords
viral
vector
protein
nucleic acid
virus
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/935,939
Inventor
Wayne A. Marasco
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Dana Farber Cancer Institute Inc
Original Assignee
Dana Farber Cancer Institute Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Dana Farber Cancer Institute Inc filed Critical Dana Farber Cancer Institute Inc
Priority to US15/935,939 priority Critical patent/US20180327782A1/en
Publication of US20180327782A1 publication Critical patent/US20180327782A1/en
Assigned to DANA-FARBER CANCER INSTITUTE, INC. reassignment DANA-FARBER CANCER INSTITUTE, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: MARASCO, WAYNE A.
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1036Retroviridae, e.g. leukemia viruses
    • C07K16/1045Lentiviridae, e.g. HIV, FIV, SIV
    • C07K16/1072Regulatory proteins, e.g. tat, rev, vpt
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034Isolating an individual clone by screening libraries
    • C12N15/1037Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins
    • G01N33/6857Antibody fragments
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/035Fusion polypeptide containing a localisation/targetting motif containing a signal for targeting to the external surface of a cell, e.g. to the outer membrane of Gram negative bacteria, GPI- anchored eukaryote proteins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/60Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16045Special targeting system for viral vectors
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/30Vector systems comprising sequences for excision in presence of a recombinase, e.g. loxP or FRT
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2810/00Vectors comprising a targeting moiety
    • C12N2810/50Vectors comprising as targeting moiety peptide derived from defined protein
    • C12N2810/60Vectors comprising as targeting moiety peptide derived from defined protein from viruses
    • C12N2810/6045RNA rev transcr viruses
    • C12N2810/6054Retroviridae
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2810/00Vectors comprising a targeting moiety
    • C12N2810/50Vectors comprising as targeting moiety peptide derived from defined protein
    • C12N2810/60Vectors comprising as targeting moiety peptide derived from defined protein from viruses
    • C12N2810/6072Vectors comprising as targeting moiety peptide derived from defined protein from viruses negative strand RNA viruses
    • C12N2810/6081Vectors comprising as targeting moiety peptide derived from defined protein from viruses negative strand RNA viruses rhabdoviridae, e.g. VSV
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/001Vector systems having a special element relevant for transcription controllable enhancer/promoter combination
    • C12N2830/002Vector systems having a special element relevant for transcription controllable enhancer/promoter combination inducible enhancer/promoter combination, e.g. hypoxia, iron, transcription factor
    • C12N2830/003Vector systems having a special element relevant for transcription controllable enhancer/promoter combination inducible enhancer/promoter combination, e.g. hypoxia, iron, transcription factor tet inducible
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/48Vector systems having a special element relevant for transcription regulating transport or export of RNA, e.g. RRE, PRE, WPRE, CTE
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/50Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/60Vector systems having a special element relevant for transcription from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/20Vectors comprising a special translation-regulating system translation of more than one cistron
    • C12N2840/203Vectors comprising a special translation-regulating system translation of more than one cistron having an IRES
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2840/00Vectors comprising a special translation-regulating system
    • C12N2840/44Vectors comprising a special translation-regulating system being a specific part of the splice mechanism, e.g. donor, acceptor

Definitions

  • the invention relates to compositions that provide for the expression of a candidate polypeptide on the surface of a viral particle and/or a mammalian cell, and methods of use thereof.
  • Antibody libraries are useful to identify antibodies of interest and to screen for novel antibody-antigen complexes.
  • the Mehta I and Mehta II single chain antibody libraries contain over 27 billion non-immune human antibodies.
  • Previously, such libraries have been screened using phage display technology.
  • the adaptation of antibody presentation from phage display to mammalian display requires new vector delivery systems.
  • Vectors that have been employed to deliver exogenous nucleic acids include both DNA viral vectors and RNA viral vectors.
  • DNA vectors include pox vectors such as orthopox or avipox vectors (see, e.g., U.S. Pat. No. 5,656,465), herpes virus vectors, such as herpes simplex I Virus (HSV) vectors (See, Geller, A. I. et al., J. Neurochem. 64:487 (1995); Lim, F., et al., DNA Cloning: Mammalian Systems , D. Glover, Ed., Oxford Univ. Press, Oxford, England (1995); Geller, A. I. et al., Proc. Natl.
  • pox vectors such as orthopox or avipox vectors (see, e.g., U.S. Pat. No. 5,656,465)
  • herpes virus vectors such as herpes simplex I Virus (HSV) vectors
  • Retroviral vectors include vectors obtained from Moloney murine leukemia viruses (MMLV) and human immunodeficiency viruses (HIV) (See, U.S. Pat. No. 5,665,577).
  • a retroviral vector can be used to infect a host cell and have the genetic material integrated into that host cell with high efficiency.
  • MMLV modified Moloney murine leukemia virus
  • retrovirus does not transduce resting cells.
  • many retroviruses typically enter cells via specific receptors, if the specific receptors are not present on a cell or are not present in large enough numbers, the infection is either not possible or is inefficient.
  • Safety issues have also been raised following outbreaks of wild-type viruses from the recombinant MMLV producing cell lines, i.e., reversions.
  • a vector derived from an adenovirus can infect a wide range of cells.
  • the transferred genetic material is not integrated. Therefore, any expression or screening procedures are limited to the time when the transferred genetic material is episomal. Thus, studies can only occur for a relatively short period of time.
  • lentiviral vectors such as those based upon the primate lentiviruses, e.g., human immunodeficiency viruses (HIV) and simian immunodeficiency virus (SIV).
  • HIV human immunodeficiency viruses
  • SIV simian immunodeficiency virus
  • a pseudotyped vector i.e., one where an envelope protein from a different species is used
  • problems encountered with infecting a wide range of cell types can be overcome by selecting a particular envelope protein based upon the type of cell to be infected.
  • multivalent vectors i.e., those expressing multiple genes having a lentiviral core, such as an HIV core, are expected to more efficiently express nucleic acids of interest.
  • lentiviral vectors such as those based on primate lentiviruses, (e.g., HIV and SIV), to perform large-scale mammalian transfections offers several advantages over retroviral vectors.
  • Lentiviral vectors containing genes encoding antibodies can infect quiescent cells and proliferating cells both in vivo and in vitro. (See, Reiser et al., PNAS 93:15266-15271 (1996); Naldini et al., Science 272:263-267 (1996)).
  • lentiviral vectors allow constitutive or induced expression of heterologous polypeptides, thus providing for the production of antibodies in culture and in animal.
  • phage display libraries typically consisting of monoclonal antibodies or peptides.
  • antigen binding antibody fragments have been expressed on the surface of filamentous phage (G. P. Smith, Science 228: 1315 (1985)), and used to create large libraries of such antibodies—e.g., 10 7 members or more, referred to as phage display libraries.
  • phage display libraries the carboxyl-terminal end of the Fd or Fv region is tethered to a fragment of a phage coat protein, which anchors, for example, Fab fragment to the surface of the phage.
  • Antibody display systems have been described in non-mammalian cells, such as E.
  • compositions and methods that provide for the display of candidate polypeptides such as an antibody or fragment thereof on the surface of a mammalian cell or viral particle.
  • the methods of the invention employ a viral display vector containing a nucleic acid sequence encoding a fusion protein.
  • the fusion protein contains a leader peptide, a candidate polypeptide, a portion of an immunoglobulin molecule and a transmembrane moiety.
  • the fusion protein further contains an envelope incorporation signal, which is a polypeptide sequence that directs the expression of the candidate polypeptide to the surface (or envelope, env) of the viral particle.
  • Suitable candidate polypeptides include, but are not limited to, monoclonal antibody variable regions, single chain antibodies, domain antibodies, diabodies, or Fab antibodies.
  • the candidate polypeptide may be derived from a library, such as a human single-chain antibody library (e.g., the Mehta I or Mehta II libraries), a natural peptide library, or a random peptide library.
  • the portion of the immunoglobulin molecule contains a domain of the constant region of an Ig molecule or functional fragment thereof.
  • the immunoglobulin molecule of the invention may contain the hinge, CH2 and CH3 region of an IgG molecule
  • transmembrane moiety includes, a viral transmembrane moiety or mammalian transmembrane moiety.
  • transmembrane moiety is the lentiviral gp41, CD28, CD8 or IgM transmembrane moiety or a functional fragment thereof.
  • the fusion protein is operably linked to a constitutive promoter or an inducible promoter.
  • Constitutive promoters include CMV. SV40, or CDK9.
  • Inducible promoters include for example a tetracycline inducible promoter, an alcohol inducible promoter, a steroid inducible promoter, a metal inducible promoter, a light inducible promoter, or a temperature inducible promoter.
  • the viral display vector contains one or more additional nucleic aid sequence such as a selectable marker or toxin.
  • Selectable markers include for example as green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a member of the luciferase family, or a member of the aequorin family.
  • the viral display vector is a lentiviral vector, including, but not limited to, vectors obtained from human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
  • HCV human immunodeficiency virus
  • SIV simian immunodeficiency virus
  • EIAV equine infectious anemia virus
  • visna virus visna virus
  • CAEV caprine arthritis-encephalitis virus
  • BIV bovine immune deficiency virus
  • BLV bovine leukemia virus
  • FMV feline immunodeficiency virus
  • a candidate polypeptide is displayed on the surface of a mammalian cell by contacting a packaging cell with a viral display vector that contains a nucleic acid sequence encoding a fusion protein under conditions such that the packaging cell generates one or more viral particles containing the nucleic acid sequence encoding the fusion protein.
  • the candidate polypeptide is expressed on the surface of the viral particle.
  • the viral particles are contacted with a mammalian display cell under conditions sufficient to express the fusion protein in the mammalian cell such that it is displayed on the surface of the mammalian cell.
  • the packaging cell may further include a helper vector that contains one or more viral structural genes, e.g., gag, pol, tat, and/or rev and an envelope vector that contains an env gene, e.g., a vesicular stomatitis virus glycoprotein gene encoding a functional envelope protein that is operably linked to a promoter and a polyadenylation sequence.
  • a helper vector that contains one or more viral structural genes, e.g., gag, pol, tat, and/or rev
  • an envelope vector that contains an env gene, e.g., a vesicular stomatitis virus glycoprotein gene encoding a functional envelope protein that is operably linked to a promoter and a polyadenylation sequence.
  • Packaging cells include for example, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells.
  • Mammalian cells include for example, human B-cell lines such as Ramos Burkitt's lymphoma cells.
  • the cells are BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells.
  • Candidate polypeptides that bind to a target antigen are identified by contacting the viral particles with one or more mammalian display cells, under conditions such that the mammalian display cells each generate a single species of candidate polypeptide displayed on the surface of the cell.
  • the mammalian cells displaying the single species of candidate polypeptide on the surface of the mammalian cell are separated (i.e., sorted) from mammalian cells not expressing a candidate polypeptide.
  • the sorted mammalian cells are contacted with a target antigen to select cells that bind the target antigen.
  • the sorting and antigen binding steps are repeated one or more times.
  • the mammalian cells are contacted with a decreasing concentration of the target antigen thus enriching and affinity maturing the candidate polypeptide that binds to the target antigen.
  • the mammalian display cell may further contain a nucleic acid sequence encoding a calcium-sensitive bioluminescent protein, such as the aequorin protein from Aequoria Victoria jellyfish.
  • a calcium-sensitive bioluminescent protein such as the aequorin protein from Aequoria Victoria jellyfish.
  • the fusion protein when bound by target antigen, increases intracellular calcium, which causes the aequorin to emit light. (See Rider et al., 2003 Science 301:213-15.)
  • an immunoglobulin receptor e.g., an IgM immunoglobulin receptor.
  • a soluble candidate polypeptide is produced flanking transmembrane moiety with a loxP site and inserting a second nucleic acid sequence encoding cre recombinase operably linked to an inducible promoter into the viral display vector.
  • loxP sites include, ATAACTTCGTATAGCATACATTATACGAAGTTA (SEQ ID NO: 12), expressed as a polypeptide as ITSYSIHYTKL (SEQ ID NO: 13).
  • the invention further provides vector systems containing any of the viral display vectors of the invention; an envelope vector containing an env gene, operably linked to a promoter and a polyadenylation sequence, encoding a functional envelope protein; and a helper vector comprising one or more viral structural genes.
  • the vector system may also include a cre vector that contains a nucleic acid sequence encoding cre recombinase polypeptide operably linked to an inducible promoter.
  • the invention also provides a viral targeting vector containing a nucleic acid encoding a fusion protein that contains a leader peptide, a candidate polypeptide, a portion of an immunoglobulin molecule and a transmembrane moiety flanked by a loxP site, a nucleic acid encoding a toxin, sequence encoding cre recombinase polypeptide, a nucleic acid encoding an entry moiety.
  • An entry moiety is a viral envelope protein that has fusogenic activity.
  • the entry moiety does not have binding activity.
  • the entry moiety is a binding defective influenza hemagglutinin protein or fragment thereof, or a VSV-G protein or fragment thereof.
  • the viral targeting vector may also contain a nucleic acid sequence encoding a selectable marker.
  • FIG. 1 is a schematic representation of exemplary viral display vectors, helper vectors and envelope constructs of the invention.
  • FIG. 2 is a schematic representation of the process for selection of a candidate polypeptide using mammalian cell display of candidate polypeptides.
  • FIG. 3 is a schematic representation of the process for affinity maturation of candidate polypeptides using mammalian cell display of candidate polypeptides.
  • FIG. 4A is a schematic representation of a fusion protein of the invention containing an antibody.
  • FIG. 4B is a photographic image of a Western blot demonstrating expression of fusion proteins of the invention in 293T cells.
  • FIG. 4C is a photographic image of an SDS-PAGE demonstrating the captured antigens of a viral capture experiment using viral particles expressing an sFv on the viral capsid surface.
  • FIGS. 5A-H are a series of graphs demonstrating the detection of immunospecific binding of sFvTac-IgG1 antibodies to C8166-45 cells as measured by flow cytometry.
  • MFI indicates mean fluorescence intensity. The amount of DNA used in each experiment is indicated below the graph.
  • FIG. 6 is a bar graph demonstrating the induced expression of human single chain antibodies of the invention (sFvTac-IgG1) by doxycycline (Dox+) treatment, as compared to untreated cells (Dox ⁇ ).
  • FIG. 7 is a bar graph demonstrating that the induction of human single chain antibodies of the invention (sFvTac-IgG1) following Dox treatment is reversible by removal of the drug.
  • FIG. 8 is a schematic illustration of a lentiviral display vector containing cre recombinase and loxP sites.
  • FIG. 9 is a schematic representation showing the identification of target proteins using a functional proteomics screen of the invention.
  • FIG. 10 is a schematic representation showing the creation of a database of the invention that is useful in functional proteomics.
  • FIG. 11 is a schematic representation showing the use of paramagnetic proteoliposomes for the methods of lentiviral and/or mammalian display selection of the invention.
  • FIGS. 12A-D are a series of bar graphs demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells co-transfected with a vector expressing a candidate polypeptide and a vector expressing GFP.
  • FIGS. 13A-D are a series of bar graphs demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells transfected with a multi-functional vector containing an IRES.
  • FIGS. 14A-B are a series of bar graphs demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells detected with a C9 tag.
  • FIGS. 15A-G are a series of FACS analyses demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells detected with a C9 tag.
  • FIG. 16 is a schematic representation of exemplary fusion proteins.
  • FIGS. 17A-D are a series of bar graphs demonstrating the transfection efficiency, MFI values, and cell surface expression of fusion proteins on the surface of 293T mammalian display cells.
  • FIGS. 18A-I are a series of FACS analyses demonstrating the MFI values and cell surface expression of fusion proteins on the surface of 293T mammalian display cells stained with anti-human IgG.
  • FIGS. 19A-D are a series of bar graphs demonstrating the transfection efficiency, MFI values, and cell surface expression of fusion proteins on the surface of 293T mammalian display cells.
  • FIGS. 20A-G are a series of FACS analyses demonstrating the MFI values and cell surface expression of fusion proteins on the surface of 293T mammalian display cells stained with anti-human IgG.
  • This invention provides methods and compositions for displaying a candidate polypeptide on the surface of a viral particle (i.e. virion) or a eukaryotic cell, e.g., mammalian cell.
  • the methods and compositions of the invention employ a viral display vector containing a nucleic acid sequence encoding a fusion protein containing the candidate polypeptide.
  • the vector is introduced into a packaging cell such that the packaging cell generates one or more viral particles containing nucleic acid encoding the fusion protein and displaying the candidate polypeptide on the surface of the particle.
  • a mammalian display cell is contacted with the viral particles such that the mammalian cell expresses (i.e., transiently or stably) the fusion protein such that the candidate polypeptide is displayed on surface of the cell.
  • candidate polypeptides on the surface of a mammalian cell has a number of advantages over other expression modalities, such as E. coli , yeast, and baculoviral infection of Sf9 insect cells.
  • the candidate polypeptide produced in mammalian cells contain post-translational modifications, such as glycosylation and sulfation, that are not made in these other expression systems.
  • correct protein folding is increased in mammalian cells as compared to cells that lack chaperone proteins and other cellular components that increase correct folding.
  • the candidate polypeptides are free of bacterial, yeast or baculovirus contaminants
  • the methods of the invention are useful, for example, to screen libraries containing nucleic acids encoding polypeptides in order to identify candidate polypeptide that binds a target antigen.
  • a viral display vector of the invention is a nucleic acid vector capable of expressing, constitutively or upon induction, a fusion protein.
  • the viral display vector is a lentiviral vector.
  • Lentivirus vectors include, for example, a human immunodeficiency virus (HIV) (e.g, HIV-1 and HIV-2), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), or feline immunodeficiency virus (FIV).
  • HIV human immunodeficiency virus
  • SIV simian immunodeficiency virus
  • EIAV equine infectious anemia virus
  • CAEV caprine arthritis-encephalitis virus
  • BIV bovine immune deficiency virus
  • BLV bovine leukemia virus
  • FMV feline immunodeficiency virus
  • HIV-1 vectors have been demonstrated to stably transduce non-dividing cells in vitro (See, J. Reiser et al., Proc. Natl. Acad. Sci. USA, 93:15266-15271 (1996)) and in vivo See, L. Naldini et al., Science, 272:263-267 (1996)). Thus, these vectors are capable of long-term expression.
  • a list of suitable viruses and the cells infected thereby is provided in US Patent Application 2003/0044981, the contents of which are incorporated herein by reference in its entirety.
  • the nucleic acid sequence encoding the fusion protein is generally under the control of a regulatory element.
  • regulatory element is meant a nucleic acid sequence sufficient to direct transcription. Regulatory elements include, for example, promoters. Regulatory elements are constitutive or inducible, and may be coupled to additional sequences or “elements,” which render promoter-dependent gene expression cell-type specific, tissue-specific or inducible by external signals or agents. Such elements may be located in the 5′ or 3′ region of the native gene, or within an intron.
  • the regulatory element is operably linked to the fusion protein.
  • operably linked is meant that a coding sequence and a regulatory sequence(s) are connected in such a way as to permit gene expression when the appropriate molecules (e.g., transcriptional activator proteins) are bound to the regulatory sequence(s).
  • Suitable constitutive promoters include, e.g., SV40, CMV, CDK9, PGK, and ubiquitin C.
  • An exemplary CMV promoter sequence is GenBank Accession numbers BD015376 and BD015377.
  • An inducible promoter system includes the tetracycline repressor (tetR), wherein expression of the nucleic acid encoding the fusion proteins of the invention is dependent on the activity of an inducible transcriptional activator.
  • tetR tetracycline repressor
  • the tet expression system includes Tet-On and Tet-Off systems.
  • Tet-On transcription is active in the presence of the tetracycline (Tc) derivative doxycycline (Dox).
  • Tet-Off transcription is inactive in the presence of tetracycline or Dox.
  • a tetracycline-controlled transactivator protein which is composed of the Tet repressor DNA binding protein (TetR) from the Tc resistance operon of Escherichia coli transposon Tn10 fused to the strong transactivating domain of VP16 from Herpes simplex virus, regulates expression of a target gene that is under transcriptional control of a tetracycline-responsive promoter element (TRE).
  • the TRE is made up of Tet operator (tetO) sequence concatamers fused to a minimal promoter (commonly the minimal promoter sequence derived from the human cytomegalovirus (hCMV) immediate-early promoter).
  • tetO Tet operator
  • hCMV human cytomegalovirus
  • the Tet-On system is based on a reverse tetracycline-controlled transactivator, rtTA.
  • rtTA is a fusion protein comprised of the TetR repressor and the VP16 transactivation domain; however, a four amino acid change in the tetR DNA binding moiety alters rtTA's binding characteristics such that it can only recognize the tetO sequences in the TRE of the target transgene in the presence of the Dox effector.
  • transcription of the TRE-regulated target gene is stimulated by rtTA only in the presence of Dox.
  • the inducible promoter system is the lac repressor system from E. coli .
  • the lac repressor system functions by regulating transcription of nucleic acids having mammalian cell promoters that contain the lac operator (lacO), a nucleic acid sequence to which the lac repressor (lacR) binds, preventing transcription of the target nucleic acids regulated by the lacO-containing promoter.
  • lacO lac operator
  • lacR lacR
  • Expression of the target nucleic acids is induced by isopropyl- ⁇ -D-thiogalactopyranoside (IPTG) treatment.
  • 293T cells are transfected with a lentiviral display vector containing a nucleic acid encoding an antibody fusion protein and a nucleic acid encoding eGFP, both of which are under the control CMV promoter having a lacO, e.g., by electroporation.
  • the induction levels of antibodies is examined before and after IPTG treatment (0.5 mmol/L) by Western blot analysis or other measurement techniques known in the art.
  • inducible systems include FK506 dimer, VP16 or p65 using estradiol, RU486, diphenol murislerone, rapamycin, and the ecdysone inducible system.
  • Organ/tissue-specific promoter include, for example, the prion protein promoter or the neuron-specific enolase promoter, the CaMKII-alpha promoter, the LAP promoter, the Clara cell 10-kD protein (CC 10) promoter can be used for lung-specific expression, the Mouse mammary tumor virus long terminal repeat, the human keratin 14 (K14) promoter, the bovine keratin 6 (K6) promoter/regulatory region, the Tek or Tie promoter and the whey acidic protein (WAP) promoter or the ß-lactoglobulin promoter.
  • the prion protein promoter or the neuron-specific enolase promoter the CaMKII-alpha promoter, the LAP promoter, the Clara cell 10-kD protein (CC 10) promoter can be used for lung-specific expression, the Mouse mammary tumor virus long terminal repeat, the human keratin 14 (K14) promoter, the bovine keratin 6 (K6) promoter/regul
  • the viral display vectors of the present invention contain a selectable marker.
  • any gene encoding a gene product that allows for selection of the cell carrying the display vector can be used as the selectable marker.
  • selection systems are well known in the art and include genes that change the sensitivity of a cell to a stimulus such as a nutrient, or an antibiotic.
  • selectable markers include, but are not limited to, known genes encoding resistance to antibiotics such as the aminoglycoside antibiotics (including, e.g., neomycin, hygromycin, kanamycin, bleomycin, and G418). (See, e.g., Potrykus et al., Mol. Gen. Genet. 199:183-188 (1985).
  • selectable markers include the dihydrofolate reductase (DHFR) gene, which confers resistance to methotrexate (See, Thillet et al., J. Biol. Chem. 263:12500-12508 (1988).
  • Other selectable markers are genes that express proteins that directly or indirectly produces light, either constitutively or upon being contacted with a compound.
  • selectable markers include, green fluorescent protein, red fluorescent protein, yellow fluorescent protein, blue fluorescent protein, ferredoxin IV, LacZ, members of the luciferase family, or members of the aequorin family.
  • the selectable marker is linked to the candidate polypeptide by the use of an internal ribosome entry site (IRES) (see Marasco et al., PCT/US96/16531).
  • IRES internal ribosome entry site
  • IRES sequences are known in the art and include those from encephalomyocarditis virus (EMCV) (Ghattas, I. R. et al., Mol.
  • the lentiviral display vector may also contain additional nucleotide sequences, including a portion of the gag gene (“gag”, which allows the transduction of dividing and non-dividing cells), e.g., about 41 nucleotides at the 5′ end of the gag gene bounded by a Cla I site (see, e.g., FIG. 1 ), which has been demonstrated to contain the RNA packaging signal and is generally sufficient for gene transfer.
  • gag a portion of the gag gene
  • Cla I site see, e.g., FIG. 1
  • the lentiviral display vector may also contain a cis-acting woodchuck hepatitis virus postregulatory regulatory element (WPRE) that post-transcriptionally stimulate transgene expression; and the viral LTR sequences R and U5, which control transcription of the vector, carry the polyadenylation signal, and integrate the virus into the genome, respectively.
  • WPRE woodchuck hepatitis virus postregulatory regulatory element
  • the WPRE is particularly useful to enhance expression of fusion proteins when an inducible promoter is used.
  • the U3 region (self-inactivation) and all HIV-1 accessory genes are deleted.
  • the cPPT/CTS central polypurine track
  • the lentiviral display vector contains a nucleic acid sequence encoding an envelope protein.
  • the lentiviral display vector does not contain a nucleic acid sequence encoding an envelope protein, and protein is provided on a separate vector.
  • the viral particles are pseudotyped having a envelope protein that differs form the lentiviral capsid.
  • an env gene that encodes an envelope protein derived from the influenza virus, VSV-G, a member of the alpha viruses (Semliki forest virus, Sindbis virus), a member of the arenaviruses (lymphocytic choriomeningitis virus), a member of the flaviviruses (tick-borne encephalitis virus, Dengue virus), a member of the rhabdoviruses (vesicular stomatitis virus, rabies virus), or a member of the orthomyxoviruses (influenza virus).
  • Other envelopes are derived from Moloney Leukemia Virus such as MLV-E, MLV-A and GALV.
  • specific envelopes are selected in order to target the construct to a desired host cell or tissue, such as brain or vascular endothelium.
  • FIG. 1 An exemplary lentiviral display vector is shown in schematic form in FIG. 1 .
  • the fusion protein represented as “sFv-IgG,” is under the control of a cytomegalovirus promoter (“CMV”).
  • CMV cytomegalovirus promoter
  • a selectable marker e.g., eGFP
  • IVS internal ribosome entry site
  • the lentiviral virion is expressed by a vector system encoding the necessary viral proteins to produce a virion (viral particle).
  • the packaging cell is further transduced with one or more additional vectors encoding all the necessary viral protein to produce the viral particle.
  • Additional vectors include a helper vector containing one or more viral structural genes.
  • the pol proteins are expressed by multiple vectors.
  • this gag nucleic acid sequence is on a separate vector than at least some of the pol nucleic acid sequence, still more preferably it is on a separate vector from all the pol nucleic acid sequences that encode pol proteins.
  • gag, pol and env vector(s) do not contain nucleotides from the lentiviral genome that package lentiviral RNA, referred to as the lentiviral packaging sequence.
  • this region corresponds to the region between the 5′ major splice donor and the gag gene initiation codon (nucleotides 301-319).
  • the vector(s) forming the particle preferably do not contain a nucleic acid sequence from the lentiviral genome that expresses an envelope protein.
  • a separate vector i.e., an envelope vector that contains a nucleic acid sequence encoding an envelope protein operably linked to a promoter is used.
  • This env vector also does not contain a lentiviral packaging sequence.
  • the envelope protein is from the lentivirus from which the lentiviral display vector is derived.
  • the envelope protein is not from the lentivirus from which the lentiviral display vector is derived but is derived from a different virus.
  • the resultant viral particle is referred to as a pseudotyped particle.
  • helper construct pCMVdR8.2 contains the gag, pol, tat, and rev genes under the control of the ieCMV promoter.
  • the gag gene encodes for the viral matrix, capsid and nucleocapsid polypeptides.
  • the pol gene encodes for the viral reverse transcriptase and integrase enzymes.
  • the tat gene induces viral gene expression and protein synthesis.
  • the rev gene regulates expression of the gag, pol and env genes.
  • the envelope vector contains the G protein of vesicular stomatitis virus (“VSV-G”), operably linked to the ieCMV promoter and A n (a polyadenylation sequence).
  • VSV-G vesicular stomatitis virus
  • the immediate-early CMV (ieCMV promoter; also known as CMVie) can contain a tetracycline operator downstream of the CMV promoter's TATA element.
  • Other useful envelope proteins include those from the Moloney Leukemia Virus, such as MLV-E, MLV-A and GALV.
  • Other env polypeptides are selected depending upon the host cell. Fragments of env polypeptides that retain cellular binding properties are also provided.
  • the HIV gp160 precursor is processed to form gp120 and gp41.
  • a viral display vector an envelope vector and a helper vector into a packaging cell
  • a viral particle containing a nucleic acid encoding the fusion protein of the invention.
  • a portion (or all) of the envelope vector and/or helper vector nucleic sequences can be contained within the viral display vector.
  • Suitable packaging include any cells capable of generating a lentiviral particle.
  • Packaging cells include primary cells, embryonic stem cells and cell lines.
  • Preferred packaging cells include for example, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells.
  • Such cell lines are available, for example, from the A.T.C.C., Manassas Va.
  • a fusion protein contains a leader peptide, a candidate polypeptide, at least a portion of an immunoglobulin molecule and a transmembrane moiety.
  • the fusion protein contains an envelope incorporation signal.
  • the leader peptide, candidate polypeptide, the portion of the immunoglobulin molecule and the transmembrane moiety is operably linked.
  • operably-linked is intended to mean that the nucleotide sequences of interest are in a manner that allows for expression of the nucleotide sequence (e.g., in a host cell when the vector is introduced into the host cell).
  • nucleic acid encoding the leader peptide is operably linked to the nucleic acid encoding the candidate polypeptide that is operably linked to the nucleic acid of the transmembrane moiety.
  • fusion protein includes a polypeptide containing all or a portion of the amino acid sequences of two or more proteins.
  • protein and “polypeptide” are used interchangeably herein.
  • portion includes any region of a polypeptide, such as a fragment (proteolytically or otherwise obtained) or a domain (a region of a polypeptide having an activity, such as, e.g., enzymatic activity or antigen- or DNA-binding) that contains fewer amino acids than the full-length polypeptide.
  • a leader peptide includes a peptide that direct a newly synthesized protein in the ribosome to the Golgi complex for transport to the plasma membrane or out of the cell. (See, Nielsen et al., “Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites” Protein Engineering, vol. 10 no. 1 pp. 1-6, 1997).
  • Leader polypeptides are also known as signal peptides or signal polypeptides.
  • Leader peptides generally include a string of hydrophobic amino acids.
  • Leader peptides include an immunoglobulin leader sequence, polyhistidine or polyvaline sequences, as well as others known to those skilled in the art. Exemplary leader peptides are provided in Table 1.
  • Leader peptides include peptides having three regions: an n-region, which is a positively charged region at the N-terminus of the signal peptide (the “left end” of the sequence); an h-region having a hydrophobic core, optionally in the middle of the signal peptide; and a c-region, a generally polar region at the C-terminus of the leader sequence with generally small and neutral amino acids at position ⁇ 1 and ⁇ 3.
  • Leader peptides of the invention include peptides capable of being acted upon by signal peptidase, a specific protease located on the cisternal face of the endoplasmic reticulum. Leader polypeptides of the present invention also include polypeptides identified using the SIGFIND program, which predicts signal peptides at the start of protein sequences and searches open reading frames with a potential signal peptide coded in nucleotide sequences. (See, “Finding Signal Peptides in Human Protein Sequences using Recurrent Neural Networks” (2002) Reczko et al., In R. Guigo and D. Gusfield (eds.): Algorithms in Bioinformatics, Proceedings of the 2nd Int. Workshop WABI 2002, Rome, Italy, September 16-21, Lecture Notes in Computer Science, Springer, Volume 2452, pp. 60-67).
  • the SIGFIND program provides a score (the sig.pep score, which ranges from 0 (no signal peptide) to 9 (maximum score for presence of a signal peptide)) along the sequence that indicates the location and size of the signal peptide. Generally, a decrease in the sig.pep score from higher to lower indicates the approximate position of the signal peptide cleavage site.
  • Ig-kappa chain leader sequence Met-Glu-Thr-Asp-Thr-Leu-Leu-Leu-Trp-Val-Leu- Leu-Leu-Trp-Val-ProGlySerThrGlyAsp (SEQ ID NO: 2)
  • Bacteriophage T7 gene 10 leader protein Met-Ala-Ser-Met-Thr-Gly-Gly-Gln-Gln- Met-Gly (SEQ ID NO: 3) Tandem polyvaline heptad repeats: (Val-Val-Val-Val-Val) n (SEQ ID NO: 4)
  • Preproalbumin Met-Lys-Trp-Val-Thr-Phe-Leu-Leu-Leu-Leu-Phe-Ile-Ser-Gly-Ser-Ala- Phe-Ser (SEQ ID NO: 5)
  • Pre-IgG light chain Met-Asp-Met-Arg-Ala-Pro-Ala-Gln-Ile
  • a candidate polypeptide is any polypeptide or fragment thereof in which expression on the surface of a viral capsid or mammalian cell is desired.
  • a candidate polypeptide is a native a cell surface polypeptide.
  • a candidate polypeptide is not a native cell surface polypeptide.
  • the candidate polypeptide is an antibody or fragment thereof, a toxin, a hormone, a growth factor, a receptor, or a signaling molecule.
  • antibody or “function fragment thereof” refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • immunoglobulin (Ig) molecules i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
  • Such antibodies include, polyclonal, monoclonal, chimeric, single chain, F ab , F ab′ and F (ab′)2 fragments, and an F ab expression library.
  • bind or “immunoreacts with” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react (i.e., bind) with other polypeptides or binds at much lower affinity (K d >10 ⁇ 6 ) with other polypeptides.
  • immunological binding refers to the non-covalent interactions of the type that occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific.
  • the strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (K d ) of the interaction, wherein a smaller K d represents a greater affinity.
  • Immunological binding properties of selected polypeptides are quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions.
  • both the “on rate constant” (K on ) and the “off rate constant” (K off ) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)).
  • the ratio of K off /K on enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant K d . (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
  • the candidate polypeptide can be obtained from a library.
  • Preferred libraries include human single-chain antibody libraries, natural peptide libraries, and random peptide libraries.
  • Exemplary libraries include the Mehta I and Mehta II phage display libraries. (See, Gennari et al., J. Mol. Biol. 335(1):193-207 (2004)).
  • the Mehta I library contains 15 billion sFv inserts; the Mehta II library contains 12 billion sFv inserts.
  • Natural peptide libraries are known in the art. (See, Matthews et al., J. Immunol. 169(2): 837-46 (2002)).
  • a natural peptide library contains peptides from about 25 to about 200 amino acids in length, as this size peptide has been demonstrated to represent native epitopes.
  • Random peptide libraries are known in the art and are available from BD Biosciences (San Jose, Calif.), New England Biolabs (Beverly, Mass.) and other commercial sources.
  • Library inserts can be amplified and ligated into the viral display vectors of the invention. Alternatively, the inserts can be excised from the host library and ligated into the viral display vectors.
  • the fusion polypeptide further includes at least a region of a an immunoglobulin polypeptide.
  • “At least a region” is meant to include any portion of an immunoglobulin molecule, such as the light chain, heavy chain, F, region, hinge region, CH1 region, CH2 region, CH3 region Fab region, Fv region or any fragment or combination thereof.
  • the immunoglobulin polypeptide contains the hinge region, the CH2 region and CH3 region of an IgG molecule (e.g., IgG1).
  • a transmembrane moiety is a plurality of amino acids that is capable of extending across a biological membrane of a cell, such as the plasma membrane or a membrane of an organelle.
  • a transmembrane moiety is a polypeptide capable of inserting into and remaining anchored within the viral capsid surface and/or the plasma membrane of a mammalian cell.
  • the transmembrane moiety is capable of localizing the fusion protein to the viral capsid surface and/or to the plasma membrane of a mammalian cell.
  • the transmembrane moiety is a viral transmembrane moiety, such as a lentiviral transmembrane moiety.
  • Lentiviral transmembrane moieties include for example envelope polypeptide from HIV, SIV, CAEV, BIV, BLV, and FIV or a functional fragments thereof.
  • the HIV-1 gp160 envelope polypeptide is a polypeptide of about 856 amino acids (See Table 2; SEQ ID NO:1 and GenBank Accession numbers AAO40783, AAA76671, BAA12995, and P03377) that is proteolytically processed into a gp120 and a gp41 polypeptide.
  • the amino acid sequence of an HIV-1 gp160 envelope polypeptide is provided as SEQ ID NO:1 in Table 2.
  • the gp41 polypeptide includes amino acids 512-856 of SEQ ID NO: 1 (See also, GenBank Accession No.: NP_057856).
  • the transmembrane moiety of gp41 is generally located between about amino acids 675-715 of the gp160 polypeptide.
  • Additional, lentiviral envelope proteins are provided by GenBank Accession numbers AAT41729 from SIV, P31627 from CAEV, P19557 from BIV, P03380 from BLV, and NP_040976 envelope from FIV.
  • the transmembrane moiety is a mammalian transmembrane moiety, such as CD28, CD8, or IgM transmembrane moiety or functional fragment.
  • a “functional fragment” of a transmembrane moiety includes any portion or fragment of a transmembrane moiety that is sufficient to localize the fusion protein to the surface of the viral particle and/or to the mammalian cell plasma membrane.
  • a transmembrane domain includes the amino acid sequence NRVRQGYS (SEQ ID NO: 14) or GGTETSQVAPA (SEQ ID NO: 15).
  • transmembrane moieties have positively charged amino acids (such as lysine and arginine) at their ends and uncharged amino acids in the center.
  • Transmembrane proteins are capable of having an N-terminal signal sequence that targets these polypeptides to the endoplasmic reticulum.
  • Transmembrane moieties include polypeptide sequences having one or more alpha-helical structures. Usually, an alpha-helical transmembrane domain of 25 or more amino acids in length is sufficient to span the plasma membrane.
  • the transmembrane moiety may include a polypeptide having one or more beta-barrel structures.
  • transmembrane moiety includes the transmembrane domain from gylcophorin A (Val-Gln-Leu-Ala-His-His-Phe-Ser-Glu-Pro-Glu-Ile-Thr-Leu-Ile-Ile-Phe-Gly-Val-Met-Ala-Gly-Val-Ile-Gly-Thr-Ile-Leu-Leu-Ile-Ser-Tyr-Gly-Ile; SEQ ID NO: 10).
  • transmembrane domains include polypeptide sequences having two or more ⁇ -sheets.
  • Transmembrane moieties include polypeptides provided in the TMbase of transmembrane proteins and their membrane-spanning domains. (See, K. Hofmann & W. Stoffel (1993), TMbase—A database of membrane spanning proteins segments. Biol. Chem. Hoppe-Seyler 374,166.)
  • the TMbase database contains information from SwissProt and other database sources.
  • Transmembrane moieties of the present invention include polypeptides identified using the TMpred program, which makes a prediction of membrane-spanning regions and their orientation using an algorithm based on the statistical analysis of the TMbase database of naturally occurring transmembrane proteins.
  • Other programs capable of determining transmembrane domains in a polypeptide include GREASE, TMHMM, and TMAP.
  • the viral display vector containing the nucleic acid encoding the fusion protein is introduced into a packaging cell.
  • transduction sometimes also known as transfection or infection.
  • the display vector is introduced by transfection in combination with one or more unlinked vectors, but one of skill in the art will appreciate that the methods of the invention can employ the use of other methods of introducing a nucleic acid vector into a recipient cell, including, but not limited to, microinjection.
  • Preferred transfection means are calcium phosphate, FUGENE 6TM (Roche Diagnostics, Indianapolis, Ind.), and POLYFECTTM (Qiagen, Valencia, Calif.).
  • the packaging cell is further transfected with a one, an envelope vector and a helper vector.
  • the ratio of display vector:envelope vector:helper vector is about 2:1:2.
  • the ratio of display vector:envelope vector:helper vector is about 1:2:1.
  • the packaging cell Following the introduction of the vector(s) into the packaging cell, the packaging cell generates one or more viral particles containing a nucleic acid encoding the fusion protein and the candidate polypeptide on the viral capsid.
  • the viral particles produced by the packaging cells are purified and/or concentrated by any means known to those skilled in the art.
  • viral particles expressing a nucleic acid encoding a selectable marker e.g., eGFP
  • FACS fluorescence assisted cell sorting
  • the viral particles are collected by filtration (e.g., filtration through a 0.45 ⁇ m and/or 0.22 ⁇ m filter) and pelleted by centrifugation at 100,000 ⁇ g).
  • Viral particles having a candidate polypeptide or fragment thereof expressed on their surface can be used to identify those candidate polypeptides that bind to an antigen of interest (e.g., a “target antigen”).
  • an antigen of interest e.g., a “target antigen”.
  • One or more viral particles, containing the fusion protein of the invention are contacted with a target antigen that has been tagged (e.g., a fluorescent tag such as FITC is attached chemically to the antigen).
  • the viral particles are provided in solution.
  • the viral particles are attached to a solid support.
  • a solid support includes for example, a chip, a bead, paper or polystyrene
  • the tagged target antigen contacts and binds the candidate polypeptide, and viral particles having a candidate polypeptide to which the target antigen has bound are selected by FACS or other suitable means known to those skilled in the art.
  • the nucleic acid sequence encoding the candidate polypeptide may be sequenced, either directly or following amplification. In this way, the candidate polypeptide that binds to the target antigen can be identified.
  • the invention also provides methods for the display of a candidate polypeptide on the surface of mammalian cells, which is useful, for example, to screen libraries containing polypeptides, antibodies or antibody fragments. It has recently been recognized that post-translational modifications such as N-linked and O-linked glycosylation, and sulfation. of polypeptides, e.g., antibodies play an important structural role. Thus, polypeptides produced by the methods of the invention will contain these post-translational modifications, while polypeptides produced in bacteria (e.g., using the method of phage display) will lack these post-translational modifications.
  • Candidate polypeptides are displayed on the surface of a mammalian cell by transfecting a packaging cell with the viral display vector containing the nucleic acid encoding the fusion protein as described above.
  • the nucleic acid encoding the fusion protein is expressed such that the candidate polypeptide is displayed on the surface of the viral capsid.
  • expression of the fusion protein on the surface of the viral capsid is not necessary in order to achieve expression of the fusion protein on the surface of the mammalian cell.
  • Viral particles produced by the packaging cell are then contacted with a mammalian display cell, such that the mammalian display cell is infected by the viral particle.
  • the viral particles are contacted with the mammalian cells at a multiplicity of infection (MOI) that will provide on average only 0-1 integrations per cell.
  • MOI multiplicity of infection
  • the viral particles are contacted with the mammalian cells at a multiplicity of infection of about 1.
  • the viral vector is stably integrated into the mammalian cell.
  • the integration is transient. The presence of the transmembrane moiety of the fusion polypeptide targets the expressed fusion protein to the surface of the mammalian cell such that the candidate polypeptide is displayed on the plasma membrane.
  • each mammalian cell will have a contain a unique nucleic acid encoding the fusion protein and thus a unique a candidate polypeptide on its surface.
  • an antibody library used e.g., one or both of the Mehta libraries
  • Exemplary mammalian display cells include, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells), and CEMX174 cell lines.
  • Another exemplary mammalian display cells include the M12g3R (IgM+) B cell line. (See Rider et al., 2003 Science 301:213-15.)
  • the mammalian display cell is a cell line that is capable of constitutively mutating nucleic acids that are either stably or transiently transfected into the cell. (Cumbers et al., Nature Biotech 20:1129, (2002); and see editorial review form Presta, Nature Biotech. 20:1096(2002)).
  • the mammalian display cell is a Ramos Burkitt's lymphoma cell line, BL-2 cells, CL-01 cells (Martin et al., Nature 415:802, 2002) or chicken DT40 B-cell lymphoma cells (Sale et al., Nature 412:921, 2001).
  • the mammalian cell to modified to overexpress activation-induced cytosine deaminase (AID) protein (Muramatsu, 2000; Di Noia, 2002; Petersen-Mahrt, 2002; Yoshikawa, 2002 and Gearhart, 2002 for brief editorial review), DNA polymerase iota (Faili, 2002) or other members of the family of TLS polymerases that are components of the immunoglobulin mutasome.
  • the AID protein is required for the maturation of antibodies in mammals and other higher vertebrates, where it promotes somatic hypermutation (SHM), class switch recombination and gene conversion.
  • SHM somatic hypermutation
  • Mutation of the fusion polypeptide by the mammalian display cell results in a candidate polypeptide that has altered, increased or decreased, binding affinity an/or specificity for a target antigen of interest.
  • mutation mimics the hypermutaton process of antibodies.
  • the mammalian cells expressing a candidate polypeptide are separated (i.e. sorted) form the mammalian cell not expressing a candidate polypeptide.
  • Sorting of infected mammalian cells allows uninfected cells to be removed from the population, which, in turn, reduces the incidence of non-specific binding interactions with labeled antigens.
  • sorting the cells recapitulates for example, the affinity maturation process of B cells during the in vivo immune response.
  • Infected mammalian cells are sorted by detecting a selectable marker such as eGFP.
  • infected mammalian cells are sorted by identifying cells that bind an antigen.
  • the cells are contacted with a labeled target antigen at a given concentration.
  • the a labeled target antigen is combined with the mammalian cells in solution or on solid support.
  • Solid supports include for example, a chip, bead, paper, plastic or other solid or semi-solid means.
  • FACS or other suitable selection means is used to identify the complex between bound antigen and candidate polypeptide to separate the bound complex from unbound tagged target antigens and unbound mammalian cells.
  • column chromatography is used to separate mammalian cells presenting candidate polypeptide or antibody bound to tagged antigen.
  • the antigen is bound to beads (e.g., cellulose or sepharose beads) in a chromatography column and a solution containing the mammalian cells is applied to the column. Unbound mammalian cells are removed from the column by one or more washing steps. The bound mammalian cells are then eluted from the column, such as with a high or low pH solution, a detergent solution, a high salt solution, or with chaotropic agents (e.g., urea and/or guanidine).
  • beads e.g., cellulose or sepharose beads
  • Unbound mammalian cells are removed from the column by one or more washing steps.
  • the bound mammalian cells are then eluted from the column, such as with a high or low pH solution, a detergent solution, a high salt solution, or with chaotropic agents (e.g., urea and/
  • the mammalian cells are sorted by both selectable marker expression and antigen binding.
  • the infected mammalian cells are expanded in culture between sorting steps.
  • the expansion may be clonal or non-clonal in nature.
  • the amount of antigen used in the subsequent sorting steps is reduced.
  • the concentration of target antigen is reduced by 25%, 50%, 75%, 90%, 95%, 99%, 99.9%, 99.99% or 99.999%.
  • the methods of the invention are used to identify candidate polypeptides that bind to the target antigen with higher specificity and affinity compared to the mean affinity of the candidate polypeptide prior to affinity selection process.
  • the nucleic acid sequence encoding the selected candidate polypeptide is determined.
  • the population of selected mammalian cells are lysed, such as with a detergent, and the nucleic acids encoding the candidate polypeptide are amplified by PCR and cloned into a suitable vector.
  • the amplified inserts are cloned into the lentiviral display vector and used to produce new virus particles, as described above. These particles can be used to infect additional mammalian cells, and the candidate polypeptide display method can be repeated one or more times.
  • the methods of the invention also allow for the production a soluble candidate polypeptide.
  • Soluble candidate polypeptides are generated by excising the nucleic acid molecule encoding the transmembrane domain of the fusion protein following expression of the fusion protein on the surface of the viral particle or the mammalian cell.
  • these methods are useful for the localization of an antibody-producing cell to a target cell or tissue using the membrane anchored antibody, followed by delivery of a soluble antibody in vivo to specific cell type or tissue, such as a cancer cell.
  • This soluble antibody may be cytotoxic, cytostatic, or induce apoptosis.
  • a viral display vector described above may additionally contain two or more signal sites (or signal sequences), e.g., loxP sites, recognized by the Cre recombinase.
  • the Cre-lox reaction functions as follows.
  • P1 bacteriophage cyclization recombination (Cre) recombinase recognizes a pair of loxP binding sites flanking a nucleic acid molecule of interest.
  • the loxP sites can flank the nucleic acid sequence encoding the transmembrane moiety of the fusion protein.
  • nucleic acid sequences encoding one or more amino acids flanking the transmembrane moiety are provided. Spacer amino acids facilitate proper folding of the fusion protein.
  • LoxP sites are 34 bp long and are composed of an 8 bp core, which determines directionality, flanked by 13 bp of palindromic (complementary) sequences. Sequences flanked by loxP sites are said to be “floxed”. Cre enzyme brings together the two loxP sites, which carry complementary sequences. Depending on the orientation of the paired loxP sites, different results may be achieved. In the cre-lox system, nucleic acid sequences between two signal sites are deleted or inverted if the signal sites are on the same nucleic acid molecule. The intervening DNA may be excised or circularized, inverted or translocated.
  • the viral display vector also contains a nucleic acid sequence encoding cre recombinase.
  • Cre expression can driven by an inducible promoter such as tetracycline/doxycycline.
  • loxP sites flank the nucleic acid sequence encoding cre recombinase in addition to flanking the transmembrane moiety of the fusion protein.
  • the nucleic acid sequence encoding cre recombinase is positioned upstream (in a 5′ direction) or downstream (in a 3′ direction) relative to the loxP sites.
  • the ability to induce cre recombinase expression provides the ability to produce soluble antibodies.
  • the nucleic acid sequence encoding cre recombinase can be situated in a different vector, or has been stably integrated into the genome of the host cell.
  • a viral display vector described above may additionally contain two or more recombination targets (FRTs), recognized by the FLP recombinase.
  • FRTs recombination targets
  • two FRTs flank the nucleic acid sequence encoding the transmembrane moiety of the fusion protein.
  • a modified FLP recombinase with increased recombinase activity has also been described (See, Bucholz et al., Nature Biotech. 16, 657-662 (1998)).
  • a suitable FRT sequence is: GAAGTTCCTATACTTTCTAGAGAATAGGAACTTCGGAATAGGAACTTA (SEQ ID NO: 11).
  • the FLP recombinase bind the FRTs, resulting in excision of the nucleic acid sequence encoding the transmembrane moiety and the production of a soluble antibody.
  • a mammalian display cell that expresses an antibody that binds immunospecifically to a tumor specific antigen (TSA) on the surface of a cancer cell is identified using the mammalian cell antibody display methods of the invention.
  • the antibody-producing mammalian cell is provided to a mammalian subject (e.g., a human subject having cancer or otherwise in need thereof), and the antibody on the surface of the mammalian cell homes in to the tumor antigen and binds specifically thereto. Detection and localization of the antibody producing cell is determined by the detection of expression of the detectable protein moiety.
  • the antibody producing mammalian cell is co-localized with (and bound to) the cell displaying the tumor antigen, expression of the cre recombinase is induced (such as with chemical means, light, oxygen, or other inductive means) such that the recombinase removes the nucleic acid encoding the transmembrane moiety of the fusion protein.
  • the fusion protein will be directed into the ER by the leader peptide and secreted outside the cell as a soluble antibody. These secreted soluble antibodies will then act locally upon the target tumor cell.
  • the antibody producing mammalian display cell also contains a nucleic acid encoding a toxin, which is also produced by the mammalian display cell. This toxin may be operably linked to the soluble antibody.
  • a viral display vector (outlined in FIG. 1 ) is constructed as follows. A nucleic acid molecule encoding a fusion protein is created by amplification of one or more candidate polypeptide-encoding inserts from a Mehta I/II library.
  • Exemplary sFv inserts include “PS11”, which is an sFv that binds immunospecifically to the TRM motif on human cyclinT 1; “E46”, which is an sFv that binds immunospecifically to the arginine-rich region of HIV-1 tat protein; “A8”, which is an sFv that binds immunospecifically to the N-terminus of CCR5; and “anti-Tac”, which is an sFv that binds immunospecifically to CD25 (the alpha chain of IL-2R).
  • inserts are ligated downstream of a nucleic acid sequence encoding an immunoglobulin leader protein and upstream of a nucleic acid sequence encoding an immunoglobulin molecule containing the hinge, CH2, and CH3 regions of human IgG1, such that, when the expressed nucleic acids are translated, the candidate polypeptide is operably connected to the leader polypeptide and the immunoglobulin molecule.
  • Expression of the nucleic acid molecule is controlled by a CMV promoter.
  • Downstream of the nucleic acid encoding the immunoglobulin molecule is a nucleic acid sequence encoding the transmembrane moiety from gp41.
  • a nucleic acid molecule encoding enhanced green fluorescent protein (eGFP) is provided downstream of an IRES that is controlled by the CMV promoter.
  • Protein expression analysis of the viral display vectors is performed by transiently transfecting 293T cells using transfection means known to those skilled in the art, such as POLYFECTTM transfection reagent, then performing Western blot analysis using an antibody specific for gp41. As shown in FIG. 4B , the fusion proteins of the invention are expressed in transiently transfected 293T cells.
  • Lane 1 shows mock transfected cells (no DNA added); lane 2 shows expression of a fusion protein containing the PS11 sFv; lane 3 shows expression of a fusion protein containing the PS11 sFv, wherein the gp41 transmembrane moiety is flanked on either end by a loxP sequence; lane 4 shows expression of a fusion protein containing the E46 sFv; and lane 5 shows expression of a fusion protein containing the E46 sFv, wherein the gp41 transmembrane moiety is flanked on either end by a loxP sequence.
  • the localization of the fusion proteins to the plasma membrane is confirmed using FACS analysis.
  • FACS analysis For example, goat-anti-human IgG ( ⁇ -chain specific) PE conjugate is useful to detect the cell surface expression of the sFv-IgG-gp41 fusion proteins. Results of a typical FACS analysis are provided in Table 3.
  • FACS analysis using fluorescently labeled antigens confirms that the fusion proteins expressed on the cell surface are capable of binding immunospecifically to target antigen.
  • biotinylated TRM peptide (2 mM, MW 4146.7, combined with Extravidin PE (Sigma E-4011)), was used in FACS experiments, the results of which are shown in Table 4. These results demonstrated that the PS11-containing fusion protein expressed on the surface of 293T cells is capable of binding to its target antigen.
  • the helper vector pCMV ⁇ R8.2 and an envelope vector are also shown in FIG. 1 .
  • the helper vector contains the gag, pol, tat and rev genes under the control of an ieCMV promoter.
  • the envelope vector contains the G protein of vesicular stomatitis virus (“VSV-G”), operably linked to the ieCMV promoter and A n (a polyadenylation sequence).
  • VSV-G vesicular stomatitis virus
  • viral particle supernatant is concentrated by centrifugation at 17,000 rpm in an SW28 rotor for 2 h.
  • the pellet is resuspended in 1/10 volume media.
  • Viral particles are sorted by fluorescence assisted cell sorting (FACS) by detecting the eGFP.
  • the multiplicity of infection (moi) is determined by infecting 293T cells, followed by flow cytometric quantification of eGFP-positive cells.
  • Incorporation of the fusion protein into viral particles is measured using Western analysis.
  • Viral stocks are concentrated by centrifugation and contacted with SDS-PAGE loading buffer, then separated by PAGE, transferred to membranes and blotted with anti-gp41 or anti-human IgG.
  • the master viral stock is contacted with a suspension of mammalian display cells overnight at an MOI of about 1.
  • the mammalian cells are sorted by FACS on the basis of binding to an anti-Fc antibody or, alternatively, eGFP content.
  • the sorted mammalian cells are contacted with target antigens that have been tagged. Suitable tags include FITC, streptavidin/biotin, and paramagnetic beads (See FIG. 11 ).
  • the sorted mammalian cells having bound antigen are then selected. Following selection, the population of selected cells is expanded in culture for subsequent rounds of selection.
  • the cells were co-transfected with two vectors, a vector expressing a fusion protein containing a candidate polypeptide of the invention, and a vector expressing GFP under the control of a CMV promoter, as shown in Table 6, using lipofectamine. About 48 hours after transfection, the transfected cells were harvested with 0.5 mM EDTA.
  • Sample 1 contains untransfected cells.
  • Sample 2 contains the pCDNA vector with no insert.
  • Sample 3 contains pCDNA3-CMV-PS11-Fc-gp41 without the C9 tag.
  • Sample 4 contains a GFP control insert.
  • Sample 5 contains a part of the lentiviral gp41 transmembrane region (corresponding to amino acids 1-50 of the TM region).
  • Sample 6 contains the human CD8 transmembrane region.
  • Sample 7 contains a full-length lentiviral gp41 transmembrane region.
  • Sample 8 contains the human CD28 transmembrane region.
  • Sample 5 contains the pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-ZsGreen, where the IRES sequence was obtained from the IRES sequence originated from the HA-ZsGreens vector.
  • the transmembrane region is the full length lentiviral gp41 transmembrane domain.
  • One method of affinity maturation involves the use of display cell lines that have a higher rate of mutation.
  • An example of a mutation prone cell line is a lymphoma cell line, e.g., the Ramos Burkitt's lymphoma cell line.
  • Mammalian cells expressing antibodies from mutated fusion proteins having increased affinity for the target antigen are selected using the display affinity selection methods described above in Example 4.
  • the viral display vector generated in Example 1 is modified by insertion of a tetR inducible element. Two tetO sequence concatamers are fused to the CMV minimal promoter. A tetR sequence is inserted downstream of the nucleic acid encoding the fusion protein of the invention. Thus, production of the fusion protein is regulated by addition of tetracycline.
  • a typical antibody cell surface expression quantitation was performed as follows. 293T cells were seeded about 24 hours before transfection on 6 well plates (1 ⁇ 10 6 cells per well). Viral display vector DNA (4 ug) was transfected using Lipofectamine 2000TM. About 48 hours after transfection, cells were harvested for FACS analysis, using 0.5 mM EDTA. For antibody detection, a primary ⁇ -C9 antibody (ID4) was used at a concentration of 2 ⁇ l per 1 ⁇ 10 5 cells and a secondary ⁇ -mouse IgG-FITC labeled antibody was used at a 1:50 dilution. FACS analysis was performed as described above and known in the art. Results of this analysis are shown in FIGS. 14 and 15 . FIG.
  • Viral display constructs (listed in Table 10) containing either truncated (amino acids 1-50) or full-length gp41 TM, CD8 TM or CD28 TM, were introduced into the pSIN lentiviral display vector to confirm the expression of the fusion proteins on the surface of mammalian cells.
  • the lentiviral vectors contain a form of GFP, ZsGreen, to aid in detection, and were transfected into 293T cells as described above. Results are shown in FIGS. 19 and 20 , and demonstrate that the viral display constructs contained in lentiviral vectors are efficiently expressed in 293T cells and result in cell surface expression of the fusion proteins.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Virology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • Plant Pathology (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Oncology (AREA)
  • AIDS & HIV (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Investigating Or Analysing Biological Materials (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The invention relates to compositions containing polynucleotide vectors capable of expressing a nucleic acid encoding a fusion polypeptide on the surface of a viral particle and/or a eukaryotic cell.

Description

    RELATED APPLICATION
  • This application is a continuation of U.S. patent application Ser. No. 11/135,235, filed May 23, 2005, which claims the benefit of and priority to U.S. Provisional Patent Application No. 60/589,610, filed Jul. 21, 2004, which is incorporated herein by reference in its entirety.
  • STATEMENT OF GOVERNMENT SUPPORT
  • This invention was made with U.S. Government support under ______ grant ______. The government has certain rights in the invention.
  • FIELD OF THE INVENTION
  • The invention relates to compositions that provide for the expression of a candidate polypeptide on the surface of a viral particle and/or a mammalian cell, and methods of use thereof.
  • BACKGROUND OF THE INVENTION
  • Antibody libraries are useful to identify antibodies of interest and to screen for novel antibody-antigen complexes. For example, the Mehta I and Mehta II single chain antibody libraries contain over 27 billion non-immune human antibodies. Previously, such libraries have been screened using phage display technology. The adaptation of antibody presentation from phage display to mammalian display requires new vector delivery systems.
  • Vectors that have been employed to deliver exogenous nucleic acids include both DNA viral vectors and RNA viral vectors. For example, DNA vectors include pox vectors such as orthopox or avipox vectors (see, e.g., U.S. Pat. No. 5,656,465), herpes virus vectors, such as herpes simplex I Virus (HSV) vectors (See, Geller, A. I. et al., J. Neurochem. 64:487 (1995); Lim, F., et al., DNA Cloning: Mammalian Systems, D. Glover, Ed., Oxford Univ. Press, Oxford, England (1995); Geller, A. I. et al., Proc. Natl. Acad. Sci., U.S. A. 90:7603 (1993); Adenovirus vectors (Legal Lasalle et al., Sci. 259-988 (1993); Davidson et al., Nat. Genet. 3:219 (1993); Yang et al., J. Virol., 69:2004 (1995)); and Adeno Associated Virus Vectors (See, Kaplitt, M. G., et al., Nat. Genet. 8; 148 (1994)). Retroviral vectors include vectors obtained from Moloney murine leukemia viruses (MMLV) and human immunodeficiency viruses (HIV) (See, U.S. Pat. No. 5,665,577).
  • Various vectors have characteristics that make them desirable for certain applications. For example, a retroviral vector can be used to infect a host cell and have the genetic material integrated into that host cell with high efficiency. One example of such a vector is a modified Moloney murine leukemia virus (MMLV), which has had its packaging sequences deleted in order to prevent packaging of the entire retroviral genome. However, that retrovirus does not transduce resting cells. Additionally, since many retroviruses typically enter cells via specific receptors, if the specific receptors are not present on a cell or are not present in large enough numbers, the infection is either not possible or is inefficient. Safety issues have also been raised following outbreaks of wild-type viruses from the recombinant MMLV producing cell lines, i.e., reversions.
  • A vector derived from an adenovirus can infect a wide range of cells. However, the transferred genetic material is not integrated. Therefore, any expression or screening procedures are limited to the time when the transferred genetic material is episomal. Thus, studies can only occur for a relatively short period of time.
  • Recently, attention has focused on lentiviral vectors such as those based upon the primate lentiviruses, e.g., human immunodeficiency viruses (HIV) and simian immunodeficiency virus (SIV). By using a pseudotyped vector (i.e., one where an envelope protein from a different species is used), problems encountered with infecting a wide range of cell types can be overcome by selecting a particular envelope protein based upon the type of cell to be infected. Additionally, in view of the complex gene splicing patterns seen in lentiviruses such as HIV, multivalent vectors (i.e., those expressing multiple genes) having a lentiviral core, such as an HIV core, are expected to more efficiently express nucleic acids of interest.
  • The use of lentiviral vectors, such as those based on primate lentiviruses, (e.g., HIV and SIV), to perform large-scale mammalian transfections offers several advantages over retroviral vectors. Lentiviral vectors containing genes encoding antibodies can infect quiescent cells and proliferating cells both in vivo and in vitro. (See, Reiser et al., PNAS 93:15266-15271 (1996); Naldini et al., Science 272:263-267 (1996)). Additionally, lentiviral vectors allow constitutive or induced expression of heterologous polypeptides, thus providing for the production of antibodies in culture and in animal.
  • In recent years, attention has been directed to developing large libraries typically consisting of monoclonal antibodies or peptides. For example, antigen binding antibody fragments have been expressed on the surface of filamentous phage (G. P. Smith, Science 228: 1315 (1985)), and used to create large libraries of such antibodies—e.g., 107 members or more, referred to as phage display libraries. In phage display libraries, the carboxyl-terminal end of the Fd or Fv region is tethered to a fragment of a phage coat protein, which anchors, for example, Fab fragment to the surface of the phage. Antibody display systems have been described in non-mammalian cells, such as E. coli (Daugherty et al, Protein Eng 1999, 12:613-621), yeast (Shusta et al. Nat Biotechnol 2000, 18:754-759), and baculoviral infection of Sf9 insect cells. Despite the advantages of being able to express antibodies on the surface of phage or non-mammalian cells, it was recognized that the expressed antibodies can often fail to fully retain their binding activity (Choe et al. Cell 2003, 114; 161-170; Huang et al. PNAS 2004, 101: 2706-2711).
  • SUMMARY OF THE INVENTION
  • The invention is based in part on the discovery of compositions and methods that provide for the display of candidate polypeptides such as an antibody or fragment thereof on the surface of a mammalian cell or viral particle.
  • The methods of the invention employ a viral display vector containing a nucleic acid sequence encoding a fusion protein. The fusion protein contains a leader peptide, a candidate polypeptide, a portion of an immunoglobulin molecule and a transmembrane moiety. Optionally, the fusion protein further contains an envelope incorporation signal, which is a polypeptide sequence that directs the expression of the candidate polypeptide to the surface (or envelope, env) of the viral particle.
  • Suitable candidate polypeptides include, but are not limited to, monoclonal antibody variable regions, single chain antibodies, domain antibodies, diabodies, or Fab antibodies. The candidate polypeptide may be derived from a library, such as a human single-chain antibody library (e.g., the Mehta I or Mehta II libraries), a natural peptide library, or a random peptide library.
  • The portion of the immunoglobulin molecule contains a domain of the constant region of an Ig molecule or functional fragment thereof. For example, the immunoglobulin molecule of the invention may contain the hinge, CH2 and CH3 region of an IgG molecule
  • The transmembrane moiety includes, a viral transmembrane moiety or mammalian transmembrane moiety. For example, transmembrane moiety is the lentiviral gp41, CD28, CD8 or IgM transmembrane moiety or a functional fragment thereof.
  • The fusion protein is operably linked to a constitutive promoter or an inducible promoter. Constitutive promoters include CMV. SV40, or CDK9. Inducible promoters include for example a tetracycline inducible promoter, an alcohol inducible promoter, a steroid inducible promoter, a metal inducible promoter, a light inducible promoter, or a temperature inducible promoter.
  • The various aspects the viral display vector contains one or more additional nucleic aid sequence such as a selectable marker or toxin. Selectable markers include for example as green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a member of the luciferase family, or a member of the aequorin family.
  • The viral display vector is a lentiviral vector, including, but not limited to, vectors obtained from human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
  • A candidate polypeptide is displayed on the surface of a mammalian cell by contacting a packaging cell with a viral display vector that contains a nucleic acid sequence encoding a fusion protein under conditions such that the packaging cell generates one or more viral particles containing the nucleic acid sequence encoding the fusion protein. Optionally, the candidate polypeptide is expressed on the surface of the viral particle. The viral particles are contacted with a mammalian display cell under conditions sufficient to express the fusion protein in the mammalian cell such that it is displayed on the surface of the mammalian cell.
  • The packaging cell may further include a helper vector that contains one or more viral structural genes, e.g., gag, pol, tat, and/or rev and an envelope vector that contains an env gene, e.g., a vesicular stomatitis virus glycoprotein gene encoding a functional envelope protein that is operably linked to a promoter and a polyadenylation sequence.
  • Packaging cells include for example, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells. Mammalian cells include for example, human B-cell lines such as Ramos Burkitt's lymphoma cells. In other embodiments, the cells are BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells.
  • Candidate polypeptides that bind to a target antigen are identified by contacting the viral particles with one or more mammalian display cells, under conditions such that the mammalian display cells each generate a single species of candidate polypeptide displayed on the surface of the cell. The mammalian cells displaying the single species of candidate polypeptide on the surface of the mammalian cell are separated (i.e., sorted) from mammalian cells not expressing a candidate polypeptide. The sorted mammalian cells are contacted with a target antigen to select cells that bind the target antigen. The sorting and antigen binding steps are repeated one or more times. In various aspects of the invention, the mammalian cells are contacted with a decreasing concentration of the target antigen thus enriching and affinity maturing the candidate polypeptide that binds to the target antigen.
  • The mammalian display cell may further contain a nucleic acid sequence encoding a calcium-sensitive bioluminescent protein, such as the aequorin protein from Aequoria Victoria jellyfish. In embodiments of the invention the fusion protein, when bound by target antigen, increases intracellular calcium, which causes the aequorin to emit light. (See Rider et al., 2003 Science 301:213-15.) To facilitate intracellular calcium increase, the transmembrane and intracellular domains of an immunoglobulin receptor (e.g., an IgM immunoglobulin receptor).
  • A soluble candidate polypeptide is produced flanking transmembrane moiety with a loxP site and inserting a second nucleic acid sequence encoding cre recombinase operably linked to an inducible promoter into the viral display vector. Exemplary loxP sites include, ATAACTTCGTATAGCATACATTATACGAAGTTA (SEQ ID NO: 12), expressed as a polypeptide as ITSYSIHYTKL (SEQ ID NO: 13).
  • The invention further provides vector systems containing any of the viral display vectors of the invention; an envelope vector containing an env gene, operably linked to a promoter and a polyadenylation sequence, encoding a functional envelope protein; and a helper vector comprising one or more viral structural genes. Optionally, the vector system may also include a cre vector that contains a nucleic acid sequence encoding cre recombinase polypeptide operably linked to an inducible promoter.
  • The invention also provides a viral targeting vector containing a nucleic acid encoding a fusion protein that contains a leader peptide, a candidate polypeptide, a portion of an immunoglobulin molecule and a transmembrane moiety flanked by a loxP site, a nucleic acid encoding a toxin, sequence encoding cre recombinase polypeptide, a nucleic acid encoding an entry moiety. An entry moiety is a viral envelope protein that has fusogenic activity. Preferably, the entry moiety does not have binding activity. For example, the entry moiety is a binding defective influenza hemagglutinin protein or fragment thereof, or a VSV-G protein or fragment thereof. Optionally, the viral targeting vector may also contain a nucleic acid sequence encoding a selectable marker.
  • Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
  • Other features and advantages of the invention will be apparent from the following detailed description and claims.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1 is a schematic representation of exemplary viral display vectors, helper vectors and envelope constructs of the invention.
  • FIG. 2 is a schematic representation of the process for selection of a candidate polypeptide using mammalian cell display of candidate polypeptides.
  • FIG. 3 is a schematic representation of the process for affinity maturation of candidate polypeptides using mammalian cell display of candidate polypeptides.
  • FIG. 4A is a schematic representation of a fusion protein of the invention containing an antibody.
  • FIG. 4B is a photographic image of a Western blot demonstrating expression of fusion proteins of the invention in 293T cells.
  • FIG. 4C is a photographic image of an SDS-PAGE demonstrating the captured antigens of a viral capture experiment using viral particles expressing an sFv on the viral capsid surface.
  • FIGS. 5A-H are a series of graphs demonstrating the detection of immunospecific binding of sFvTac-IgG1 antibodies to C8166-45 cells as measured by flow cytometry. MFI indicates mean fluorescence intensity. The amount of DNA used in each experiment is indicated below the graph.
  • FIG. 6 is a bar graph demonstrating the induced expression of human single chain antibodies of the invention (sFvTac-IgG1) by doxycycline (Dox+) treatment, as compared to untreated cells (Dox−).
  • FIG. 7 is a bar graph demonstrating that the induction of human single chain antibodies of the invention (sFvTac-IgG1) following Dox treatment is reversible by removal of the drug.
  • FIG. 8 is a schematic illustration of a lentiviral display vector containing cre recombinase and loxP sites.
  • FIG. 9 is a schematic representation showing the identification of target proteins using a functional proteomics screen of the invention.
  • FIG. 10 is a schematic representation showing the creation of a database of the invention that is useful in functional proteomics.
  • FIG. 11 is a schematic representation showing the use of paramagnetic proteoliposomes for the methods of lentiviral and/or mammalian display selection of the invention.
  • FIGS. 12A-D are a series of bar graphs demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells co-transfected with a vector expressing a candidate polypeptide and a vector expressing GFP.
  • FIGS. 13A-D are a series of bar graphs demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells transfected with a multi-functional vector containing an IRES.
  • FIGS. 14A-B are a series of bar graphs demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells detected with a C9 tag.
  • FIGS. 15A-G are a series of FACS analyses demonstrating the cell surface expression of fusion proteins on the surface of 293T mammalian display cells detected with a C9 tag.
  • FIG. 16 is a schematic representation of exemplary fusion proteins.
  • FIGS. 17A-D are a series of bar graphs demonstrating the transfection efficiency, MFI values, and cell surface expression of fusion proteins on the surface of 293T mammalian display cells.
  • FIGS. 18A-I are a series of FACS analyses demonstrating the MFI values and cell surface expression of fusion proteins on the surface of 293T mammalian display cells stained with anti-human IgG.
  • FIGS. 19A-D are a series of bar graphs demonstrating the transfection efficiency, MFI values, and cell surface expression of fusion proteins on the surface of 293T mammalian display cells.
  • FIGS. 20A-G are a series of FACS analyses demonstrating the MFI values and cell surface expression of fusion proteins on the surface of 293T mammalian display cells stained with anti-human IgG.
  • DETAILED DESCRIPTION OF THE INVENTION
  • This invention provides methods and compositions for displaying a candidate polypeptide on the surface of a viral particle (i.e. virion) or a eukaryotic cell, e.g., mammalian cell. The methods and compositions of the invention employ a viral display vector containing a nucleic acid sequence encoding a fusion protein containing the candidate polypeptide. The vector is introduced into a packaging cell such that the packaging cell generates one or more viral particles containing nucleic acid encoding the fusion protein and displaying the candidate polypeptide on the surface of the particle. A mammalian display cell is contacted with the viral particles such that the mammalian cell expresses (i.e., transiently or stably) the fusion protein such that the candidate polypeptide is displayed on surface of the cell.
  • The expression of candidate polypeptides on the surface of a mammalian cell has a number of advantages over other expression modalities, such as E. coli, yeast, and baculoviral infection of Sf9 insect cells. For example, the candidate polypeptide produced in mammalian cells contain post-translational modifications, such as glycosylation and sulfation, that are not made in these other expression systems. Moreover, correct protein folding is increased in mammalian cells as compared to cells that lack chaperone proteins and other cellular components that increase correct folding. Additionally, the candidate polypeptides are free of bacterial, yeast or baculovirus contaminants
  • The methods of the invention are useful, for example, to screen libraries containing nucleic acids encoding polypeptides in order to identify candidate polypeptide that binds a target antigen.
  • Viral Display Vectors
  • A viral display vector of the invention is a nucleic acid vector capable of expressing, constitutively or upon induction, a fusion protein. For example, the viral display vector is a lentiviral vector. Lentivirus vectors include, for example, a human immunodeficiency virus (HIV) (e.g, HIV-1 and HIV-2), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), or feline immunodeficiency virus (FIV).
  • A preferred lentiviral vector is obtained from HIV-1. HIV-1 vectors have been demonstrated to stably transduce non-dividing cells in vitro (See, J. Reiser et al., Proc. Natl. Acad. Sci. USA, 93:15266-15271 (1996)) and in vivo See, L. Naldini et al., Science, 272:263-267 (1996)). Thus, these vectors are capable of long-term expression. A list of suitable viruses and the cells infected thereby is provided in US Patent Application 2003/0044981, the contents of which are incorporated herein by reference in its entirety.
  • The nucleic acid sequence encoding the fusion protein is generally under the control of a regulatory element. By “regulatory element” is meant a nucleic acid sequence sufficient to direct transcription. Regulatory elements include, for example, promoters. Regulatory elements are constitutive or inducible, and may be coupled to additional sequences or “elements,” which render promoter-dependent gene expression cell-type specific, tissue-specific or inducible by external signals or agents. Such elements may be located in the 5′ or 3′ region of the native gene, or within an intron.
  • The regulatory element is operably linked to the fusion protein. By “operably linked” is meant that a coding sequence and a regulatory sequence(s) are connected in such a way as to permit gene expression when the appropriate molecules (e.g., transcriptional activator proteins) are bound to the regulatory sequence(s).
  • Suitable constitutive promoters include, e.g., SV40, CMV, CDK9, PGK, and ubiquitin C. An exemplary CMV promoter sequence is GenBank Accession numbers BD015376 and BD015377.
  • An inducible promoter system includes the tetracycline repressor (tetR), wherein expression of the nucleic acid encoding the fusion proteins of the invention is dependent on the activity of an inducible transcriptional activator. (See, Yao et al., Human Gene Therapy 9:1939-1950 (1998). (See, Baron et al. Tet repressor-based system for regulated gene expression in eukaryotic cells: Principles and advances. Methods Enzymol 327: 401-21(2000)).
  • The tet expression system includes Tet-On and Tet-Off systems. In the Tet-On system, transcription is active in the presence of the tetracycline (Tc) derivative doxycycline (Dox). Conversely, in the Tet-Off system, transcription is inactive in the presence of tetracycline or Dox. In the Tet-Off expression system, a tetracycline-controlled transactivator protein (tTA), which is composed of the Tet repressor DNA binding protein (TetR) from the Tc resistance operon of Escherichia coli transposon Tn10 fused to the strong transactivating domain of VP16 from Herpes simplex virus, regulates expression of a target gene that is under transcriptional control of a tetracycline-responsive promoter element (TRE). The TRE is made up of Tet operator (tetO) sequence concatamers fused to a minimal promoter (commonly the minimal promoter sequence derived from the human cytomegalovirus (hCMV) immediate-early promoter). In the absence of Tc or Dox, tTA binds to the TRE and activates transcription of the target gene. In the presence of Tc or Dox, tTA cannot bind to the TRE, and expression from the target gene remains inactive.
  • The Tet-On system is based on a reverse tetracycline-controlled transactivator, rtTA. Like tTA, rtTA is a fusion protein comprised of the TetR repressor and the VP16 transactivation domain; however, a four amino acid change in the tetR DNA binding moiety alters rtTA's binding characteristics such that it can only recognize the tetO sequences in the TRE of the target transgene in the presence of the Dox effector. Thus, in the Tet-On system, transcription of the TRE-regulated target gene is stimulated by rtTA only in the presence of Dox.
  • Alternatively, the inducible promoter system is the lac repressor system from E. coli. (See, Brown et al., Cell 49:603-612 (1987). The lac repressor system functions by regulating transcription of nucleic acids having mammalian cell promoters that contain the lac operator (lacO), a nucleic acid sequence to which the lac repressor (lacR) binds, preventing transcription of the target nucleic acids regulated by the lacO-containing promoter. Expression of the target nucleic acids is induced by isopropyl-β-D-thiogalactopyranoside (IPTG) treatment. For example, 293T cells are transfected with a lentiviral display vector containing a nucleic acid encoding an antibody fusion protein and a nucleic acid encoding eGFP, both of which are under the control CMV promoter having a lacO, e.g., by electroporation. The induction levels of antibodies is examined before and after IPTG treatment (0.5 mmol/L) by Western blot analysis or other measurement techniques known in the art.
  • Other inducible systems include FK506 dimer, VP16 or p65 using estradiol, RU486, diphenol murislerone, rapamycin, and the ecdysone inducible system.
  • Organ/tissue-specific promoter include, for example, the prion protein promoter or the neuron-specific enolase promoter, the CaMKII-alpha promoter, the LAP promoter, the Clara cell 10-kD protein (CC 10) promoter can be used for lung-specific expression, the Mouse mammary tumor virus long terminal repeat, the human keratin 14 (K14) promoter, the bovine keratin 6 (K6) promoter/regulatory region, the Tek or Tie promoter and the whey acidic protein (WAP) promoter or the ß-lactoglobulin promoter.
  • Optionally, the viral display vectors of the present invention contain a selectable marker. In general, any gene encoding a gene product that allows for selection of the cell carrying the display vector can be used as the selectable marker. Such selection systems are well known in the art and include genes that change the sensitivity of a cell to a stimulus such as a nutrient, or an antibiotic. Examples of selectable markers include, but are not limited to, known genes encoding resistance to antibiotics such as the aminoglycoside antibiotics (including, e.g., neomycin, hygromycin, kanamycin, bleomycin, and G418). (See, e.g., Potrykus et al., Mol. Gen. Genet. 199:183-188 (1985). Other selectable markers include the dihydrofolate reductase (DHFR) gene, which confers resistance to methotrexate (See, Thillet et al., J. Biol. Chem. 263:12500-12508 (1988). Other selectable markers are genes that express proteins that directly or indirectly produces light, either constitutively or upon being contacted with a compound. For example, other selectable markers include, green fluorescent protein, red fluorescent protein, yellow fluorescent protein, blue fluorescent protein, ferredoxin IV, LacZ, members of the luciferase family, or members of the aequorin family.
  • The selectable marker is linked to the candidate polypeptide by the use of an internal ribosome entry site (IRES) (see Marasco et al., PCT/US96/16531). The presence of an IRES sequence directs the nearly simultaneous production of the fusion protein and the selectable marker, if present. This nearly simultaneous co-expression allows for the selection of cells expressing the fusion protein based on detection of the selectable marker. IRES sequences are known in the art and include those from encephalomyocarditis virus (EMCV) (Ghattas, I. R. et al., Mol. Cell Biol., 11: 5848-5849 (1991)); BiP protein (Macejak and Samow, Nature, 353:91 (1991)); the Antennapedia gene of Drosophila (exons d and e) (Oh et al., Genes & Dev., 6: 1643-1653 (1992)); those in polio virus (Pelletier and Sonenberg, Nature 334:320325 (1988); see also Mountford and Smith, TIG, 11:179-184 (1985)).
  • The lentiviral display vector may also contain additional nucleotide sequences, including a portion of the gag gene (“gag”, which allows the transduction of dividing and non-dividing cells), e.g., about 41 nucleotides at the 5′ end of the gag gene bounded by a Cla I site (see, e.g., FIG. 1), which has been demonstrated to contain the RNA packaging signal and is generally sufficient for gene transfer. (See, Parolin et al., 1994 J. Virol. 68:3888-95.) The lentiviral display vector may also contain a cis-acting woodchuck hepatitis virus postregulatory regulatory element (WPRE) that post-transcriptionally stimulate transgene expression; and the viral LTR sequences R and U5, which control transcription of the vector, carry the polyadenylation signal, and integrate the virus into the genome, respectively. The WPRE is particularly useful to enhance expression of fusion proteins when an inducible promoter is used. Typically, the U3 region (self-inactivation) and all HIV-1 accessory genes are deleted. Further, the cPPT/CTS (central polypurine track) region is added. The lentiviral display vector contains a nucleic acid sequence encoding an envelope protein. Alternatively, the lentiviral display vector does not contain a nucleic acid sequence encoding an envelope protein, and protein is provided on a separate vector. Optionally, the viral particles are pseudotyped having a envelope protein that differs form the lentiviral capsid. By appropriate selection of envelope proteins one can “infect” virtually any cell. Thus, the vector can readily be targeted to a specific cell. For example, one can use an env gene that encodes an envelope protein derived from the influenza virus, VSV-G, a member of the alpha viruses (Semliki forest virus, Sindbis virus), a member of the arenaviruses (lymphocytic choriomeningitis virus), a member of the flaviviruses (tick-borne encephalitis virus, Dengue virus), a member of the rhabdoviruses (vesicular stomatitis virus, rabies virus), or a member of the orthomyxoviruses (influenza virus). Other envelopes are derived from Moloney Leukemia Virus such as MLV-E, MLV-A and GALV. Also, specific envelopes are selected in order to target the construct to a desired host cell or tissue, such as brain or vascular endothelium.
  • Numerous modifications can be made to the vectors, which are used to create the particles to further minimize the chance of obtaining wild type revertants. These include deletions of the U3 region of the LTR, tat deletions and matrix (MA) deletions.
  • An exemplary lentiviral display vector is shown in schematic form in FIG. 1. In this figure, the fusion protein, represented as “sFv-IgG,” is under the control of a cytomegalovirus promoter (“CMV”). A selectable marker (e.g., eGFP) is provided downstream of an internal ribosome entry site (IRES) (See, Marasco et al., PCT/US96/16531).
  • The lentiviral virion (particle) is expressed by a vector system encoding the necessary viral proteins to produce a virion (viral particle). For example, the packaging cell is further transduced with one or more additional vectors encoding all the necessary viral protein to produce the viral particle. Additional vectors include a helper vector containing one or more viral structural genes. Preferably, there is at least one vector containing a nucleic acid sequence encoding the lentiviral pol proteins necessary for reverse transcription and integration, operably linked to a promoter. Preferably, the pol proteins are expressed by multiple vectors. There is also a vector containing a nucleic acid sequence encoding the lentiviral gag proteins necessary for forming a viral capsid operably linked to a promoter. Preferably, this gag nucleic acid sequence is on a separate vector than at least some of the pol nucleic acid sequence, still more preferably it is on a separate vector from all the pol nucleic acid sequences that encode pol proteins.
  • The gag, pol and env vector(s) do not contain nucleotides from the lentiviral genome that package lentiviral RNA, referred to as the lentiviral packaging sequence. In HIV this region corresponds to the region between the 5′ major splice donor and the gag gene initiation codon (nucleotides 301-319).
  • The vector(s) forming the particle preferably do not contain a nucleic acid sequence from the lentiviral genome that expresses an envelope protein. Preferably, a separate vector (i.e., an envelope vector that contains a nucleic acid sequence encoding an envelope protein operably linked to a promoter is used. This env vector also does not contain a lentiviral packaging sequence. The envelope protein is from the lentivirus from which the lentiviral display vector is derived. Alternatively, the envelope protein is not from the lentivirus from which the lentiviral display vector is derived but is derived from a different virus. The resultant viral particle is referred to as a pseudotyped particle.
  • As shown in FIG. 1, helper construct pCMVdR8.2 contains the gag, pol, tat, and rev genes under the control of the ieCMV promoter. The gag gene encodes for the viral matrix, capsid and nucleocapsid polypeptides. The pol gene encodes for the viral reverse transcriptase and integrase enzymes. The tat gene induces viral gene expression and protein synthesis. The rev gene regulates expression of the gag, pol and env genes.
  • As shown in FIG. 1, the envelope vector contains the G protein of vesicular stomatitis virus (“VSV-G”), operably linked to the ieCMV promoter and An (a polyadenylation sequence). The immediate-early CMV (ieCMV promoter; also known as CMVie) can contain a tetracycline operator downstream of the CMV promoter's TATA element. Other useful envelope proteins include those from the Moloney Leukemia Virus, such as MLV-E, MLV-A and GALV. Other env polypeptides are selected depending upon the host cell. Fragments of env polypeptides that retain cellular binding properties are also provided. For example, the HIV gp160 precursor is processed to form gp120 and gp41.
  • Introduction of a viral display vector, an envelope vector and a helper vector into a packaging cell) is useful, i.e., to produce a viral particle containing a nucleic acid encoding the fusion protein of the invention. Alternatively, a portion (or all) of the envelope vector and/or helper vector nucleic sequences can be contained within the viral display vector.
  • Suitable packaging include any cells capable of generating a lentiviral particle. Packaging cells include primary cells, embryonic stem cells and cell lines. Preferred packaging cells include for example, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells) and CEMX174 cells. Such cell lines are available, for example, from the A.T.C.C., Manassas Va.
  • Fusion Proteins
  • A fusion protein contains a leader peptide, a candidate polypeptide, at least a portion of an immunoglobulin molecule and a transmembrane moiety. Optionally, the fusion protein contains an envelope incorporation signal. The leader peptide, candidate polypeptide, the portion of the immunoglobulin molecule and the transmembrane moiety is operably linked. By “operably-linked” is intended to mean that the nucleotide sequences of interest are in a manner that allows for expression of the nucleotide sequence (e.g., in a host cell when the vector is introduced into the host cell). Preferably, nucleic acid encoding the leader peptide is operably linked to the nucleic acid encoding the candidate polypeptide that is operably linked to the nucleic acid of the transmembrane moiety.
  • As used herein, the term “fusion protein” includes a polypeptide containing all or a portion of the amino acid sequences of two or more proteins. The terms “protein” and “polypeptide” are used interchangeably herein. The term “portion” includes any region of a polypeptide, such as a fragment (proteolytically or otherwise obtained) or a domain (a region of a polypeptide having an activity, such as, e.g., enzymatic activity or antigen- or DNA-binding) that contains fewer amino acids than the full-length polypeptide. Those skilled in the art will recognize that the terms “portion” and “fragment” are also used interchangeably herein.
  • Leader Peptide
  • A leader peptide includes a peptide that direct a newly synthesized protein in the ribosome to the Golgi complex for transport to the plasma membrane or out of the cell. (See, Nielsen et al., “Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites” Protein Engineering, vol. 10 no. 1 pp. 1-6, 1997). Leader polypeptides are also known as signal peptides or signal polypeptides. Leader peptides generally include a string of hydrophobic amino acids. Leader peptides include an immunoglobulin leader sequence, polyhistidine or polyvaline sequences, as well as others known to those skilled in the art. Exemplary leader peptides are provided in Table 1.
  • Leader peptides include peptides having three regions: an n-region, which is a positively charged region at the N-terminus of the signal peptide (the “left end” of the sequence); an h-region having a hydrophobic core, optionally in the middle of the signal peptide; and a c-region, a generally polar region at the C-terminus of the leader sequence with generally small and neutral amino acids at position −1 and −3.
  • Leader peptides of the invention include peptides capable of being acted upon by signal peptidase, a specific protease located on the cisternal face of the endoplasmic reticulum. Leader polypeptides of the present invention also include polypeptides identified using the SIGFIND program, which predicts signal peptides at the start of protein sequences and searches open reading frames with a potential signal peptide coded in nucleotide sequences. (See, “Finding Signal Peptides in Human Protein Sequences using Recurrent Neural Networks” (2002) Reczko et al., In R. Guigo and D. Gusfield (eds.): Algorithms in Bioinformatics, Proceedings of the 2nd Int. Workshop WABI 2002, Rome, Italy, September 16-21, Lecture Notes in Computer Science, Springer, Volume 2452, pp. 60-67).
  • The SIGFIND program provides a score (the sig.pep score, which ranges from 0 (no signal peptide) to 9 (maximum score for presence of a signal peptide)) along the sequence that indicates the location and size of the signal peptide. Generally, a decrease in the sig.pep score from higher to lower indicates the approximate position of the signal peptide cleavage site.
  • TABLE 1
    Ig-kappa chain leader sequence: Met-Glu-Thr-Asp-Thr-Leu-Leu-Leu-Trp-Val-Leu-
    Leu-Leu-Trp-Val-ProGlySerThrGlyAsp (SEQ ID NO: 2)
    Bacteriophage T7 gene 10 leader protein: Met-Ala-Ser-Met-Thr-Gly-Gly-Gln-Gln-
    Met-Gly (SEQ ID NO: 3)
    Tandem polyvaline heptad repeats: (Val-Val-Val-Val-Val-Val)n (SEQ ID NO: 4)
    Preproalbumin: Met-Lys-Trp-Val-Thr-Phe-Leu-Leu-Leu-Leu-Phe-Ile-Ser-Gly-Ser-Ala-
    Phe-Ser (SEQ ID NO: 5)
    Pre-IgG light chain: Met-Asp-Met-Arg-Ala-Pro-Ala-Gln-Ile-Phe-Gly-Phe-Leu-Leu-Leu-
    Leu-Phe-Pro-Gly-Thr-Arg-Cys (SEQ ID NO: 6)
    Prelysozyme: Met-Arg-Ser-Leu-Leu-Ile-Leu-Val-Leu-Cys-Phe-Leu-Pro-Leu-Ala-Ala-Leu-
    Gly (SEQ ID NO: 7)
    Acetylcholine receptor gamma subunit precursor: Met-Val-Leu-Thr-Leu-Leu-Leu-Ile-
    Ile-Cys-Leu-Ala-Leu-Glu-Val-Arg-Ser (SEQ ID NO: 8)
    ER signal peptide: X1-Leu-Leu-Leu-Val-Gly-Ile-Leu-Phe-Trp-Ala-X2 (SEQ ID NO: 9). X1
    may be any one or more amino acids or nothing. X2 is the remainder of the polypeptide.
  • Candidate Polypeptide
  • A candidate polypeptide is any polypeptide or fragment thereof in which expression on the surface of a viral capsid or mammalian cell is desired. A candidate polypeptide is a native a cell surface polypeptide. Alternatively, a candidate polypeptide is not a native cell surface polypeptide. The candidate polypeptide is an antibody or fragment thereof, a toxin, a hormone, a growth factor, a receptor, or a signaling molecule.
  • As used herein, the term “antibody” or “function fragment thereof” refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, polyclonal, monoclonal, chimeric, single chain, Fab, Fab′ and F(ab′)2 fragments, and an Fab expression library.
  • By “specifically bind” or “immunoreacts with” is meant that the antibody reacts with one or more antigenic determinants of the desired antigen and does not react (i.e., bind) with other polypeptides or binds at much lower affinity (Kd>10−6) with other polypeptides.
  • As used herein, the terms “immunological binding,” and “immunological binding properties” refer to the non-covalent interactions of the type that occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific. The strength, or affinity of immunological binding interactions can be expressed in terms of the dissociation constant (Kd) of the interaction, wherein a smaller Kd represents a greater affinity. Immunological binding properties of selected polypeptides are quantified using methods well known in the art. One such method entails measuring the rates of antigen-binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions. Thus, both the “on rate constant” (Kon) and the “off rate constant” (Koff) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361:186-87 (1993)). The ratio of Koff/Kon enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant Kd. (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
  • The candidate polypeptide can be obtained from a library. Preferred libraries include human single-chain antibody libraries, natural peptide libraries, and random peptide libraries. Exemplary libraries include the Mehta I and Mehta II phage display libraries. (See, Gennari et al., J. Mol. Biol. 335(1):193-207 (2004)). The Mehta I library contains 15 billion sFv inserts; the Mehta II library contains 12 billion sFv inserts. Natural peptide libraries are known in the art. (See, Matthews et al., J. Immunol. 169(2): 837-46 (2002)). Preferably, a natural peptide library contains peptides from about 25 to about 200 amino acids in length, as this size peptide has been demonstrated to represent native epitopes. (See, Fack et al., J. Immunol. Methods 206:43 (1997); Matthews et al., J. Immunol. 169:837 (2002)). Random peptide libraries are known in the art and are available from BD Biosciences (San Jose, Calif.), New England Biolabs (Beverly, Mass.) and other commercial sources. Library inserts can be amplified and ligated into the viral display vectors of the invention. Alternatively, the inserts can be excised from the host library and ligated into the viral display vectors.
  • Immunoglobin Polypeptides
  • The fusion polypeptide further includes at least a region of a an immunoglobulin polypeptide. “At least a region” is meant to include any portion of an immunoglobulin molecule, such as the light chain, heavy chain, F, region, hinge region, CH1 region, CH2 region, CH3 region Fab region, Fv region or any fragment or combination thereof. Preferably, the immunoglobulin polypeptide contains the hinge region, the CH2 region and CH3 region of an IgG molecule (e.g., IgG1).
  • Transmembrane Moiety
  • A transmembrane moiety (or transmembrane domain) is a plurality of amino acids that is capable of extending across a biological membrane of a cell, such as the plasma membrane or a membrane of an organelle. A transmembrane moiety is a polypeptide capable of inserting into and remaining anchored within the viral capsid surface and/or the plasma membrane of a mammalian cell. When included in the fusion protein of the invention, the transmembrane moiety is capable of localizing the fusion protein to the viral capsid surface and/or to the plasma membrane of a mammalian cell. The transmembrane moiety is a viral transmembrane moiety, such as a lentiviral transmembrane moiety. Lentiviral transmembrane moieties include for example envelope polypeptide from HIV, SIV, CAEV, BIV, BLV, and FIV or a functional fragments thereof.
  • The HIV-1 gp160 envelope polypeptide is a polypeptide of about 856 amino acids (See Table 2; SEQ ID NO:1 and GenBank Accession numbers AAO40783, AAA76671, BAA12995, and P03377) that is proteolytically processed into a gp120 and a gp41 polypeptide. The amino acid sequence of an HIV-1 gp160 envelope polypeptide is provided as SEQ ID NO:1 in Table 2. The gp41 polypeptide includes amino acids 512-856 of SEQ ID NO: 1 (See also, GenBank Accession No.: NP_057856). The transmembrane moiety of gp41 is generally located between about amino acids 675-715 of the gp160 polypeptide. Additional, lentiviral envelope proteins are provided by GenBank Accession numbers AAT41729 from SIV, P31627 from CAEV, P19557 from BIV, P03380 from BLV, and NP_040976 envelope from FIV.
  • TABLE 2
    Polypeptide sequence of HIV-1 gp160 (SEQ ID NO: 1)
    mrvkekyqhlwrwgwrwgtmllgmlmicsateklwvtvyygvpvwkeatt
    tlfcasdakaydtevhnvwathacvptdpnpqevvlvnvtenfnmwkndm
    veqmhediislwdqslkpcvkltplcvslkctdlkndtntnsssgrmime
    kgeikncsfnistsirgkvqkeyaffykldiipidndttsykltscntsv
    itqacpkvsfepipihycapagfailkcnnktfngtgpctnvstvqcthg
    irpvvstqlllngslaeeevvirsvnftdnaktiivqlntsveinctrpn
    nntrkririqrgpgrafvtigkignmrqahcnisrakwnntlkqiasklr
    eqfgnnktiifkqssggdpeivthsfncggeffycnstqlfnstwfnstw
    stegsnntegsdtitlpcrikqiinmwqkvgkamyappisgqircssnit
    gllltrdggnsnneseifrpgggdmrdnwrselykykvvkieplgvaptk
    akrrvvqrekravgigalflgflgaagstmgaasmtltvqarqllsgivq
    qqnnllraieaqqhllqltvwgikqlqarilaverylkdqqllgiwgcsg
    klicttavpwnaswsnksleqiwnhttwmewdreinnytslihslieesq
    nqqekneqelleldkwaslwnwfnitnwlwyiklfimivgglvglrivfa
    vlsivnrvrqgysplsfqthlptprgpdrpegieeeggerdrdrsirlvn
    gslaliwddlrslclfsyhrlrdlllivtrivellgrrgwealkywwnll
    qywsqelknsavsllnataiavaegtdrvievvqgacrairhiprrirqg
    lerill
  • Alternatively, the transmembrane moiety is a mammalian transmembrane moiety, such as CD28, CD8, or IgM transmembrane moiety or functional fragment.
  • As used herein, a “functional fragment” of a transmembrane moiety includes any portion or fragment of a transmembrane moiety that is sufficient to localize the fusion protein to the surface of the viral particle and/or to the mammalian cell plasma membrane. For example, a transmembrane domain includes the amino acid sequence NRVRQGYS (SEQ ID NO: 14) or GGTETSQVAPA (SEQ ID NO: 15).
  • Generally, transmembrane moieties have positively charged amino acids (such as lysine and arginine) at their ends and uncharged amino acids in the center. Transmembrane proteins are capable of having an N-terminal signal sequence that targets these polypeptides to the endoplasmic reticulum. Transmembrane moieties include polypeptide sequences having one or more alpha-helical structures. Usually, an alpha-helical transmembrane domain of 25 or more amino acids in length is sufficient to span the plasma membrane. Alternatively, the transmembrane moiety may include a polypeptide having one or more beta-barrel structures. An exemplary transmembrane moiety includes the transmembrane domain from gylcophorin A (Val-Gln-Leu-Ala-His-His-Phe-Ser-Glu-Pro-Glu-Ile-Thr-Leu-Ile-Ile-Phe-Gly-Val-Met-Ala-Gly-Val-Ile-Gly-Thr-Ile-Leu-Leu-Ile-Ser-Tyr-Gly-Ile; SEQ ID NO: 10). In some embodiments, transmembrane domains include polypeptide sequences having two or more β-sheets.
  • Transmembrane moieties include polypeptides provided in the TMbase of transmembrane proteins and their membrane-spanning domains. (See, K. Hofmann & W. Stoffel (1993), TMbase—A database of membrane spanning proteins segments. Biol. Chem. Hoppe-Seyler 374,166.) The TMbase database contains information from SwissProt and other database sources. Transmembrane moieties of the present invention include polypeptides identified using the TMpred program, which makes a prediction of membrane-spanning regions and their orientation using an algorithm based on the statistical analysis of the TMbase database of naturally occurring transmembrane proteins. Other programs capable of determining transmembrane domains in a polypeptide include GREASE, TMHMM, and TMAP.
  • Methods of Displaying a Candidate Polypeptide on a Viral Capsid
  • The viral display vector containing the nucleic acid encoding the fusion protein is introduced into a packaging cell. As used herein, the introduction of DNA into a cell is referred to as transduction, sometimes also known as transfection or infection.
  • Generally, the display vector is introduced by transfection in combination with one or more unlinked vectors, but one of skill in the art will appreciate that the methods of the invention can employ the use of other methods of introducing a nucleic acid vector into a recipient cell, including, but not limited to, microinjection. Preferred transfection means are calcium phosphate, FUGENE 6™ (Roche Diagnostics, Indianapolis, Ind.), and POLYFECT™ (Qiagen, Valencia, Calif.). The packaging cell is further transfected with a one, an envelope vector and a helper vector. The ratio of display vector:envelope vector:helper vector is about 2:1:2. Alternatively, the ratio of display vector:envelope vector:helper vector is about 1:2:1.
  • Following the introduction of the vector(s) into the packaging cell, the packaging cell generates one or more viral particles containing a nucleic acid encoding the fusion protein and the candidate polypeptide on the viral capsid. Optionally, the viral particles produced by the packaging cells are purified and/or concentrated by any means known to those skilled in the art. For example, viral particles expressing a nucleic acid encoding a selectable marker (e.g., eGFP) are then sorted by fluorescence assisted cell sorting (FACS) by detecting the expressed selectable marker. Alternatively, the viral particles are collected by filtration (e.g., filtration through a 0.45 μm and/or 0.22 μm filter) and pelleted by centrifugation at 100,000×g).
  • Viral particles having a candidate polypeptide or fragment thereof expressed on their surface can be used to identify those candidate polypeptides that bind to an antigen of interest (e.g., a “target antigen”). One or more viral particles, containing the fusion protein of the invention are contacted with a target antigen that has been tagged (e.g., a fluorescent tag such as FITC is attached chemically to the antigen). The viral particles are provided in solution. Alternatively, the viral particles are attached to a solid support. A solid support includes for example, a chip, a bead, paper or polystyrene The tagged target antigen contacts and binds the candidate polypeptide, and viral particles having a candidate polypeptide to which the target antigen has bound are selected by FACS or other suitable means known to those skilled in the art. The nucleic acid sequence encoding the candidate polypeptide may be sequenced, either directly or following amplification. In this way, the candidate polypeptide that binds to the target antigen can be identified.
  • Methods of Displaying a Candidate Polypeptide on the Surface of a Mammalian Cell
  • The invention also provides methods for the display of a candidate polypeptide on the surface of mammalian cells, which is useful, for example, to screen libraries containing polypeptides, antibodies or antibody fragments. It has recently been recognized that post-translational modifications such as N-linked and O-linked glycosylation, and sulfation. of polypeptides, e.g., antibodies play an important structural role. Thus, polypeptides produced by the methods of the invention will contain these post-translational modifications, while polypeptides produced in bacteria (e.g., using the method of phage display) will lack these post-translational modifications.
  • Candidate polypeptides are displayed on the surface of a mammalian cell by transfecting a packaging cell with the viral display vector containing the nucleic acid encoding the fusion protein as described above. Optionally, the nucleic acid encoding the fusion protein is expressed such that the candidate polypeptide is displayed on the surface of the viral capsid. However, those skilled in the art will recognize that expression of the fusion protein on the surface of the viral capsid is not necessary in order to achieve expression of the fusion protein on the surface of the mammalian cell.
  • Viral particles produced by the packaging cell are then contacted with a mammalian display cell, such that the mammalian display cell is infected by the viral particle. The viral particles are contacted with the mammalian cells at a multiplicity of infection (MOI) that will provide on average only 0-1 integrations per cell. For example, the viral particles are contacted with the mammalian cells at a multiplicity of infection of about 1. Generally, the viral vector is stably integrated into the mammalian cell. Alternatively, the integration is transient. The presence of the transmembrane moiety of the fusion polypeptide targets the expressed fusion protein to the surface of the mammalian cell such that the candidate polypeptide is displayed on the plasma membrane. Based upon the MOI, each mammalian cell will have a contain a unique nucleic acid encoding the fusion protein and thus a unique a candidate polypeptide on its surface. For example, if an antibody library used, (e.g., one or both of the Mehta libraries), to create the viral vector it should be possible to obtain 27 billion mammalian cells, each expressing a unique antibody on its cell surface.
  • Exemplary mammalian display cells include, BHK, VERO, HT1080, 293, 293T, RD, COS-7, CHO, Jurkat, HUT, SUPT, C8166, MOLT4/clone8, MT-2, MT-4, H9, PM1, CEM, myeloma cells (e.g., SB20 cells), and CEMX174 cell lines. Another exemplary mammalian display cells include the M12g3R (IgM+) B cell line. (See Rider et al., 2003 Science 301:213-15.)
  • The mammalian display cell is a cell line that is capable of constitutively mutating nucleic acids that are either stably or transiently transfected into the cell. (Cumbers et al., Nature Biotech 20:1129, (2002); and see editorial review form Presta, Nature Biotech. 20:1096(2002)). For example, the mammalian display cell is a Ramos Burkitt's lymphoma cell line, BL-2 cells, CL-01 cells (Martin et al., Nature 415:802, 2002) or chicken DT40 B-cell lymphoma cells (Sale et al., Nature 412:921, 2001). Alternatively, the mammalian cell to modified to overexpress activation-induced cytosine deaminase (AID) protein (Muramatsu, 2000; Di Noia, 2002; Petersen-Mahrt, 2002; Yoshikawa, 2002 and Gearhart, 2002 for brief editorial review), DNA polymerase iota (Faili, 2002) or other members of the family of TLS polymerases that are components of the immunoglobulin mutasome. The AID protein is required for the maturation of antibodies in mammals and other higher vertebrates, where it promotes somatic hypermutation (SHM), class switch recombination and gene conversion.
  • Mutation of the fusion polypeptide by the mammalian display cell results in a candidate polypeptide that has altered, increased or decreased, binding affinity an/or specificity for a target antigen of interest. For example, when the candidate polypeptide is an antibody or fragment thereof, mutation mimics the hypermutaton process of antibodies.
  • Optionally, the mammalian cells expressing a candidate polypeptide (i.e. infected cells) are separated (i.e. sorted) form the mammalian cell not expressing a candidate polypeptide. Sorting of infected mammalian cells allows uninfected cells to be removed from the population, which, in turn, reduces the incidence of non-specific binding interactions with labeled antigens. Moreover, when mammalian display cell is capable of mutating the nucleic acid as described above, sorting the cells recapitulates for example, the affinity maturation process of B cells during the in vivo immune response.
  • Infected mammalian cells are sorted by detecting a selectable marker such as eGFP. Alternatively, infected mammalian cells are sorted by identifying cells that bind an antigen. For example the cells are contacted with a labeled target antigen at a given concentration. The a labeled target antigen is combined with the mammalian cells in solution or on solid support. Solid supports include for example, a chip, bead, paper, plastic or other solid or semi-solid means. When the target antigen an mammalian cells are present in solution, FACS or other suitable selection means is used to identify the complex between bound antigen and candidate polypeptide to separate the bound complex from unbound tagged target antigens and unbound mammalian cells. In contrast, when the target antigen is on a solid support, column chromatography is used to separate mammalian cells presenting candidate polypeptide or antibody bound to tagged antigen. The antigen is bound to beads (e.g., cellulose or sepharose beads) in a chromatography column and a solution containing the mammalian cells is applied to the column. Unbound mammalian cells are removed from the column by one or more washing steps. The bound mammalian cells are then eluted from the column, such as with a high or low pH solution, a detergent solution, a high salt solution, or with chaotropic agents (e.g., urea and/or guanidine).
  • Preferably, the mammalian cells are sorted by both selectable marker expression and antigen binding.
  • Optionally, the infected mammalian cells are expanded in culture between sorting steps. The expansion may be clonal or non-clonal in nature. The amount of antigen used in the subsequent sorting steps is reduced. For example, the concentration of target antigen is reduced by 25%, 50%, 75%, 90%, 95%, 99%, 99.9%, 99.99% or 99.999%. Thus, in this way, the methods of the invention are used to identify candidate polypeptides that bind to the target antigen with higher specificity and affinity compared to the mean affinity of the candidate polypeptide prior to affinity selection process.
  • The nucleic acid sequence encoding the selected candidate polypeptide is determined. For example, the population of selected mammalian cells are lysed, such as with a detergent, and the nucleic acids encoding the candidate polypeptide are amplified by PCR and cloned into a suitable vector. Optionally, the amplified inserts are cloned into the lentiviral display vector and used to produce new virus particles, as described above. These particles can be used to infect additional mammalian cells, and the candidate polypeptide display method can be repeated one or more times.
  • The methods of the invention also allow for the production a soluble candidate polypeptide. Soluble candidate polypeptides are generated by excising the nucleic acid molecule encoding the transmembrane domain of the fusion protein following expression of the fusion protein on the surface of the viral particle or the mammalian cell. For example, these methods are useful for the localization of an antibody-producing cell to a target cell or tissue using the membrane anchored antibody, followed by delivery of a soluble antibody in vivo to specific cell type or tissue, such as a cancer cell. This soluble antibody may be cytotoxic, cytostatic, or induce apoptosis.
  • For example, a viral display vector described above may additionally contain two or more signal sites (or signal sequences), e.g., loxP sites, recognized by the Cre recombinase. The Cre-lox reaction functions as follows. P1 bacteriophage cyclization recombination (Cre) recombinase recognizes a pair of loxP binding sites flanking a nucleic acid molecule of interest. Here, the loxP sites can flank the nucleic acid sequence encoding the transmembrane moiety of the fusion protein. Optionally, nucleic acid sequences encoding one or more amino acids flanking the transmembrane moiety (termed “spacer amino acids”) are provided. Spacer amino acids facilitate proper folding of the fusion protein. LoxP sites are 34 bp long and are composed of an 8 bp core, which determines directionality, flanked by 13 bp of palindromic (complementary) sequences. Sequences flanked by loxP sites are said to be “floxed”. Cre enzyme brings together the two loxP sites, which carry complementary sequences. Depending on the orientation of the paired loxP sites, different results may be achieved. In the cre-lox system, nucleic acid sequences between two signal sites are deleted or inverted if the signal sites are on the same nucleic acid molecule. The intervening DNA may be excised or circularized, inverted or translocated. Optionally, the viral display vector also contains a nucleic acid sequence encoding cre recombinase. Cre expression can driven by an inducible promoter such as tetracycline/doxycycline. Optionally, loxP sites flank the nucleic acid sequence encoding cre recombinase in addition to flanking the transmembrane moiety of the fusion protein. The nucleic acid sequence encoding cre recombinase is positioned upstream (in a 5′ direction) or downstream (in a 3′ direction) relative to the loxP sites. The ability to induce cre recombinase expression provides the ability to produce soluble antibodies. The nucleic acid sequence encoding cre recombinase can be situated in a different vector, or has been stably integrated into the genome of the host cell.
  • Another example of a site-specific recombinase system is the flp system from yeast. The Flp recombinase is a 45 kD protein endoded by the 2 micron plasmid of the yeast Saccharomyces cerevisiae. A viral display vector described above may additionally contain two or more recombination targets (FRTs), recognized by the FLP recombinase. For example, two FRTs flank the nucleic acid sequence encoding the transmembrane moiety of the fusion protein.
  • A modified FLP recombinase with increased recombinase activity has also been described (See, Bucholz et al., Nature Biotech. 16, 657-662 (1998)). A suitable FRT sequence is: GAAGTTCCTATACTTTCTAGAGAATAGGAACTTCGGAATAGGAACTTA (SEQ ID NO: 11). The FLP recombinase bind the FRTs, resulting in excision of the nucleic acid sequence encoding the transmembrane moiety and the production of a soluble antibody.
  • For example, a mammalian display cell that expresses an antibody that binds immunospecifically to a tumor specific antigen (TSA) on the surface of a cancer cell is identified using the mammalian cell antibody display methods of the invention. The antibody-producing mammalian cell is provided to a mammalian subject (e.g., a human subject having cancer or otherwise in need thereof), and the antibody on the surface of the mammalian cell homes in to the tumor antigen and binds specifically thereto. Detection and localization of the antibody producing cell is determined by the detection of expression of the detectable protein moiety. Once the antibody producing mammalian cell is co-localized with (and bound to) the cell displaying the tumor antigen, expression of the cre recombinase is induced (such as with chemical means, light, oxygen, or other inductive means) such that the recombinase removes the nucleic acid encoding the transmembrane moiety of the fusion protein. In the absence of the transmembrane domain, the fusion protein will be directed into the ER by the leader peptide and secreted outside the cell as a soluble antibody. These secreted soluble antibodies will then act locally upon the target tumor cell. Optionally, the antibody producing mammalian display cell also contains a nucleic acid encoding a toxin, which is also produced by the mammalian display cell. This toxin may be operably linked to the soluble antibody.
  • EXAMPLES Example 1. Creation of Viral Display Vectors and Vector Systems
  • A viral display vector (outlined in FIG. 1) is constructed as follows. A nucleic acid molecule encoding a fusion protein is created by amplification of one or more candidate polypeptide-encoding inserts from a Mehta I/II library. Exemplary sFv inserts include “PS11”, which is an sFv that binds immunospecifically to the TRM motif on human cyclinT 1; “E46”, which is an sFv that binds immunospecifically to the arginine-rich region of HIV-1 tat protein; “A8”, which is an sFv that binds immunospecifically to the N-terminus of CCR5; and “anti-Tac”, which is an sFv that binds immunospecifically to CD25 (the alpha chain of IL-2R). These inserts are ligated downstream of a nucleic acid sequence encoding an immunoglobulin leader protein and upstream of a nucleic acid sequence encoding an immunoglobulin molecule containing the hinge, CH2, and CH3 regions of human IgG1, such that, when the expressed nucleic acids are translated, the candidate polypeptide is operably connected to the leader polypeptide and the immunoglobulin molecule. Expression of the nucleic acid molecule is controlled by a CMV promoter. Downstream of the nucleic acid encoding the immunoglobulin molecule is a nucleic acid sequence encoding the transmembrane moiety from gp41. A nucleic acid molecule encoding enhanced green fluorescent protein (eGFP) is provided downstream of an IRES that is controlled by the CMV promoter.
  • Protein expression analysis of the viral display vectors is performed by transiently transfecting 293T cells using transfection means known to those skilled in the art, such as POLYFECT™ transfection reagent, then performing Western blot analysis using an antibody specific for gp41. As shown in FIG. 4B, the fusion proteins of the invention are expressed in transiently transfected 293T cells. Lane 1 shows mock transfected cells (no DNA added); lane 2 shows expression of a fusion protein containing the PS11 sFv; lane 3 shows expression of a fusion protein containing the PS11 sFv, wherein the gp41 transmembrane moiety is flanked on either end by a loxP sequence; lane 4 shows expression of a fusion protein containing the E46 sFv; and lane 5 shows expression of a fusion protein containing the E46 sFv, wherein the gp41 transmembrane moiety is flanked on either end by a loxP sequence.
  • The localization of the fusion proteins to the plasma membrane is confirmed using FACS analysis. For example, goat-anti-human IgG (γ-chain specific) PE conjugate is useful to detect the cell surface expression of the sFv-IgG-gp41 fusion proteins. Results of a typical FACS analysis are provided in Table 3.
  • TABLE 3
    Transfection M1 % PE+ M1 Mean F M2 % PE+ M2 Mean F
    Mock 4.49 15.49 1.25 24.86
    transfection
    HXBC2 + pTat 11.32 15.97 3.92 23.83
    (control vector
    PS11-gp41 37.25 19.85 19.12 27.12
    PS11-lox-gp41 28.99 21.64 11.01 37.27
    E46-gp41 34.88 18.76 13.65 29.33
    E46-lox-gp41 30.53 21.84 11.95 37.12
    M1 = gate at 10;
    M2 = gate at 15
  • FACS analysis using fluorescently labeled antigens confirms that the fusion proteins expressed on the cell surface are capable of binding immunospecifically to target antigen. For example, biotinylated TRM peptide (2 mM, MW 4146.7, combined with Extravidin PE (Sigma E-4011)), was used in FACS experiments, the results of which are shown in Table 4. These results demonstrated that the PS11-containing fusion protein expressed on the surface of 293T cells is capable of binding to its target antigen.
  • TABLE 4
    1 uM 5 uM 25 uM 50 uM
    % % % %
    Transfection PE+ MFI PE+ MFI PE+ MFI PE+ MFI
    Mock 2.32 10.84 2.39 12.34 3.41 17.48 4.20 23.12
    PS11-gp41 15.76 13.17 19.82 12.95 20.58 13.62 26.31 14.85
    E46-gp41 4.61 10.24 5.06 10.53 6.73 13.08 9.55 15.92
    M1 = gate at 7
  • The helper vector pCMVΔR8.2 and an envelope vector are also shown in FIG. 1. The helper vector contains the gag, pol, tat and rev genes under the control of an ieCMV promoter.
  • The envelope vector contains the G protein of vesicular stomatitis virus (“VSV-G”), operably linked to the ieCMV promoter and An (a polyadenylation sequence).
  • Example 2. Antibody Display on Viral Capsids
  • A population of viral display vectors containing sFv inserts from a Mehta I/II library are co-transfected with a helper vector and an envelope vector into 293T cells using CaCl2 or POLYFECT™ transfection agent. Alternatively, a 293T cell line stably expressing VSV-g is used. To make fusion protein viral particles, 293T cells grown to 80%-100% confluence are transfected on a 10-cm plate with a transfection cocktail containing about 12 μg of viral display vector (1.0 μg/μl), about 12 μg of envelope vector (1.0 μg/μl), about 6 μg of helper vector pCMVΔR8.2 (0.5 μg/μl), 62 μl of 2M CaCl2 in 2×HeBS. Viral particle-containing supernatant (the master viral stock) is collected at about 37, and 61 hours after transfection, filtered and stored at −80° C. Alternatively, the master viral stock is collected at 48, 72 and 96 hours after transfection. When required, viral particle supernatant is concentrated by centrifugation at 17,000 rpm in an SW28 rotor for 2 h. The pellet is resuspended in 1/10 volume media. Viral particles are sorted by fluorescence assisted cell sorting (FACS) by detecting the eGFP. The multiplicity of infection (moi) is determined by infecting 293T cells, followed by flow cytometric quantification of eGFP-positive cells. Incorporation of the fusion protein into viral particles is measured using Western analysis. Viral stocks are concentrated by centrifugation and contacted with SDS-PAGE loading buffer, then separated by PAGE, transferred to membranes and blotted with anti-gp41 or anti-human IgG.
  • Specific binding of the fusion protein to target antigen is demonstrated by viral particle capture experiments. Target antigens are coated on multiwell plates, blocked (such as with 1% BSA), and incubated with viral particles prepared as described above. Reverse transcriptase activity, an indication of specific binding of the fusion protein to the target antigen, is determined using 3H and assigned a value (RT value). Results of a series of viral particle capture experiments is provided in Table 5, and demonstrates that lentiviral particles expressing PS11-containing fusion proteins bind specifically to their target antigens. Captured antigens were analyzed by SDS-PAGE and stained, as shown in FIG. 4C.
  • TABLE 5
    Hcyclin T1 antigens Control
    50 uM 3 ug 3 ug
    TRM GST-hCyclin Anti-human
    peptide T1-300 IgG-PE 3 ug GST 1% BSA
    Virus
    1 2 3 4 7 8 9 10 11 12
    PS11 10 ul* 10250 16085 1765 1635 1095 1780 1225 920 500 900
    PS11 30 ul 25955 32360 3675 5030 1135   95** 1560 1770 360 4620
    E46 10 ul* 1195 620 460 570 690 2065 1180 735 260 665
    E46 30 ul 1230 1465 590 825 1055 2000 1245 980 555 1300
    CMV 10 ul* 175 130 215 145 205  350 315 305 210 265
    CMV 30 ul 300 230 125 155 220  240 255 165 120 160
    *The total volume is equalized with addition of 20 ul media;
    **did not have 3H mix
  • Example 3. Mammalian Cell Antibody Display
  • The master viral stock is contacted with a suspension of mammalian display cells overnight at an MOI of about 1. The mammalian cells are sorted by FACS on the basis of binding to an anti-Fc antibody or, alternatively, eGFP content. The sorted mammalian cells are contacted with target antigens that have been tagged. Suitable tags include FITC, streptavidin/biotin, and paramagnetic beads (See FIG. 11). The sorted mammalian cells having bound antigen are then selected. Following selection, the population of selected cells is expanded in culture for subsequent rounds of selection. Alternatively, nucleic acids are obtained from the population of selected cells and the nucleic acid encoding the candidate polypeptide is amplified and inserted into a display vector for one or more additional rounds of selection. To obtain the sequence of the candidate polypeptide of interest that binds to antigen, the selected cells are lysed and the nucleic acid sequences encoding the candidate polypeptides contained within the antigen-bound mammalian cells are cloned into a vector and then sequenced. Experiments were performed to demonstrate the cell surface expression of fusion proteins on the surface of 293T mammalian display cells. 1×106 293T cells were seeded on 6 well multiwell plates. The cells were co-transfected with two vectors, a vector expressing a fusion protein containing a candidate polypeptide of the invention, and a vector expressing GFP under the control of a CMV promoter, as shown in Table 6, using lipofectamine. About 48 hours after transfection, the transfected cells were harvested with 0.5 mM EDTA.
  • TABLE 6
    CMV- % % APC
    Sample GFP GFP MFI APC MFI
    1. Untransfected cells 1.15 5.4 24.2 32
    2. pCDNA3 4 μg 0.2 μg 98.5 1340 16.3 30
    3. pCDNA3-CMV-PS11- 4 μg 0.2 μg 45 551 90.65 261
    Fc-gp41
    4. pCDNA3-CMV-GFP 4 μg 0.2 μg 99.66 3895 16 42
    5. pCDNA3-CMV-PS11- 4 μg 0.2 μg 99.5 1818 98.9 182
    Fc-C9-gp41(1-50) #10
    6. pCDNA3-CMV-PS11- 4 μg 0.2 μg 97.7 1057 97.5 1523
    Fc-C9-CD8 #7
    7. pCDNA3-CMV-PS11- 4 μg 0.2 μg 50 241 96.8 196
    Fc-C9-gp41FL #1
    8. pCDNA3-CMV-PS11- 4 μg 0.2 μg 89.3 932 95.5 1660
    Fc-C9-CD28 #3

    Harvested transfected cells were analyzed for GFP expression and were stained with an anti-human Ig-APC conjugate to demonstrate Fc cell surface expression.
  • Sample 1 contains untransfected cells. Sample 2 contains the pCDNA vector with no insert. Sample 3 contains pCDNA3-CMV-PS11-Fc-gp41 without the C9 tag. Sample 4 contains a GFP control insert. Sample 5 contains a part of the lentiviral gp41 transmembrane region (corresponding to amino acids 1-50 of the TM region). Sample 6 contains the human CD8 transmembrane region. Sample 7 contains a full-length lentiviral gp41 transmembrane region. Sample 8 contains the human CD28 transmembrane region.
  • As shown in FIG. 12D, the CD8 and CD28 transmembrane regions result in robust targeting of the fusion protein to the surface of the display cells.
  • Additional experiments were performed to demonstrate the cell surface expression of fusion proteins on the surface of 293T mammalian display cells. 1×106 293T cells were seeded on 6 well multiwell plates. The cells were co-transfected with a multi-functional vector containing an IRES, as shown in Table 7, using lipofectamine. About 48 hours after transfection, the transfected cells were harvested with 0.5 mM EDTA.
  • TABLE 7
    CMV- % MFI %
    Sample DNA GFP pCDNA3 GFP GFP APC
    1. Untransfected cells- 9.8 8 24.2
    APC stain
    2. pSIN-delta gp41- 4 μg 0.2 μg 99 3895 15.6
    CMV-GFP
    3. pSIN-mdeltaU3- 4 μg 0.2 μg 15 22 86.3
    CMV-PS11-Fc-gp41-
    IRES-ZsGreen-clone
    3.4
    4. pSIN-mdeltaU3- 4 μg 0.2 μg 12 12 88.2
    CMV-PS11-Fc-gp41-
    IRES-GFP (#3)
    5. pSIN-mdeltaU3- 4 μg 0.2 μg 86.1 139 90.3
    CMV-PS11-Fc-gp41-
    IRES-ZsGreen-clone
    #
    5

    Harvested transfected cells were analyzed for GFP expression and were stained with an anti-human Ig-APC conjugate to demonstrate Fc cell surface expression.
  • Sample 1 contains untransfected cells. Sample 2 contains the pSIN vector expressing GFP under the control of a CMV promoter. Sample 3 contains pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-ZsGreen, where the IRES sequence was obtained from the pSIN-deltaU3-CMV-PS11-Fc-gp41-IRES-GFP vector. Sample 4 contains the pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-GFP, thereby expressing GFP. Sample 5 contains the pSIN-mdeltaU3-CMV-PS11-Fc-gp41-IRES-ZsGreen, where the IRES sequence was obtained from the IRES sequence originated from the HA-ZsGreens vector. In samples 3-5 the transmembrane region is the full length lentiviral gp41 transmembrane domain.
  • As shown in FIG. 13D, the multifunctional vectors of the present invention result in robust targeting of the fusion protein to the surface of the display cells.
  • Example 4. Affinity Selection of Human Antibodies
  • Selected antigen-bound mammalian cells are separated from unbound mammalian cells and expanded in culture to increase the number of mammalian cells producing a target antigen-specific antibody. The antibody display method of Example 4 is repeated with the concentration of target antigens reduced by 50%, 90%, 95%, 99%, 99.9%, 99.99% or more. For example, a antigen concentration of about 200 ng/ml is used in the first round of selection, and this concentration is reduced to about 1 ng/ml in a second round of selection.
  • Example 5. Affinity Maturation of Human Antibodies
  • It is desirable to identify candidate polypeptides, such as antibodies, that bind to a target antigen with very high specificity and very high binding affinity (low Kd). The present invention provides for the generation of high specificity antibodies by affinity maturation.
  • One method of affinity maturation involves the use of display cell lines that have a higher rate of mutation. An example of a mutation prone cell line is a lymphoma cell line, e.g., the Ramos Burkitt's lymphoma cell line. Mammalian cells expressing antibodies from mutated fusion proteins having increased affinity for the target antigen are selected using the display affinity selection methods described above in Example 4.
  • Another method of affinity maturation involves the induction of expression of a activation-induced cytosine deaminase (AID) protein in the display cells. Increased AID activity results in higher mutation rates in the candidate polypeptides. The viral display vector shown in FIG. 1 can be modified to include a nucleic acid molecule encoding the AID protein under the control of a promoter. Alternatively, the invention provides display cells having stably integrated the AID gene under the control of a constitutive or an inducible promoter.
  • Example 6. Induction of Antibody Expression
  • The viral display vector generated in Example 1 is modified by insertion of a tetR inducible element. Two tetO sequence concatamers are fused to the CMV minimal promoter. A tetR sequence is inserted downstream of the nucleic acid encoding the fusion protein of the invention. Thus, production of the fusion protein is regulated by addition of tetracycline.
  • Example 7. Quantitation of Antibody Cell Surface Expression Using a C9 Tag
  • The present invention provides methods for determining the density of antibodies expressed on the surface of displaying mammalian cells. Quantitation of antibody cell surface expression allows for the determination of efficiency of antibody display, as well as the refinement of expression levels, e.g., by altering promoters and/or enhancers in the viral display vector.
  • Antibody cell surface expression quantitation is performed using a tag contained in the expressed fusion protein. Alternatively, quantitation is performed using labeled peptides (such as biotinylated peptides) that bind to single chain antibodies. Any tag capable of being detected with an entity that can be measured by any means (e.g., FACS) can be used in the present invention. One exemplary tag is the C9 peptide tag (GGTETSQVAPA, SEQ ID NO: 16). The C9 tag is recognized by the monoclonal antibody 1D4. Any means capable of detecting this antibody, such as FACS, can be used to quantitate expression levels. The C9 tag is located C terminal to the portion of immunoglobulin molecule and N terminal to the transmembrane moiety. In embodiments of the invention the C9 tag is connected to the portion of immunoglobulin molecule by a linker (e.g., a flexible linker such as SGGSS (SEQ ID NO: 17)). The C9 tag is linked to the C terminus of the linker by insertion of an XbaI site at the C terminus of the linker (which encodes the single amino acid arginine (R)). Exemplary viral display vectors containing the C9 linker are provided below in Table 8. The extracellular region of gp41 has 18 residues, the transmembrane region has 24 residues, and the intracellular region has 8 residues (the gp41 tag of SEQ ID NO: 14). Display vector 4 encodes a truncated gp41 polypeptide containing amino acids 1-50, while display vector 6 encodes the full length gp41 polypeptide. The extracellular region of CD8 has 12 residues, the transmembrane region has 21 residues, and the intracellular region has 11 residues (LYCNHRNRRRV; SEQ ID NO: 17). The extracellular region of CD28 has 39 residues, the transmembrane region has 27 residues, and the intracellular region has 13 residues. As a control, a pCDNA3 vector without the nucleic acid sequence encoding the fusion protein was used. scFv-48 is a single chain antibody against human CXCR4.
  • TABLE 8
    Viral display vector DNA % C9 Tag MFI
    1. pCDNA 3 ID4 stain 4 μg 1.2 8.3
    2. pCDNA3 - ID4 + anti Mouse FITC 4 μg 4.5 162
    3. pCDNA3-scFv-48-C9-CD28 4 μg 96 378
    4. pCDNA3-CMV-PS11-Fc-C9-gp41(1-50) #10 4 μg 97.7 515
    5. pCDNA3-CMV-PS11-Fc-C9-CD8 #7 4 μg 97 478
    6. pCDNA3-CMV-PS11-Fc-C9-gp41FL #1 4 μg 94 695
    7. pCDNA3-CMV-PS11-Fc-C9-CD28 #3 4 μg 97 470
  • A typical antibody cell surface expression quantitation was performed as follows. 293T cells were seeded about 24 hours before transfection on 6 well plates (1×106 cells per well). Viral display vector DNA (4 ug) was transfected using Lipofectamine 2000™. About 48 hours after transfection, cells were harvested for FACS analysis, using 0.5 mM EDTA. For antibody detection, a primary α-C9 antibody (ID4) was used at a concentration of 2 μl per 1×105 cells and a secondary α-mouse IgG-FITC labeled antibody was used at a 1:50 dilution. FACS analysis was performed as described above and known in the art. Results of this analysis are shown in FIGS. 14 and 15. FIG. 14A shows the percentage of cells that were positive for C9 tag expression as measured by FACS. The great majority (94% or more) of cells expressing fusion constructs containing C9 are identified using FACS, while very low levels of positive cells were seen in populations of cells transfected with control vectors lacking the C9 tag. FIG. 14B shows the mean fluorescence intensity (MFI) values for cells transfected with the viral display vectors listed in Table 8. The expression of fusion proteins containing either the truncated or full length gp41 polypeptide, and proteins containing either CD8 or CD28 transmembrane domains was quantitated by measuring MFI values in transfected cells. FIGS. 15A-G display the FACS plot for cells transfected with the viral display vectors described in Table 8.
  • Example 8. Quantitation of Antibody Cell Surface Expression in Constructs Containing Envelope Incorporation Signals
  • The present invention provides fusion viral display vectors that contain the gp41 envelope (env) incorporation signal. FIG. 16 demonstrates several fusion protein constructs. Construct 1 contains amino acids 1-50 of the gp41 TM region. Construct 2 contains the CD8 transmembrane domain. Construct 3 contains the CD28 transmembrane domain. Construct 4 contains the CD8 transmembrane domain operably linked to the gp41 env incorporation signal. Construct 3 contains the CD28 transmembrane domain operably linked to the gp41 env incorporation signal. The constructs listed in Table 9 were transfected into 293T cells as follows. 293T cells were seeded on 6 well plates (1×106/well). Cells were transfected using lipofectamine and 48 hours post transfection, cells were harvested with 5 mM EDTA and analyzed for GFP and Fc-surface expression using α-human-IgG-APC. Results are shown in FIGS. 17 and 18, and demonstrate that the CD8, CD28, and gp41 TM domains result in substantial cell surface expression of the transfected fusion protein; CD8 and CD28 in the presence of absence of the envelope incorporation signal, give higher levels of cell surface expression than gp41 TM.
  • TABLE 9
    CMV- % % APC
    GFP GFP MFI APC MFI
    1. Untransfected cells 1.3 29 1.2 170
    2. pCDNA3 + APC 4 μg 0.1 μg 51 522 1.27 246
    3. pCDNA3-CMV-GFP + APC 4 μg 0.1 μg 62 2581 4.2 110
    4. pCDNA3-CMV-PS11-Fc-C9- 4 μg 0.1 μg 56 841 63 233
    gp41FL #1
    5. pCDNA3-CMV-PS11-Fc-C9-gp41(1-50) 4 μg 0.1 μg 42 471 76 822
    # 5-1
    6. pCDNA3-CMV-PS11-Fc-C9-CD8 4 μg 0.1 μg 42 874 89 3773
    # 2-4
    7. pCDNA3-CMV-PS11-FC-C9-CD28 4 μg 0.1 μg 51 1024 94 3738
    # 3-4
    8. pCDNA3-CMV-PS11-Fc-C9-CD28-gp41 4 μg 0.1 μg 43 925 94 3846
    Tag # 4-5
    9. pCDNA3-CMV-PS11-Fc-C9-CD8-gp41 4 μg 0.1 μg 46 851 91 4177
    Tag # 6-5
  • Example 9. Antibody Cell Surface Expression in Cells Transfected with Lentiviral Vectors
  • Viral display constructs (listed in Table 10) containing either truncated (amino acids 1-50) or full-length gp41 TM, CD8 TM or CD28 TM, were introduced into the pSIN lentiviral display vector to confirm the expression of the fusion proteins on the surface of mammalian cells. The lentiviral vectors contain a form of GFP, ZsGreen, to aid in detection, and were transfected into 293T cells as described above. Results are shown in FIGS. 19 and 20, and demonstrate that the viral display constructs contained in lentiviral vectors are efficiently expressed in 293T cells and result in cell surface expression of the fusion proteins.
  • TABLE 10
    CMV- % MFI % MFI
    DNA GFP pCDNA3 GFP GFP APC APC
    1. pCDNA3 + APC 4 μg 0.2 μg 51 322 1.27 246
    2. pSIN-delta gp41-CMV-GFP 4 μg 49 1855 2.5 131
    3. pSIN-mdeltaU3-CMV-PS11- 4 μg 0.2 μg 42 231 35 164
    Fc-gp41(1-50)-IRES-
    ZsGreen-done 2A
    4. pSIN-mdeltaU3-CMV- 4 μg 0.2 μg 33 398 90 3410
    PS11-Fc-CD8-IRES-
    ZsGreen-done 4A
    5. pSIN-mdeltaU3-CMV- 4 μg 0.2 μg 34 309 85 3276
    PS11-Fc-CD28-IRES-
    ZsGreen-done 5A
    6. pSIN-mdeltaU3-CMV- 4 μg 0.2 μg 45 322 54 313
    PS11-Fc-gp41(FL)-IRES-
    ZsGreen-done 5
  • EQUIVALENTS
  • Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, numerous equivalents to the specific procedures described herein. Such equivalents are considered to be within the scope of the present invention and are covered by the following claims. The contents of all references, issued patents, and published patent applications cited throughout this application are hereby incorporated by reference. The appropriate components, processes, and methods of those patents, applications and other documents may be selected for the present invention and embodiments thereof.

Claims (72)

What is claimed is:
1. A method of displaying a candidate polypeptide on the surface of a mammalian cell, comprising the steps of:
a) contacting a packaging cell with a viral display vector comprising a nucleic acid sequence encoding a fusion protein under conditions such that said packaging cell generates one or more viral particles comprising said nucleic acid sequence, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule;
iv) a transmembrane moiety; and
b) contacting said viral particles with a mammalian cell, under conditions sufficient to express said fusion protein in said mammalian cell, wherein said candidate polypeptide is displayed on the surface of the mammalian cell.
2. The method of claim 1, wherein said immunoglobulin molecule is further displayed on the surface of the mammalian cell.
3. The method of claim 1, wherein said immunoglobulin molecule comprises the hinge region, the CH2 region or the CH3 region of an IgG molecule or a combination thereof.
4. The method of claim 1, wherein said viral display vector is a lentiviral vector.
5. The method of claim 1, wherein said candidate polypeptide is an antibody or fragment thereof.
6. The method of claim 5, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
7. The method of claim 1, wherein said candidate polypeptide is derived from a library.
8. The method of claim 4, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
9. The method of claim 1, wherein said packaging cell further comprises;
(i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and;
(ii) a helper vector comprising one or more viral structural genes.
10. The method of claim 1, wherein said candidate polypeptide is expressed on the surface of said viral particles prior to contacting said viral particles with said mammalian cell.
11. The method of claim 1, wherein said transmembrane moiety is a viral transmembrane moiety or a mammalian transmembrane moiety.
12. The method of claim 1, wherein said mammalian cell is a Ramos Burkitt's lymphoma cell.
13. A method of displaying a candidate polypeptide on the surface of a viral particle, comprising the step of contacting a packaging cell with a viral display vector comprising a nucleic acid sequence encoding a fusion protein under conditions such that said packaging cell generates one or more viral particles comprising the fusion protein, such that said candidate polypeptide is displayed on the surface of the viral particle, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule;
iv) a transmembrane moiety; and
v) an envelope incorporation signal.
14. The method of claim 13, wherein said candidate polypeptide is an antibody or fragment thereof.
15. The method of claim 14, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
16. The method of claim 13, wherein said candidate polypeptide is derived from a library.
17. The method of claim 13, wherein said viral display vector is a lentiviral vector.
18. The method of claim 17, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
19. The method of claim 13, wherein said immunoglobulin molecule comprises the hinge region, the CH2 region or the CH3 region of an IgG molecule or a combination thereof.
20. The method of claim 13, wherein said transmembrane moiety is a viral transmembrane moiety or a mammalian transmembrane moiety
21. The method of claim 13, wherein said packaging cell further comprises;
(i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and;
(ii) a helper vector comprising one or more viral structural genes.
22. A method of identifying a candidate polypeptide that binds to a target antigen, comprising the steps of:
a) contacting a packaging cell with a nucleic acid vector comprising a nucleic acid sequence encoding a fusion protein under conditions such said packaging cell generates one or more viral particles comprising said nucleic acid sequence, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule; and
iv) a transmembrane moiety, and
b) contacting said viral particles with one or more mammalian cells, under conditions such that said one or more mammalian cells each generate a single species of said candidate polypeptide displayed on the surface of said mammalian cells;
c) sorting said mammalian cells displaying said single species of said candidate polypeptide on the surface of said mammalian cell;
d) contacting said sorted mammalian cells with a target antigen; and
e) identifying the mammalian cells that bind to said target antigen, thereby identifying a candidate polypeptide that binds to said target antigen.
23. The method of claim 22, further comprising repeating steps d) and e) one or more times.
24. The method of claim 22, wherein said packaging cell further comprises;
(i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and;
(ii) a helper vector comprising one or more viral structural genes.
25. The method of claim 22, wherein said candidate polypeptide is an antibody or fragment thereof.
26. The method of claim 22, wherein said candidate polypeptide is derived from a library.
27. The method of claim 28, wherein said viral display vector is a lentiviral vector.
28. The method of claim 27, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
29. The method of claim 22, wherein said nucleic acid vector further comprises an nucleic acid encoding a selectable marker.
30. The method of claim 29, wherein said selectable marker is selected from the group consisting of a green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a luciferase protein and a aequorin protein.
31. The method of claim 22, wherein said transmembrane moiety is a viral transmembrane moiety or mammalian transmembrane moiety.
32. A method of affinity maturing a candidate polypeptide, comprising the steps of:
a) contacting a packaging cell with a nucleic acid vector comprising a nucleic acid sequence encoding a fusion protein, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule; and
iv) a transmembrane moiety
under conditions such that the packaging cell generates one or more viral particles comprising said nucleic acid sequence;
b) contacting said one or more viral particles with one or more second mammalian cells, under conditions such that said one or more mammalian cells each generate a single species of candidate polypeptide that is displayed on the surface of said one or more mammalian cells;
c) sorting said one or more mammalian cells displaying said single species of candidate polypeptide on the surface of said mammalian cell;
d) contacting said sorted one or more mammalian cells with a target antigen;
e) identifying those mammalian cells that bind to said target antigen;
f) contacting said identified mammalian cells with a decreasing concentration of said target antigen; and
g) repeating steps e) and f) one or more times,
thereby affinity maturing a candidate polypeptide that binds to said target antigen.
33. The method of claim 32, wherein said packaging cell further comprises;
(i) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and;
(ii) a helper vector comprising one or more viral structural genes.
34. The method of claim 32, wherein said mammalian cells express activation-induced cytosine deaminase (AID) protein.
35. The method of claim 32, wherein said mammalian cells are Ramos Burkitt's lymphoma cells.
36. The method of claim 32, wherein said candidate polypeptide is derived from a library.
37. The method of claim 32, wherein said viral display vector is a lentiviral vector.
38. The method of claim 32, wherein said candidate polypeptide is an antibody or fragment thereof
39. The method of claim 37, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
40. The method of claim 37, wherein said nucleic acid vector further comprises a selectable marker.
41. The method of claim 40, wherein said selectable marker is selected from the group consisting of a green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a luciferase protein and a aequorin protein.
42. A method of producing a soluble candidate polypeptide, comprising the step of:
a) contacting a packaging cell comprising with a viral display vector under conditions such that said packaging cell generates one or more viral particles, wherein said viral vector comprises:
i) a first a nucleic acid sequence encoding a fusion protein comprising:
a) a leader peptide;
b) a candidate polypeptide;
c) at least a portion of an immunoglobulin molecule; and
d) a transmembrane moiety flanked by a loxP sites
ii) a second nucleic acid sequence encoding a cre recombinase polypeptide, operably linked to an inducible promoter,
b) contacting said viral particles with a mammalian cell, under conditions sufficient to express said fusion protein and said cre recombinase in said mammalian cell, whereby a soluble candidate polypeptide is produced by said mammalian cell.
43. The method of claim 42, wherein said candidate polypeptide is an antibody.
44. The method of claim 43, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
45. The method of claim 42, wherein said candidate polypeptide is derived from a library.
46. The method of claim 42, wherein said viral display vector is a lentiviral vector.
47. The method of claim 46, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
48. A viral display vector comprising a first nucleic acid sequence encoding a fusion protein comprising:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule; and
iv) a transmembrane moiety; and
49. The method of claim 48, wherein said immunoglobulin molecule comprises the hinge region, the CH2 region or the CH3 region of an IgG molecule or a combination thereof.
50. The method of claim 48, wherein said candidate polypeptide is an antibody or fragment thereof.
51. The method of claim 50, wherein said antibody is a single chain antibody, a domain antibody, a diabody, or Fab fragment.
52. The method of claim 48, wherein said candidate polypeptide is derived from a library.
53. The method of claim 48, wherein said viral display vector is a lentiviral vector.
54. The method of claim 53, wherein said lentiviral vector is obtained from a lentivirus selected from the group consisting of human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), equine infectious anemia virus (EIAV), visna virus, caprine arthritis-encephalitis virus (CAEV), bovine immune deficiency virus (BIV), bovine leukemia virus (BLV), and feline immunodeficiency virus (FIV).
55. The viral display vector of claim 48, wherein said first nucleic acid further comprises a selectable marker.
56. The viral display vector of claim 55, wherein said selectable marker is a bioluminescent protein moiety.
57. The viral display vector of claim 56, wherein said bioluminescent protein moiety is selected from the group consisting of a green fluorescent protein, a red fluorescent protein, a yellow fluorescent protein, a blue fluorescent protein, a ferredoxin IV protein, a luciferase protein and a aequorin protein.
58. The viral display vector of claim 53, further comprising two or more loxP sites, wherein said loxP sites flank said transmembrane moiety,
59. The viral display vector of claim 53, further comprising a second nucleic acid sequence encoding a cre recombinase protein operably linked to an inducible promoter.
60. The viral display vector of claim 53, wherein said first nucleic acid sequence is operably linked to an inducible promoter.
61. The viral display vector of claim 60, wherein said inducible promoter is selected from the group consisting of a tetracycline inducible promoter, an alcohol inducible promoter, a steroid inducible promoter, a metal inducible promoter, a light inducible promoter, and a temperature inducible promoter.
62. A vector system, comprising:
a) the viral display vector of claim 53;
b) an envelope vector comprising an env gene operably linked to a promoter and a polyadenylation sequence wherein said env gene encodes a functional envelope protein and;
(c) a helper vector comprising one or more viral structural genes.
63. The vector system of claim 62, wherein said env gene comprises a vesicular stomatitis virus glycoprotein gene.
64. The vector system of claim 62, wherein said one or more viral structural genes are selected from the group consisting of gag, pol, tat, and rev.
65. A nucleic acid viral targeting vector comprising:
a) a first nucleic acid sequence encoding a fusion protein, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule; and
iv) a transmembrane moiety flanked by a loxP;
b) a second nucleic acid sequence comprising a toxin
c) a third nucleic acid sequence encoding cre recombinase operably linked to an inducible promoter; and
d) a fourth nucleic acid sequence encoding an entry moiety.
66. The viral targeting vector of claim 65, wherein said entry moiety is selected from the group consisting of a viral envelope protein, a eukaryotic protein having fusogenic activity, a binding-defective hemagglutinin protein, and a binding-defective influenza hemagglutinin protein.
67. A nucleic acid viral targeting vector comprising:
a) a first nucleic acid sequence encoding a fusion protein, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule;
iv) a toxin; and
v) a transmembrane moiety flanked by a loxP;
b) a second nucleic acid sequence encoding cre recombinase operably linked to an inducible promoter; and
c) a third nucleic acid sequence encoding an entry moiety.
68. The viral targeting vector of claim 67, wherein said entry moiety is selected from the group consisting of a viral envelope protein, a eukaryotic protein having fusogenic activity, a binding-defective hemagglutinin protein, and a binding-defective influenza hemagglutinin protein.
69. A method for the targeted delivery of a nucleic acid sequence in a subject, wherein said nucleic acid sequence encodes a fusion protein, wherein said fusion protein comprises:
i) a leader peptide;
ii) a candidate polypeptide;
iii) at least a portion of an immunoglobulin molecule;
iv) a transmembrane moiety; and
v) an entry moiety,
wherein the nucleic acid is expressed on the surface of a viral particle, and wherein the candidate polypeptide specifically binds to a target cell surface antigen, the method comprising introducing said viral particle into the subject, such that said viral particle contacts a cell expressing said target cell surface antigen under conditions such that said candidate polypeptide selectively binds to said cell and said nucleic acid transduces said cell.
70. The viral targeting vector of claim 69, wherein said entry moiety is selected from the group consisting of a viral envelope protein, a eukaryotic protein having fusogenic activity, a binding-defective hemagglutinin protein, and a binding-defective influenza hemagglutinin protein.
71. The method of claim 22, wherein said one or more mammalian cells express a calcium-sensitive bioluminescent protein.
72. The method of claim 71, wherein said calcium-sensitive bioluminescent protein is aequorin.
US15/935,939 2004-07-21 2018-03-26 Lentiviral vectors and uses thereof Abandoned US20180327782A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/935,939 US20180327782A1 (en) 2004-07-21 2018-03-26 Lentiviral vectors and uses thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US58961004P 2004-07-21 2004-07-21
US11/135,235 US8828727B2 (en) 2004-07-21 2005-05-23 Lentiviral vectors and uses thereof
US14/449,898 US20150031756A1 (en) 2004-07-21 2014-08-01 Lentiviral vectors and uses thereof
US15/935,939 US20180327782A1 (en) 2004-07-21 2018-03-26 Lentiviral vectors and uses thereof

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US14/449,898 Continuation US20150031756A1 (en) 2004-07-21 2014-08-01 Lentiviral vectors and uses thereof

Publications (1)

Publication Number Publication Date
US20180327782A1 true US20180327782A1 (en) 2018-11-15

Family

ID=35967995

Family Applications (3)

Application Number Title Priority Date Filing Date
US11/135,235 Expired - Fee Related US8828727B2 (en) 2004-07-21 2005-05-23 Lentiviral vectors and uses thereof
US14/449,898 Abandoned US20150031756A1 (en) 2004-07-21 2014-08-01 Lentiviral vectors and uses thereof
US15/935,939 Abandoned US20180327782A1 (en) 2004-07-21 2018-03-26 Lentiviral vectors and uses thereof

Family Applications Before (2)

Application Number Title Priority Date Filing Date
US11/135,235 Expired - Fee Related US8828727B2 (en) 2004-07-21 2005-05-23 Lentiviral vectors and uses thereof
US14/449,898 Abandoned US20150031756A1 (en) 2004-07-21 2014-08-01 Lentiviral vectors and uses thereof

Country Status (7)

Country Link
US (3) US8828727B2 (en)
EP (1) EP1784506B1 (en)
JP (1) JP4956427B2 (en)
AT (1) ATE478965T1 (en)
CA (1) CA2574282A1 (en)
DE (1) DE602005023181D1 (en)
WO (1) WO2006022944A2 (en)

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006089001A2 (en) * 2005-02-16 2006-08-24 Lentigen Corporation Lentiviral vectors and their use
CA2625619A1 (en) 2005-10-14 2007-04-26 Medimmune, Inc. Cell display of antibody libraries
CN101970483A (en) 2007-12-06 2011-02-09 达纳-法伯癌症研究公司 Antibodies against influenza virus and methods of use thereof
EP2096121A1 (en) * 2008-02-29 2009-09-02 Institut Pasteur Of Shanghai Antiviral peptides comprising lipid attachment signals and methods of use
EP2112164A1 (en) * 2008-04-23 2009-10-28 Institut Pasteur Of Shanghai Antiviral peptides comprising lipid attachment signals and methods of use
EP2098536A1 (en) 2008-03-05 2009-09-09 4-Antibody AG Isolation and identification of antigen- or ligand-specific binding proteins
EP2218784A1 (en) * 2009-02-04 2010-08-18 Universität Leipzig Vector(s) containing an inducible gene encoding a CDK4/CD6 inhibitor useful for treating neurodegenerative disorders
FR2981946B1 (en) * 2011-10-28 2015-02-20 Lfb Biotechnologies TRANSCRIPTION UNITS AND THEIR USE IN EXPRESSION VECTORS (YB2 / 0)
WO2016176652A2 (en) 2015-04-29 2016-11-03 Fred Hutchinson Cancer Research Center Modified stem cells and uses thereof
CN106754756B (en) * 2015-11-23 2020-01-14 中国科学院武汉物理与数学研究所 Simplex forest virus replicon for rapidly marking nerve cells of non-human primate and application thereof
EP3235828A1 (en) * 2016-04-21 2017-10-25 Genethon Stable pseudotyped lentiviral particles and uses thereof
KR20240073085A (en) * 2017-05-10 2024-05-24 파마 싱크, 엘엘씨 Enveloped virus resistant to complement inactivation for the treatment of cancer
KR102284949B1 (en) 2017-06-16 2021-08-03 에스케이이노베이션 주식회사 Fouling inhibition methdo and oligomerisation of olefin

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5665577A (en) * 1989-02-06 1997-09-09 Dana-Farber Cancer Institute Vectors containing HIV packaging sequences, packaging defective HIV vectors, and uses thereof
JPH08504091A (en) * 1992-09-22 1996-05-07 メディカル・リサーチ・カウンシル Recombinant virus displaying non-viral polypeptides on the outer surface
EP0672129A4 (en) * 1992-11-20 1997-06-11 Univ New Jersey Med Cell-type specific gene transfer using retroviral vectors containing antibody-envelope fusion proteins.
US6506604B2 (en) * 1993-06-11 2003-01-14 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US5834256A (en) 1993-06-11 1998-11-10 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
US6051427A (en) * 1993-06-11 2000-04-18 Cell Genesys, Inc. Method for production of high titer virus and high efficiency retroviral mediated transduction of mammalian cells
IT1261847B (en) 1993-09-01 1996-06-03 San Romanello Centro Fond METHOD FOR MARKING EUCARIOT CELLS.
NZ284800A (en) 1994-04-13 1998-02-26 Rossignol Jean Francois 2-hydroxy-n-(5-nitro-thiazol-2-yl)-benzamide, medicaments particularly in conjunction with the acetylated form
US5656465A (en) * 1994-05-04 1997-08-12 Therion Biologics Corporation Methods of in vivo gene delivery
EP0857217B1 (en) 1995-10-16 2005-04-13 Dana-Farber Cancer Institute Novel expression vectors and methods of use
US7276488B2 (en) 1997-06-04 2007-10-02 Oxford Biomedica (Uk) Limited Vector system
US7262049B2 (en) 1999-03-16 2007-08-28 Dana-Farber Cancer Institute, Inc. Pseudotyped lentiviral vectors and uses thereof
CA2380991A1 (en) 1999-08-13 2001-02-22 The Rockfeller University Protective antigen of epstein barr virus
US20050048578A1 (en) * 2003-06-26 2005-03-03 Epitomics, Inc. Methods of screening for monoclonal antibodies with desirable activity

Also Published As

Publication number Publication date
ATE478965T1 (en) 2010-09-15
JP4956427B2 (en) 2012-06-20
US20150031756A1 (en) 2015-01-29
JP2008507272A (en) 2008-03-13
WO2006022944A3 (en) 2006-08-17
EP1784506B1 (en) 2010-08-25
EP1784506A2 (en) 2007-05-16
EP1784506A4 (en) 2008-05-07
US8828727B2 (en) 2014-09-09
DE602005023181D1 (en) 2010-10-07
WO2006022944A2 (en) 2006-03-02
US20060019395A1 (en) 2006-01-26
CA2574282A1 (en) 2006-03-02

Similar Documents

Publication Publication Date Title
US20180327782A1 (en) Lentiviral vectors and uses thereof
US11667929B2 (en) Retroviral vectors
JP7237960B2 (en) An adapter-based retroviral vector system for selective transduction of target cells
US8222188B2 (en) Antibody libraries
JP2002538842A (en) Lentiviral vector system for high volume screening
JP2009519715A (en) Compositions and methods for controlled gene expression using viral vectors
US20140227786A1 (en) Retroviral Vector Particles and Methods for their Generation and Use
Tolu et al. A versatile system for the neuronal subtype specific expression of lentiviral vectors
US20140018521A1 (en) Methods for the identification and repair of amino acid residues destabilizing single-chain variable fragments (scFv)
WO2022204071A1 (en) Method to assess potency of viral vector particles
JP7410983B2 (en) Method for the generation of protein-expressing cells by targeted integration using Cre mRNA
US20220169729A1 (en) Method for the generation of a trivalent antibody expressing cell by targeted integration of multiple expression cassettes in a defined organization
JP2022537333A (en) Methods for generating multivalent, multispecific antibody-expressing cells by targeted integration of multiple expression cassettes of defined configuration
CN114008081A (en) Method for generating bivalent bispecific antibody-expressing cells by targeted integration of multiple expression cassettes in defined tissue format

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

AS Assignment

Owner name: DANA-FARBER CANCER INSTITUTE, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:MARASCO, WAYNE A.;REEL/FRAME:054493/0882

Effective date: 20050729

STPP Information on status: patent application and granting procedure in general

Free format text: NON FINAL ACTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION