US20180187155A1 - Compositions and methods related to multimodal therapeutic cell systems for autoimmune indications - Google Patents
Compositions and methods related to multimodal therapeutic cell systems for autoimmune indications Download PDFInfo
- Publication number
- US20180187155A1 US20180187155A1 US15/905,445 US201815905445A US2018187155A1 US 20180187155 A1 US20180187155 A1 US 20180187155A1 US 201815905445 A US201815905445 A US 201815905445A US 2018187155 A1 US2018187155 A1 US 2018187155A1
- Authority
- US
- United States
- Prior art keywords
- cell
- exogenous polypeptide
- polypeptide
- target
- exogenous
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 39
- 230000001225 therapeutic effect Effects 0.000 title abstract description 22
- 239000000203 mixture Substances 0.000 title abstract description 20
- 230000001363 autoimmune Effects 0.000 title description 9
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 601
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 588
- 229920001184 polypeptide Polymers 0.000 claims description 579
- 210000004027 cell Anatomy 0.000 claims description 183
- 210000003743 erythrocyte Anatomy 0.000 claims description 177
- 210000000267 erythroid cell Anatomy 0.000 claims description 146
- 239000012634 fragment Substances 0.000 claims description 104
- 150000007523 nucleic acids Chemical class 0.000 claims description 47
- 210000001995 reticulocyte Anatomy 0.000 claims description 41
- 108020004707 nucleic acids Proteins 0.000 claims description 38
- 102000039446 nucleic acids Human genes 0.000 claims description 38
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 37
- 239000012528 membrane Substances 0.000 claims description 23
- 210000002865 immune cell Anatomy 0.000 claims description 21
- 238000004519 manufacturing process Methods 0.000 claims description 13
- 239000002243 precursor Substances 0.000 claims description 11
- 230000028993 immune response Effects 0.000 claims description 9
- 230000003204 osmotic effect Effects 0.000 claims description 8
- 230000003834 intracellular effect Effects 0.000 claims description 6
- 108010045579 Desmoglein 1 Proteins 0.000 claims description 4
- 102000007577 Desmoglein 3 Human genes 0.000 claims description 4
- 108010032035 Desmoglein 3 Proteins 0.000 claims description 4
- 230000007159 enucleation Effects 0.000 claims description 4
- 201000011152 Pemphigus Diseases 0.000 claims description 3
- 201000001976 pemphigus vulgaris Diseases 0.000 claims description 3
- 239000000825 pharmaceutical preparation Substances 0.000 claims description 3
- 230000008569 process Effects 0.000 claims description 3
- 102000005708 Desmoglein 1 Human genes 0.000 claims 3
- 238000012258 culturing Methods 0.000 claims 2
- 239000008194 pharmaceutical composition Substances 0.000 claims 2
- 239000003937 drug carrier Substances 0.000 claims 1
- 208000023275 Autoimmune disease Diseases 0.000 abstract description 20
- 238000002560 therapeutic procedure Methods 0.000 abstract description 12
- 230000008901 benefit Effects 0.000 abstract description 4
- 208000037979 autoimmune inflammatory disease Diseases 0.000 abstract 1
- 239000003795 chemical substances by application Substances 0.000 description 177
- 108090000623 proteins and genes Proteins 0.000 description 73
- 239000004365 Protease Substances 0.000 description 65
- 102000035195 Peptidases Human genes 0.000 description 62
- 108091005804 Peptidases Proteins 0.000 description 62
- 239000003446 ligand Substances 0.000 description 62
- 102000004169 proteins and genes Human genes 0.000 description 62
- 235000018102 proteins Nutrition 0.000 description 54
- 102000005962 receptors Human genes 0.000 description 53
- 108020003175 receptors Proteins 0.000 description 53
- 235000019419 proteases Nutrition 0.000 description 49
- 230000008685 targeting Effects 0.000 description 47
- 102000004127 Cytokines Human genes 0.000 description 46
- 108090000695 Cytokines Proteins 0.000 description 46
- 230000027455 binding Effects 0.000 description 46
- -1 DNA Chemical class 0.000 description 42
- 102100024598 Tumor necrosis factor ligand superfamily member 10 Human genes 0.000 description 41
- 101710097160 Tumor necrosis factor ligand superfamily member 10 Proteins 0.000 description 41
- 230000000694 effects Effects 0.000 description 41
- 102000004190 Enzymes Human genes 0.000 description 37
- 108090000790 Enzymes Proteins 0.000 description 37
- 229940088598 enzyme Drugs 0.000 description 37
- 230000000295 complement effect Effects 0.000 description 32
- 239000000427 antigen Substances 0.000 description 28
- 102000036639 antigens Human genes 0.000 description 28
- 108091007433 antigens Proteins 0.000 description 28
- 108010000449 TNF-Related Apoptosis-Inducing Ligand Receptors Proteins 0.000 description 26
- 102000002259 TNF-Related Apoptosis-Inducing Ligand Receptors Human genes 0.000 description 26
- 239000003814 drug Substances 0.000 description 25
- 230000006870 function Effects 0.000 description 25
- 230000037361 pathway Effects 0.000 description 25
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 22
- 210000004379 membrane Anatomy 0.000 description 22
- 201000010099 disease Diseases 0.000 description 21
- 230000002401 inhibitory effect Effects 0.000 description 20
- 229940079593 drug Drugs 0.000 description 17
- 239000003112 inhibitor Substances 0.000 description 17
- 239000000654 additive Substances 0.000 description 16
- 239000000556 agonist Substances 0.000 description 16
- 239000000758 substrate Substances 0.000 description 16
- 108091005250 Glycophorins Proteins 0.000 description 13
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 13
- 102100040247 Tumor necrosis factor Human genes 0.000 description 13
- 230000009471 action Effects 0.000 description 13
- 235000001014 amino acid Nutrition 0.000 description 13
- 229940024606 amino acid Drugs 0.000 description 13
- 230000006907 apoptotic process Effects 0.000 description 13
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 13
- 238000006243 chemical reaction Methods 0.000 description 12
- 102000037865 fusion proteins Human genes 0.000 description 12
- 108020001507 fusion proteins Proteins 0.000 description 12
- 210000005259 peripheral blood Anatomy 0.000 description 12
- 239000011886 peripheral blood Substances 0.000 description 12
- 210000001519 tissue Anatomy 0.000 description 12
- 150000001413 amino acids Chemical class 0.000 description 11
- 238000010586 diagram Methods 0.000 description 11
- 208000027866 inflammatory disease Diseases 0.000 description 11
- 230000004807 localization Effects 0.000 description 11
- 102100035716 Glycophorin-A Human genes 0.000 description 10
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 10
- 238000003776 cleavage reaction Methods 0.000 description 10
- 230000024203 complement activation Effects 0.000 description 10
- 230000001419 dependent effect Effects 0.000 description 10
- 230000004927 fusion Effects 0.000 description 10
- 238000000338 in vitro Methods 0.000 description 10
- 230000007017 scission Effects 0.000 description 10
- 230000002195 synergetic effect Effects 0.000 description 10
- 108010006519 Molecular Chaperones Proteins 0.000 description 9
- 125000003275 alpha amino acid group Chemical group 0.000 description 9
- 239000005557 antagonist Substances 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 102000003675 cytokine receptors Human genes 0.000 description 9
- 108010057085 cytokine receptors Proteins 0.000 description 9
- 239000003607 modifier Substances 0.000 description 9
- 238000011282 treatment Methods 0.000 description 9
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 8
- 102100031506 Complement C5 Human genes 0.000 description 8
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 8
- 101000941598 Homo sapiens Complement C5 Proteins 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 102000003814 Interleukin-10 Human genes 0.000 description 8
- 108090000174 Interleukin-10 Proteins 0.000 description 8
- 230000000996 additive effect Effects 0.000 description 8
- 230000001580 bacterial effect Effects 0.000 description 8
- 230000003197 catalytic effect Effects 0.000 description 8
- 230000001447 compensatory effect Effects 0.000 description 8
- 230000002255 enzymatic effect Effects 0.000 description 8
- 239000012642 immune effector Substances 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 229940121354 immunomodulator Drugs 0.000 description 8
- 108010044426 integrins Proteins 0.000 description 8
- 102000006495 integrins Human genes 0.000 description 8
- 239000003981 vehicle Substances 0.000 description 8
- 102000000844 Cell Surface Receptors Human genes 0.000 description 7
- 108010001857 Cell Surface Receptors Proteins 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 7
- 108090001081 Dipeptidases Proteins 0.000 description 7
- 102000004860 Dipeptidases Human genes 0.000 description 7
- 108010054147 Hemoglobins Proteins 0.000 description 7
- 102000001554 Hemoglobins Human genes 0.000 description 7
- 108090001005 Interleukin-6 Proteins 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 108090000526 Papain Proteins 0.000 description 7
- 102000012479 Serine Proteases Human genes 0.000 description 7
- 108010022999 Serine Proteases Proteins 0.000 description 7
- 230000003213 activating effect Effects 0.000 description 7
- 230000003110 anti-inflammatory effect Effects 0.000 description 7
- 238000000684 flow cytometry Methods 0.000 description 7
- 229940125396 insulin Drugs 0.000 description 7
- 229940055729 papain Drugs 0.000 description 7
- 235000019834 papain Nutrition 0.000 description 7
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 108090000672 Annexin A5 Proteins 0.000 description 6
- 102000004121 Annexin A5 Human genes 0.000 description 6
- 102000012002 Aquaporin 4 Human genes 0.000 description 6
- 108010036280 Aquaporin 4 Proteins 0.000 description 6
- 108010074708 B7-H1 Antigen Proteins 0.000 description 6
- 102100035431 Complement factor I Human genes 0.000 description 6
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 6
- 108090000144 Human Proteins Proteins 0.000 description 6
- 102000003839 Human Proteins Human genes 0.000 description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 6
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 6
- 102000004877 Insulin Human genes 0.000 description 6
- 108090001061 Insulin Proteins 0.000 description 6
- 102000004889 Interleukin-6 Human genes 0.000 description 6
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 6
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 6
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 6
- 206010040047 Sepsis Diseases 0.000 description 6
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 6
- 241000700605 Viruses Species 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 230000030833 cell death Effects 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 230000012447 hatching Effects 0.000 description 6
- 235000019833 protease Nutrition 0.000 description 6
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 6
- 229940044601 receptor agonist Drugs 0.000 description 6
- 239000000018 receptor agonist Substances 0.000 description 6
- 150000003384 small molecules Chemical class 0.000 description 6
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 5
- 102000004400 Aminopeptidases Human genes 0.000 description 5
- 108090000915 Aminopeptidases Proteins 0.000 description 5
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 5
- 102000005927 Cysteine Proteases Human genes 0.000 description 5
- 108010005843 Cysteine Proteases Proteins 0.000 description 5
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 5
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 5
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 5
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 5
- 108090000176 Interleukin-13 Proteins 0.000 description 5
- 102000003816 Interleukin-13 Human genes 0.000 description 5
- 102000004195 Isomerases Human genes 0.000 description 5
- 108090000769 Isomerases Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- 102100023302 Myelin-oligodendrocyte glycoprotein Human genes 0.000 description 5
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 5
- 229910019142 PO4 Inorganic materials 0.000 description 5
- 108010067372 Pancreatic elastase Proteins 0.000 description 5
- 102000016387 Pancreatic elastase Human genes 0.000 description 5
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 5
- 239000013566 allergen Substances 0.000 description 5
- 230000030741 antigen processing and presentation Effects 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 108010059385 chemotactic factor inactivator Proteins 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 5
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 239000010452 phosphate Substances 0.000 description 5
- 239000000651 prodrug Substances 0.000 description 5
- 229940002612 prodrug Drugs 0.000 description 5
- 206010039073 rheumatoid arthritis Diseases 0.000 description 5
- 238000010186 staining Methods 0.000 description 5
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- 238000012546 transfer Methods 0.000 description 5
- 229910052725 zinc Inorganic materials 0.000 description 5
- 239000011701 zinc Substances 0.000 description 5
- 102000003925 1,4-alpha-Glucan Branching Enzyme Human genes 0.000 description 4
- 108090000344 1,4-alpha-Glucan Branching Enzyme Proteins 0.000 description 4
- 102100036664 Adenosine deaminase Human genes 0.000 description 4
- 102100026882 Alpha-synuclein Human genes 0.000 description 4
- 102000004580 Aspartic Acid Proteases Human genes 0.000 description 4
- 108010017640 Aspartic Acid Proteases Proteins 0.000 description 4
- 108090000317 Chymotrypsin Proteins 0.000 description 4
- 108010053085 Complement Factor H Proteins 0.000 description 4
- 102100035432 Complement factor H Human genes 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 108010033040 Histones Proteins 0.000 description 4
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 4
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 4
- 206010061218 Inflammation Diseases 0.000 description 4
- 108010002386 Interleukin-3 Proteins 0.000 description 4
- 102000000646 Interleukin-3 Human genes 0.000 description 4
- 108090000978 Interleukin-4 Proteins 0.000 description 4
- 102000004388 Interleukin-4 Human genes 0.000 description 4
- 102000015696 Interleukins Human genes 0.000 description 4
- 108010063738 Interleukins Proteins 0.000 description 4
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 4
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 4
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 4
- 102000018697 Membrane Proteins Human genes 0.000 description 4
- 108010052285 Membrane Proteins Proteins 0.000 description 4
- 102100039373 Membrane cofactor protein Human genes 0.000 description 4
- 102100028793 Mucosal addressin cell adhesion molecule 1 Human genes 0.000 description 4
- 108090000284 Pepsin A Proteins 0.000 description 4
- 102000057297 Pepsin A Human genes 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 108091008874 T cell receptors Proteins 0.000 description 4
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 4
- 108700012920 TNF Proteins 0.000 description 4
- 239000004473 Threonine Chemical group 0.000 description 4
- 108090000631 Trypsin Proteins 0.000 description 4
- 102000004142 Trypsin Human genes 0.000 description 4
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 4
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 4
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- RASZIXQTZOARSV-BDPUVYQTSA-N astacin Chemical compound CC=1C(=O)C(=O)CC(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)C(=O)C(=O)CC1(C)C RASZIXQTZOARSV-BDPUVYQTSA-N 0.000 description 4
- 230000022534 cell killing Effects 0.000 description 4
- 229960002376 chymotrypsin Drugs 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- 238000006471 dimerization reaction Methods 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 4
- 239000000833 heterodimer Substances 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 230000002757 inflammatory effect Effects 0.000 description 4
- 230000004054 inflammatory process Effects 0.000 description 4
- 201000006417 multiple sclerosis Diseases 0.000 description 4
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- 239000012588 trypsin Substances 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- 102100026802 72 kDa type IV collagenase Human genes 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 3
- 108010059574 C5a peptidase Proteins 0.000 description 3
- 102100024263 CD160 antigen Human genes 0.000 description 3
- 102100036008 CD48 antigen Human genes 0.000 description 3
- 102000005367 Carboxypeptidases Human genes 0.000 description 3
- 108010006303 Carboxypeptidases Proteins 0.000 description 3
- 108010009685 Cholinergic Receptors Proteins 0.000 description 3
- 102000016550 Complement Factor H Human genes 0.000 description 3
- 102100039061 Cytokine receptor common subunit beta Human genes 0.000 description 3
- 206010050685 Cytokine storm Diseases 0.000 description 3
- 102000005593 Endopeptidases Human genes 0.000 description 3
- 108010059378 Endopeptidases Proteins 0.000 description 3
- 102000003951 Erythropoietin Human genes 0.000 description 3
- 108090000394 Erythropoietin Proteins 0.000 description 3
- 108010088842 Fibrinolysin Proteins 0.000 description 3
- 206010018364 Glomerulonephritis Diseases 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 108700023372 Glycosyltransferases Proteins 0.000 description 3
- 102000001398 Granzyme Human genes 0.000 description 3
- 108060005986 Granzyme Proteins 0.000 description 3
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 3
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 3
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 3
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 3
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 3
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 3
- 101000737574 Homo sapiens Complement factor H Proteins 0.000 description 3
- 101001033280 Homo sapiens Cytokine receptor common subunit beta Proteins 0.000 description 3
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 3
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 3
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 3
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 3
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 3
- 101000610605 Homo sapiens Tumor necrosis factor receptor superfamily member 10A Proteins 0.000 description 3
- 101000610604 Homo sapiens Tumor necrosis factor receptor superfamily member 10B Proteins 0.000 description 3
- 101000798130 Homo sapiens Tumor necrosis factor receptor superfamily member 11B Proteins 0.000 description 3
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 3
- 108010002231 IgA-specific serine endopeptidase Proteins 0.000 description 3
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 3
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 3
- 108010050904 Interferons Proteins 0.000 description 3
- 102000014150 Interferons Human genes 0.000 description 3
- 108090000177 Interleukin-11 Proteins 0.000 description 3
- 102000003815 Interleukin-11 Human genes 0.000 description 3
- 108010065805 Interleukin-12 Proteins 0.000 description 3
- 102000013462 Interleukin-12 Human genes 0.000 description 3
- 102000003812 Interleukin-15 Human genes 0.000 description 3
- 108090000172 Interleukin-15 Proteins 0.000 description 3
- 108010065637 Interleukin-23 Proteins 0.000 description 3
- 102000013264 Interleukin-23 Human genes 0.000 description 3
- 102100036672 Interleukin-23 receptor Human genes 0.000 description 3
- 102100037795 Interleukin-6 receptor subunit beta Human genes 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical group OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 102000002704 Leucyl aminopeptidase Human genes 0.000 description 3
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 3
- 102100037611 Lysophospholipase Human genes 0.000 description 3
- 102100027998 Macrophage metalloelastase Human genes 0.000 description 3
- 108010015302 Matrix metalloproteinase-9 Proteins 0.000 description 3
- 102000005741 Metalloproteases Human genes 0.000 description 3
- 108010006035 Metalloproteases Proteins 0.000 description 3
- 101710139349 Mucosal addressin cell adhesion molecule 1 Proteins 0.000 description 3
- 102000007999 Nuclear Proteins Human genes 0.000 description 3
- 108010089610 Nuclear Proteins Proteins 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 102000004316 Oxidoreductases Human genes 0.000 description 3
- 108090000854 Oxidoreductases Proteins 0.000 description 3
- 108010043045 Phospholipase A2 Receptors Proteins 0.000 description 3
- 102000004050 Phospholipase A2 Receptors Human genes 0.000 description 3
- 108010058864 Phospholipases A2 Proteins 0.000 description 3
- 108091000080 Phosphotransferase Proteins 0.000 description 3
- 201000004681 Psoriasis Diseases 0.000 description 3
- 108090000794 Streptopain Proteins 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 3
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 3
- 108090001109 Thermolysin Proteins 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Chemical group CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 102000004357 Transferases Human genes 0.000 description 3
- 108090000992 Transferases Proteins 0.000 description 3
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 3
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 3
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 3
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 3
- 102100032236 Tumor necrosis factor receptor superfamily member 11B Human genes 0.000 description 3
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 3
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 3
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 3
- 102000034337 acetylcholine receptors Human genes 0.000 description 3
- 239000012190 activator Substances 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 210000000612 antigen-presenting cell Anatomy 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 235000009697 arginine Nutrition 0.000 description 3
- 208000006673 asthma Diseases 0.000 description 3
- 238000006555 catalytic reaction Methods 0.000 description 3
- 239000004074 complement inhibitor Substances 0.000 description 3
- 206010052015 cytokine release syndrome Diseases 0.000 description 3
- 239000002158 endotoxin Substances 0.000 description 3
- 229940105423 erythropoietin Drugs 0.000 description 3
- 230000002538 fungal effect Effects 0.000 description 3
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- 150000004676 glycans Chemical class 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 235000014304 histidine Nutrition 0.000 description 3
- 229940047122 interleukins Drugs 0.000 description 3
- 229920006008 lipopolysaccharide Polymers 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 210000003643 myeloid progenitor cell Anatomy 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 208000008795 neuromyelitis optica Diseases 0.000 description 3
- 210000000440 neutrophil Anatomy 0.000 description 3
- 229940111202 pepsin Drugs 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 102000020233 phosphotransferase Human genes 0.000 description 3
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 3
- 229940012957 plasmin Drugs 0.000 description 3
- 210000004180 plasmocyte Anatomy 0.000 description 3
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000000861 pro-apoptotic effect Effects 0.000 description 3
- 230000011664 signaling Effects 0.000 description 3
- 210000000130 stem cell Anatomy 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Chemical group OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 2
- 108010082808 4-1BB Ligand Proteins 0.000 description 2
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 description 2
- 102100032290 A disintegrin and metalloproteinase with thrombospondin motifs 13 Human genes 0.000 description 2
- 108091005670 ADAMTS13 Proteins 0.000 description 2
- 108091006112 ATPases Proteins 0.000 description 2
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 2
- 108700023418 Amidases Proteins 0.000 description 2
- 101710102551 Aminopeptidase Proteins 0.000 description 2
- 102100022749 Aminopeptidase N Human genes 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Chemical group OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 108090000658 Astacin Proteins 0.000 description 2
- 102000034498 Astacin Human genes 0.000 description 2
- 108091008875 B cell receptors Proteins 0.000 description 2
- 108010028006 B-Cell Activating Factor Proteins 0.000 description 2
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 2
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 108010049990 CD13 Antigens Proteins 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 102100032937 CD40 ligand Human genes 0.000 description 2
- 102100022002 CD59 glycoprotein Human genes 0.000 description 2
- 102100025221 CD70 antigen Human genes 0.000 description 2
- 108010080937 Carboxypeptidases A Proteins 0.000 description 2
- 102000000496 Carboxypeptidases A Human genes 0.000 description 2
- 102000005600 Cathepsins Human genes 0.000 description 2
- 108010084457 Cathepsins Proteins 0.000 description 2
- 108050001186 Chaperonin Cpn60 Proteins 0.000 description 2
- 102000052603 Chaperonins Human genes 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108090000746 Chymosin Proteins 0.000 description 2
- 208000015943 Coeliac disease Diseases 0.000 description 2
- 108010035532 Collagen Proteins 0.000 description 2
- 102000008186 Collagen Human genes 0.000 description 2
- 108010078015 Complement C3b Proteins 0.000 description 2
- 108090000044 Complement Factor I Proteins 0.000 description 2
- 102100026234 Cytokine receptor common subunit gamma Human genes 0.000 description 2
- 108010071840 Cytosol nonspecific dipeptidase Proteins 0.000 description 2
- 102000011799 Desmoglein Human genes 0.000 description 2
- 108050002238 Desmoglein Proteins 0.000 description 2
- FMKGDHLSXFDSOU-BDPUVYQTSA-N Dienon-Astacin Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)C(=O)C(=CC1(C)C)O)C=CC=C(/C)C=CC2=C(C)C(=O)C(=CC2(C)C)O FMKGDHLSXFDSOU-BDPUVYQTSA-N 0.000 description 2
- 108090000194 Dipeptidyl-peptidases and tripeptidyl-peptidases Proteins 0.000 description 2
- 102000003779 Dipeptidyl-peptidases and tripeptidyl-peptidases Human genes 0.000 description 2
- 102100031111 Disintegrin and metalloproteinase domain-containing protein 17 Human genes 0.000 description 2
- 108700035154 EC 3.4.15.- Proteins 0.000 description 2
- 102000051496 EC 3.4.15.- Human genes 0.000 description 2
- 108700033355 EC 3.4.19.- Proteins 0.000 description 2
- 102000057898 EC 3.4.19.- Human genes 0.000 description 2
- 108700033921 EC 3.4.23.20 Proteins 0.000 description 2
- 108010092208 Endothia aspartic proteinase Proteins 0.000 description 2
- 108010044495 Fetal Hemoglobin Proteins 0.000 description 2
- 229920001503 Glucan Polymers 0.000 description 2
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 2
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 2
- 102000051366 Glycosyltransferases Human genes 0.000 description 2
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 2
- 101710121996 Hexon protein p72 Proteins 0.000 description 2
- 102000003893 Histone acetyltransferases Human genes 0.000 description 2
- 108090000246 Histone acetyltransferases Proteins 0.000 description 2
- 101000924577 Homo sapiens Adenomatous polyposis coli protein Proteins 0.000 description 2
- 101000834898 Homo sapiens Alpha-synuclein Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101100220044 Homo sapiens CD34 gene Proteins 0.000 description 2
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 2
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 2
- 101100334515 Homo sapiens FCGR3A gene Proteins 0.000 description 2
- 101001074244 Homo sapiens Glycophorin-A Proteins 0.000 description 2
- 101001001420 Homo sapiens Interferon gamma receptor 1 Proteins 0.000 description 2
- 101001076422 Homo sapiens Interleukin-1 receptor type 2 Proteins 0.000 description 2
- 101000853012 Homo sapiens Interleukin-23 receptor Proteins 0.000 description 2
- 101000853002 Homo sapiens Interleukin-25 Proteins 0.000 description 2
- 101001033312 Homo sapiens Interleukin-4 receptor subunit alpha Proteins 0.000 description 2
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 2
- 101001018100 Homo sapiens Lysozyme C Proteins 0.000 description 2
- 101000577881 Homo sapiens Macrophage metalloelastase Proteins 0.000 description 2
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 description 2
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 2
- 101001128431 Homo sapiens Myeloid-derived growth factor Proteins 0.000 description 2
- 101001126836 Homo sapiens N-acetylmuramoyl-L-alanine amidase Proteins 0.000 description 2
- 101000611936 Homo sapiens Programmed cell death protein 1 Proteins 0.000 description 2
- 101000652359 Homo sapiens Spermatogenesis-associated protein 2 Proteins 0.000 description 2
- 101000669511 Homo sapiens T-cell immunoglobulin and mucin domain-containing protein 4 Proteins 0.000 description 2
- 101000610602 Homo sapiens Tumor necrosis factor receptor superfamily member 10C Proteins 0.000 description 2
- 101000610609 Homo sapiens Tumor necrosis factor receptor superfamily member 10D Proteins 0.000 description 2
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 2
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 2
- 101000679903 Homo sapiens Tumor necrosis factor receptor superfamily member 25 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 206010020751 Hypersensitivity Diseases 0.000 description 2
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 108010001127 Insulin Receptor Proteins 0.000 description 2
- 102100036721 Insulin receptor Human genes 0.000 description 2
- 102100035678 Interferon gamma receptor 1 Human genes 0.000 description 2
- 102000000589 Interleukin-1 Human genes 0.000 description 2
- 108010002352 Interleukin-1 Proteins 0.000 description 2
- 102100026017 Interleukin-1 receptor type 2 Human genes 0.000 description 2
- 101800003050 Interleukin-16 Proteins 0.000 description 2
- 102000049772 Interleukin-16 Human genes 0.000 description 2
- 102000013691 Interleukin-17 Human genes 0.000 description 2
- 108050003558 Interleukin-17 Proteins 0.000 description 2
- 102000003810 Interleukin-18 Human genes 0.000 description 2
- 108090000171 Interleukin-18 Proteins 0.000 description 2
- 102100030703 Interleukin-22 Human genes 0.000 description 2
- 102100036680 Interleukin-25 Human genes 0.000 description 2
- 108010067003 Interleukin-33 Proteins 0.000 description 2
- 102000017761 Interleukin-33 Human genes 0.000 description 2
- 102100039078 Interleukin-4 receptor subunit alpha Human genes 0.000 description 2
- 108010002616 Interleukin-5 Proteins 0.000 description 2
- 108010002586 Interleukin-7 Proteins 0.000 description 2
- 108010002335 Interleukin-9 Proteins 0.000 description 2
- 102000000585 Interleukin-9 Human genes 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical group OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical group C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical group C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 102000017578 LAG3 Human genes 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 108010004098 Leucyl aminopeptidase Proteins 0.000 description 2
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 2
- 102000004317 Lyases Human genes 0.000 description 2
- 108090000856 Lyases Proteins 0.000 description 2
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 101710125418 Major capsid protein Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 102100030417 Matrilysin Human genes 0.000 description 2
- 102000000380 Matrix Metalloproteinase 1 Human genes 0.000 description 2
- 102100030216 Matrix metalloproteinase-14 Human genes 0.000 description 2
- 102100024130 Matrix metalloproteinase-23 Human genes 0.000 description 2
- 102100024131 Matrix metalloproteinase-25 Human genes 0.000 description 2
- 102000001776 Matrix metalloproteinase-9 Human genes 0.000 description 2
- 102100030412 Matrix metalloproteinase-9 Human genes 0.000 description 2
- 108030000089 Metallocarboxypeptidases Proteins 0.000 description 2
- 102000006166 Metallocarboxypeptidases Human genes 0.000 description 2
- 102000005431 Molecular Chaperones Human genes 0.000 description 2
- 241000713869 Moloney murine leukemia virus Species 0.000 description 2
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 2
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 2
- 102100030397 N-acetylmuramoyl-L-alanine amidase Human genes 0.000 description 2
- 102100035488 Nectin-2 Human genes 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 108090000028 Neprilysin Proteins 0.000 description 2
- 102000003729 Neprilysin Human genes 0.000 description 2
- 102100030411 Neutrophil collagenase Human genes 0.000 description 2
- PXHVJJICTQNCMI-UHFFFAOYSA-N Nickel Chemical compound [Ni] PXHVJJICTQNCMI-UHFFFAOYSA-N 0.000 description 2
- 108010051791 Nuclear Antigens Proteins 0.000 description 2
- 102000019040 Nuclear Antigens Human genes 0.000 description 2
- 102000004473 OX40 Ligand Human genes 0.000 description 2
- 108010042215 OX40 Ligand Proteins 0.000 description 2
- 102100029740 Poliovirus receptor Human genes 0.000 description 2
- 108010076181 Proinsulin Proteins 0.000 description 2
- 101800001753 Protease Proteins 0.000 description 2
- 102000001253 Protein Kinase Human genes 0.000 description 2
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 2
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 2
- 206010037549 Purpura Diseases 0.000 description 2
- 241001672981 Purpura Species 0.000 description 2
- 102000004879 Racemases and epimerases Human genes 0.000 description 2
- 108090001066 Racemases and epimerases Proteins 0.000 description 2
- 108090000783 Renin Proteins 0.000 description 2
- 102100028255 Renin Human genes 0.000 description 2
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- 108030000574 Serine-type carboxypeptidases Proteins 0.000 description 2
- 102000034328 Serine-type carboxypeptidases Human genes 0.000 description 2
- 241000607715 Serratia marcescens Species 0.000 description 2
- 241000700584 Simplexvirus Species 0.000 description 2
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 2
- 101710190410 Staphylococcal complement inhibitor Proteins 0.000 description 2
- 101710145796 Staphylokinase Proteins 0.000 description 2
- 102100030416 Stromelysin-1 Human genes 0.000 description 2
- 102100028848 Stromelysin-2 Human genes 0.000 description 2
- 108090000787 Subtilisin Proteins 0.000 description 2
- 102100039367 T-cell immunoglobulin and mucin domain-containing protein 4 Human genes 0.000 description 2
- 102000003911 Thyrotropin Receptors Human genes 0.000 description 2
- 108090000253 Thyrotropin Receptors Proteins 0.000 description 2
- 102000004338 Transferrin Human genes 0.000 description 2
- 108090000901 Transferrin Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 102000001400 Tryptase Human genes 0.000 description 2
- 108060005989 Tryptase Proteins 0.000 description 2
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Chemical group C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 2
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 description 2
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 2
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 2
- 102100040115 Tumor necrosis factor receptor superfamily member 10C Human genes 0.000 description 2
- 102100040110 Tumor necrosis factor receptor superfamily member 10D Human genes 0.000 description 2
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 2
- 102100022203 Tumor necrosis factor receptor superfamily member 25 Human genes 0.000 description 2
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 2
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 2
- 206010064930 age-related macular degeneration Diseases 0.000 description 2
- 229960003767 alanine Drugs 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 208000026935 allergic disease Diseases 0.000 description 2
- 230000007815 allergy Effects 0.000 description 2
- 102000005922 amidase Human genes 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 238000003782 apoptosis assay Methods 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000003676 astacin Nutrition 0.000 description 2
- 208000036556 autosomal recessive T cell-negative B cell-negative NK cell-negative due to adenosine deaminase deficiency severe combined immunodeficiency Diseases 0.000 description 2
- 201000005008 bacterial sepsis Diseases 0.000 description 2
- 239000002585 base Substances 0.000 description 2
- 238000002869 basic local alignment search tool Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 2
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 2
- 210000002960 bfu-e Anatomy 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 239000003139 biocide Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000008236 biological pathway Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 230000006037 cell lysis Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 229940080701 chymosin Drugs 0.000 description 2
- 229920001436 collagen Polymers 0.000 description 2
- 230000001332 colony forming effect Effects 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Chemical group SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 230000000593 degrading effect Effects 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 210000003173 enucleated reticulocyte Anatomy 0.000 description 2
- 230000000925 erythroid effect Effects 0.000 description 2
- 210000003013 erythroid precursor cell Anatomy 0.000 description 2
- 210000001808 exosome Anatomy 0.000 description 2
- 239000007850 fluorescent dye Substances 0.000 description 2
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000005734 heterodimerization reaction Methods 0.000 description 2
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 229940126546 immune checkpoint molecule Drugs 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 229940079322 interferon Drugs 0.000 description 2
- 108090000681 interleukin 20 Proteins 0.000 description 2
- 102000004114 interleukin 20 Human genes 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- 210000005228 liver tissue Anatomy 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000002132 lysosomal effect Effects 0.000 description 2
- 208000002780 macular degeneration Diseases 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 210000000135 megakaryocyte-erythroid progenitor cell Anatomy 0.000 description 2
- 210000002901 mesenchymal stem cell Anatomy 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 230000002438 mitochondrial effect Effects 0.000 description 2
- 108010083018 monocyte locomotion inhibitory factor Proteins 0.000 description 2
- 206010028417 myasthenia gravis Diseases 0.000 description 2
- GNOLWGAJQVLBSM-UHFFFAOYSA-N n,n,5,7-tetramethyl-1,2,3,4-tetrahydronaphthalen-1-amine Chemical compound C1=C(C)C=C2C(N(C)C)CCCC2=C1C GNOLWGAJQVLBSM-UHFFFAOYSA-N 0.000 description 2
- 206010053219 non-alcoholic steatohepatitis Diseases 0.000 description 2
- 239000012038 nucleophile Substances 0.000 description 2
- 230000003071 parasitic effect Effects 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 150000003904 phospholipids Chemical class 0.000 description 2
- 210000002381 plasma Anatomy 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 108090000588 rhizopuspepsin Proteins 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000003582 thrombocytopenic effect Effects 0.000 description 2
- 230000003614 tolerogenic effect Effects 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 239000012581 transferrin Substances 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 108010087967 type I signal peptidase Proteins 0.000 description 2
- KDXKERNSBIXSRK-RGXOIRHWSA-N (2s)-6-amino-2-(deuterioamino)hexanoic acid Chemical compound [2H]N[C@H](C(O)=O)CCCCN KDXKERNSBIXSRK-RGXOIRHWSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- 102100024341 10 kDa heat shock protein, mitochondrial Human genes 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- RAXXELZNTBOGNW-UHFFFAOYSA-N 1H-imidazole Chemical group C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 1
- RDTRHBCZFDCUPW-KWICJJCGSA-N 2-[(4r,7s,10s,13s,19s,22s,25s,28s,31s,34r)-4-[[(2s,3r)-1-amino-3-hydroxy-1-oxobutan-2-yl]carbamoyl]-34-[[(2s,3s)-2-amino-3-methylpentanoyl]amino]-25-(3-amino-3-oxopropyl)-7-[3-(diaminomethylideneamino)propyl]-10,13-bis(1h-imidazol-5-ylmethyl)-19-(1h-indol Chemical compound C([C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CSSC[C@@H](C(N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)NCC(=O)N[C@@H](CC=2NC=NC=2)C(=O)N1)C(C)C)C(C)C)=O)NC(=O)[C@@H](N)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(N)=O)C1=CN=CN1 RDTRHBCZFDCUPW-KWICJJCGSA-N 0.000 description 1
- OTLLEIBWKHEHGU-UHFFFAOYSA-N 2-[5-[[5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy]-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-4-phosphonooxyhexanedioic acid Chemical compound C1=NC=2C(N)=NC=NC=2N1C(C(C1O)O)OC1COC1C(CO)OC(OC(C(O)C(OP(O)(O)=O)C(O)C(O)=O)C(O)=O)C(O)C1O OTLLEIBWKHEHGU-UHFFFAOYSA-N 0.000 description 1
- LKDMKWNDBAVNQZ-UHFFFAOYSA-N 4-[[1-[[1-[2-[[1-(4-nitroanilino)-1-oxo-3-phenylpropan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-4-oxobutanoic acid Chemical compound OC(=O)CCC(=O)NC(C)C(=O)NC(C)C(=O)N1CCCC1C(=O)NC(C(=O)NC=1C=CC(=CC=1)[N+]([O-])=O)CC1=CC=CC=C1 LKDMKWNDBAVNQZ-UHFFFAOYSA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- 101710154868 60 kDa heat shock protein, mitochondrial Proteins 0.000 description 1
- VHRSUDSXCMQTMA-PJHHCJLFSA-N 6alpha-methylprednisolone Chemical compound C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)CO)CC[C@H]21 VHRSUDSXCMQTMA-PJHHCJLFSA-N 0.000 description 1
- 101710151806 72 kDa type IV collagenase Proteins 0.000 description 1
- 108091007505 ADAM17 Proteins 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 108010092060 Acetate kinase Proteins 0.000 description 1
- 102100026041 Acrosin Human genes 0.000 description 1
- 108090000107 Acrosin Proteins 0.000 description 1
- ZHQQRIUYLMXDPP-SSDOTTSWSA-N Actinidine Natural products C1=NC=C(C)C2=C1[C@H](C)CC2 ZHQQRIUYLMXDPP-SSDOTTSWSA-N 0.000 description 1
- 102100032488 Acylamino-acid-releasing enzyme Human genes 0.000 description 1
- 108010061216 Acylaminoacyl-peptidase Proteins 0.000 description 1
- 108030001653 Adamalysin Proteins 0.000 description 1
- 102000034473 Adamalysin Human genes 0.000 description 1
- 102100036601 Aggrecan core protein Human genes 0.000 description 1
- 108010067219 Aggrecans Proteins 0.000 description 1
- 108010075409 Alanine carboxypeptidase Proteins 0.000 description 1
- 102000003677 Aldehyde-Lyases Human genes 0.000 description 1
- 108090000072 Aldehyde-Lyases Proteins 0.000 description 1
- 108030007066 Alternative-complement-pathway C3/C5 convertases Proteins 0.000 description 1
- 102000006534 Amino Acid Isomerases Human genes 0.000 description 1
- 108010008830 Amino Acid Isomerases Proteins 0.000 description 1
- 102100032126 Aminopeptidase B Human genes 0.000 description 1
- 108030000961 Aminopeptidase Y Proteins 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- FQEQMASDZFXSJI-UHFFFAOYSA-N Anagyrin Natural products C12CCCCN2CC2C3=CC=CC(=O)N3CC1C2 FQEQMASDZFXSJI-UHFFFAOYSA-N 0.000 description 1
- 108090000886 Ananain Proteins 0.000 description 1
- 102000005590 Anaphylatoxin C5a Receptor Human genes 0.000 description 1
- 108010059426 Anaphylatoxin C5a Receptor Proteins 0.000 description 1
- 102100035765 Angiotensin-converting enzyme 2 Human genes 0.000 description 1
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 1
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108090000935 Antithrombin III Proteins 0.000 description 1
- 102100022977 Antithrombin-III Human genes 0.000 description 1
- 102000003916 Arrestin Human genes 0.000 description 1
- 108090000328 Arrestin Proteins 0.000 description 1
- 108090000101 Asclepain Proteins 0.000 description 1
- 102000030431 Asparaginyl endopeptidase Human genes 0.000 description 1
- 108090000432 Aspergillopepsin II Proteins 0.000 description 1
- 108090000618 Atrolysin B Proteins 0.000 description 1
- 108090000616 Atrolysin C Proteins 0.000 description 1
- 108090000664 Atrolysin E Proteins 0.000 description 1
- 108090000666 Atrolysin F Proteins 0.000 description 1
- 108090000254 Aureolysin Proteins 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 1
- 210000002237 B-cell of pancreatic islet Anatomy 0.000 description 1
- 108090000145 Bacillolysin Proteins 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 108010066768 Bacterial leucyl aminopeptidase Proteins 0.000 description 1
- 101710113841 Barrierpepsin Proteins 0.000 description 1
- 208000023328 Basedow disease Diseases 0.000 description 1
- 108091005658 Basic proteases Proteins 0.000 description 1
- 102100030802 Beta-2-glycoprotein 1 Human genes 0.000 description 1
- 101710180007 Beta-2-glycoprotein 1 Proteins 0.000 description 1
- 102100031006 Beta-Ala-His dipeptidase Human genes 0.000 description 1
- 108030004753 Beta-Ala-His dipeptidases Proteins 0.000 description 1
- 108010005785 Beta-aspartyl-peptidase Proteins 0.000 description 1
- 108030001561 Beta-lytic metalloendopeptidases Proteins 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 102000015081 Blood Coagulation Factors Human genes 0.000 description 1
- 108010039209 Blood Coagulation Factors Proteins 0.000 description 1
- 108090000654 Bone morphogenetic protein 1 Proteins 0.000 description 1
- 102000004152 Bone morphogenetic protein 1 Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 108010004032 Bromelains Proteins 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 229940122551 CD40 antagonist Drugs 0.000 description 1
- 101150099575 CDC37 gene Proteins 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102100021868 Calnexin Human genes 0.000 description 1
- 108010056891 Calnexin Proteins 0.000 description 1
- 108010032088 Calpain Proteins 0.000 description 1
- 102000007590 Calpain Human genes 0.000 description 1
- 102100029968 Calreticulin Human genes 0.000 description 1
- 108090000549 Calreticulin Proteins 0.000 description 1
- 101710124576 Candidapepsin Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 101100507655 Canis lupus familiaris HSPA1 gene Proteins 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- 108090000087 Carboxypeptidase B Proteins 0.000 description 1
- 102000003670 Carboxypeptidase B Human genes 0.000 description 1
- 108090000018 Carboxypeptidase D Proteins 0.000 description 1
- 102100032407 Carboxypeptidase D Human genes 0.000 description 1
- 102100032378 Carboxypeptidase E Human genes 0.000 description 1
- 108010058255 Carboxypeptidase H Proteins 0.000 description 1
- 108090000007 Carboxypeptidase M Proteins 0.000 description 1
- 102100032936 Carboxypeptidase M Human genes 0.000 description 1
- 101710082751 Carboxypeptidase S1 homolog A Proteins 0.000 description 1
- 108090000012 Carboxypeptidase T Proteins 0.000 description 1
- 102000013602 Cardiac Myosins Human genes 0.000 description 1
- 108010051609 Cardiac Myosins Proteins 0.000 description 1
- 108090000391 Caricain Proteins 0.000 description 1
- 108090000397 Caspase 3 Proteins 0.000 description 1
- 108090000426 Caspase-1 Proteins 0.000 description 1
- 102100029855 Caspase-3 Human genes 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 208000029713 Catastrophic antiphospholipid syndrome Diseases 0.000 description 1
- 102000005572 Cathepsin A Human genes 0.000 description 1
- 108010059081 Cathepsin A Proteins 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 108090000267 Cathepsin C Proteins 0.000 description 1
- 102000003902 Cathepsin C Human genes 0.000 description 1
- 102000003908 Cathepsin D Human genes 0.000 description 1
- 108090000258 Cathepsin D Proteins 0.000 description 1
- 102000004178 Cathepsin E Human genes 0.000 description 1
- 108090000611 Cathepsin E Proteins 0.000 description 1
- 102000004173 Cathepsin G Human genes 0.000 description 1
- 108090000617 Cathepsin G Proteins 0.000 description 1
- 108090000619 Cathepsin H Proteins 0.000 description 1
- 102000004175 Cathepsin H Human genes 0.000 description 1
- 108090000613 Cathepsin S Proteins 0.000 description 1
- 102100035654 Cathepsin S Human genes 0.000 description 1
- 108090000615 Cathepsin T Proteins 0.000 description 1
- 102100026657 Cathepsin Z Human genes 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102100035437 Ceramide transfer protein Human genes 0.000 description 1
- 101710119334 Ceramide transfer protein Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108010059013 Chaperonin 10 Proteins 0.000 description 1
- 108010058432 Chaperonin 60 Proteins 0.000 description 1
- 108050002052 Chemotaxis inhibitory proteins Proteins 0.000 description 1
- 102100024539 Chymase Human genes 0.000 description 1
- 108090000227 Chymases Proteins 0.000 description 1
- 108090001069 Chymopapain Proteins 0.000 description 1
- 108090000205 Chymotrypsin C Proteins 0.000 description 1
- 102100039511 Chymotrypsin-C Human genes 0.000 description 1
- 102100023336 Chymotrypsin-like elastase family member 3B Human genes 0.000 description 1
- 108010038061 Chymotrypsinogen Proteins 0.000 description 1
- 102000003813 Cis-trans-isomerases Human genes 0.000 description 1
- 108090000175 Cis-trans-isomerases Proteins 0.000 description 1
- 108030007055 Classical-complement-pathway C3/C5 convertases Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 108010042086 Collagen Type IV Proteins 0.000 description 1
- 102000004266 Collagen Type IV Human genes 0.000 description 1
- 102100027995 Collagenase 3 Human genes 0.000 description 1
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 1
- 206010010099 Combined immunodeficiency Diseases 0.000 description 1
- 108700040183 Complement C1 Inhibitor Proteins 0.000 description 1
- 102000055157 Complement C1 Inhibitor Human genes 0.000 description 1
- 102000016574 Complement C3-C5 Convertases Human genes 0.000 description 1
- 108010067641 Complement C3-C5 Convertases Proteins 0.000 description 1
- 108010077762 Complement C4b Proteins 0.000 description 1
- 101710184994 Complement control protein Proteins 0.000 description 1
- 102000003706 Complement factor D Human genes 0.000 description 1
- 108090000059 Complement factor D Proteins 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- 102100030851 Cortistatin Human genes 0.000 description 1
- 229930185483 Cortistatin Natural products 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 101000774636 Crotalus ruber ruber Snake venom metalloproteinase HT-2 Proteins 0.000 description 1
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 1
- 102000004654 Cyclic GMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010003591 Cyclic GMP-Dependent Protein Kinases Proteins 0.000 description 1
- 108090000266 Cyclin-dependent kinases Proteins 0.000 description 1
- 102000003903 Cyclin-dependent kinases Human genes 0.000 description 1
- 108030001451 Cysteine-type carboxypeptidases Proteins 0.000 description 1
- 108091000069 Cystinyl Aminopeptidase Proteins 0.000 description 1
- 102000030900 Cystinyl aminopeptidase Human genes 0.000 description 1
- 108030000958 Cytosol alanyl aminopeptidases Proteins 0.000 description 1
- 102100034560 Cytosol aminopeptidase Human genes 0.000 description 1
- 108030000936 D-stereospecific aminopeptidases Proteins 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 201000004624 Dermatitis Diseases 0.000 description 1
- 102100034579 Desmoglein-1 Human genes 0.000 description 1
- 108030001574 Deuterolysin Proteins 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102100020751 Dipeptidyl peptidase 2 Human genes 0.000 description 1
- 102100020750 Dipeptidyl peptidase 3 Human genes 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 108030006877 Dipeptidyl-dipeptidases Proteins 0.000 description 1
- 108030004793 Dual-specificity kinases Proteins 0.000 description 1
- 108700036067 EC 3.4.21.55 Proteins 0.000 description 1
- 108700036006 EC 3.4.21.67 Proteins 0.000 description 1
- 108700036060 EC 3.4.21.86 Proteins 0.000 description 1
- 108700036061 EC 3.4.21.88 Proteins 0.000 description 1
- 108700036055 EC 3.4.21.90 Proteins 0.000 description 1
- 108700033920 EC 3.4.23.26 Proteins 0.000 description 1
- 108700033912 EC 3.4.23.28 Proteins 0.000 description 1
- 108700033306 EC 3.4.23.30 Proteins 0.000 description 1
- 108700033307 EC 3.4.23.31 Proteins 0.000 description 1
- 108700033393 EC 3.4.24.47 Proteins 0.000 description 1
- 108700033395 EC 3.4.24.49 Proteins 0.000 description 1
- 108700033343 EC 3.4.24.50 Proteins 0.000 description 1
- 108700033346 EC 3.4.24.51 Proteins 0.000 description 1
- 108700033344 EC 3.4.24.54 Proteins 0.000 description 1
- 108700035531 EC 3.4.24.6 Proteins 0.000 description 1
- 108700033391 EC 3.4.24.60 Proteins 0.000 description 1
- 108010014258 Elastin Proteins 0.000 description 1
- 102000016942 Elastin Human genes 0.000 description 1
- 108010067770 Endopeptidase K Proteins 0.000 description 1
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 description 1
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 description 1
- 102100031857 Endoplasmic reticulum resident protein 29 Human genes 0.000 description 1
- 101710113964 Endoplasmic reticulum resident protein 29 Proteins 0.000 description 1
- 102100039328 Endoplasmin Human genes 0.000 description 1
- 101001023854 Enterococcus faecalis (strain ATCC 700802 / V583) Gelatinase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 108090000293 Envelysin Proteins 0.000 description 1
- 108010062466 Enzyme Precursors Proteins 0.000 description 1
- 102000010911 Enzyme Precursors Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 108010008165 Etanercept Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 101150064015 FAS gene Proteins 0.000 description 1
- 108010040476 FITC-annexin A5 Proteins 0.000 description 1
- 108010048049 Factor IXa Proteins 0.000 description 1
- 108010054265 Factor VIIa Proteins 0.000 description 1
- 108010071241 Factor XIIa Proteins 0.000 description 1
- 108010080805 Factor XIa Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 108010039471 Fas Ligand Protein Proteins 0.000 description 1
- 102100029531 Fas-activated serine/threonine kinase Human genes 0.000 description 1
- 108030004420 Fas-activated serine/threonine kinases Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 101710128530 Fibrinogen-binding protein Proteins 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 108090000270 Ficain Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 102000004961 Furin Human genes 0.000 description 1
- 102100030125 GDP-fucose protein O-fucosyltransferase 2 Human genes 0.000 description 1
- 101710114200 GDP-fucose protein O-fucosyltransferase 2 Proteins 0.000 description 1
- 102100031351 Galectin-9 Human genes 0.000 description 1
- 101710121810 Galectin-9 Proteins 0.000 description 1
- 102100021023 Gamma-glutamyl hydrolase Human genes 0.000 description 1
- 108090001072 Gastricsin Proteins 0.000 description 1
- 102100030875 Gastricsin Human genes 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108010026132 Gelatinases Proteins 0.000 description 1
- 102000013382 Gelatinases Human genes 0.000 description 1
- 101000930822 Giardia intestinalis Dipeptidyl-peptidase 4 Proteins 0.000 description 1
- 102100039992 Gliomedin Human genes 0.000 description 1
- 101710177565 Gliomedin Proteins 0.000 description 1
- 206010018372 Glomerulonephritis membranous Diseases 0.000 description 1
- 108030005223 Glu-Glu dipeptidases Proteins 0.000 description 1
- 108010048963 Glutamate carboxypeptidase Proteins 0.000 description 1
- 108010058940 Glutamyl Aminopeptidase Proteins 0.000 description 1
- 102000006485 Glutamyl Aminopeptidase Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100028113 Granulocyte-macrophage colony-stimulating factor receptor subunit alpha Human genes 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 102100030385 Granzyme B Human genes 0.000 description 1
- 208000015023 Graves' disease Diseases 0.000 description 1
- 208000035895 Guillain-Barré syndrome Diseases 0.000 description 1
- 208000012051 H syndrome Diseases 0.000 description 1
- 101150112743 HSPA5 gene Proteins 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 101710178376 Heat shock 70 kDa protein Proteins 0.000 description 1
- 102100034051 Heat shock protein HSP 90-alpha Human genes 0.000 description 1
- 102000012428 Hematopoietic Cell Growth Factors Human genes 0.000 description 1
- 108010022580 Hematopoietic Cell Growth Factors Proteins 0.000 description 1
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 108090000252 Histolysain Proteins 0.000 description 1
- 108090000353 Histone deacetylase Proteins 0.000 description 1
- 102000003964 Histone deacetylase Human genes 0.000 description 1
- 102000006947 Histones Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000627872 Homo sapiens 72 kDa type IV collagenase Proteins 0.000 description 1
- 101000907951 Homo sapiens Chymotrypsin-like elastase family member 3B Proteins 0.000 description 1
- 101000577887 Homo sapiens Collagenase 3 Proteins 0.000 description 1
- 101000931862 Homo sapiens Dipeptidyl peptidase 3 Proteins 0.000 description 1
- 101001027128 Homo sapiens Fibronectin Proteins 0.000 description 1
- 101001009603 Homo sapiens Granzyme B Proteins 0.000 description 1
- 101001016865 Homo sapiens Heat shock protein HSP 90-alpha Proteins 0.000 description 1
- 101001068136 Homo sapiens Hepatitis A virus cellular receptor 1 Proteins 0.000 description 1
- 101001002470 Homo sapiens Interferon lambda-1 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001003135 Homo sapiens Interleukin-13 receptor subunit alpha-1 Proteins 0.000 description 1
- 101001019598 Homo sapiens Interleukin-17 receptor A Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000853000 Homo sapiens Interleukin-26 Proteins 0.000 description 1
- 101000998139 Homo sapiens Interleukin-32 Proteins 0.000 description 1
- 101000960936 Homo sapiens Interleukin-5 receptor subunit alpha Proteins 0.000 description 1
- 101001013150 Homo sapiens Interstitial collagenase Proteins 0.000 description 1
- 101001042362 Homo sapiens Leukemia inhibitory factor receptor Proteins 0.000 description 1
- 101000972485 Homo sapiens Lupus La protein Proteins 0.000 description 1
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 1
- 101000576894 Homo sapiens Macrophage mannose receptor 1 Proteins 0.000 description 1
- 101001106413 Homo sapiens Macrophage-stimulating protein receptor Proteins 0.000 description 1
- 101000990912 Homo sapiens Matrilysin Proteins 0.000 description 1
- 101001011906 Homo sapiens Matrix metalloproteinase-14 Proteins 0.000 description 1
- 101001011884 Homo sapiens Matrix metalloproteinase-15 Proteins 0.000 description 1
- 101001011886 Homo sapiens Matrix metalloproteinase-16 Proteins 0.000 description 1
- 101001011887 Homo sapiens Matrix metalloproteinase-17 Proteins 0.000 description 1
- 101001011896 Homo sapiens Matrix metalloproteinase-19 Proteins 0.000 description 1
- 101001013139 Homo sapiens Matrix metalloproteinase-20 Proteins 0.000 description 1
- 101001013142 Homo sapiens Matrix metalloproteinase-21 Proteins 0.000 description 1
- 101000627851 Homo sapiens Matrix metalloproteinase-23 Proteins 0.000 description 1
- 101000627858 Homo sapiens Matrix metalloproteinase-24 Proteins 0.000 description 1
- 101000627852 Homo sapiens Matrix metalloproteinase-25 Proteins 0.000 description 1
- 101000627854 Homo sapiens Matrix metalloproteinase-26 Proteins 0.000 description 1
- 101000627860 Homo sapiens Matrix metalloproteinase-27 Proteins 0.000 description 1
- 101000627861 Homo sapiens Matrix metalloproteinase-28 Proteins 0.000 description 1
- 101000990902 Homo sapiens Matrix metalloproteinase-9 Proteins 0.000 description 1
- 101000950695 Homo sapiens Mitogen-activated protein kinase 8 Proteins 0.000 description 1
- 101001059662 Homo sapiens Mucosal addressin cell adhesion molecule 1 Proteins 0.000 description 1
- 101000990908 Homo sapiens Neutrophil collagenase Proteins 0.000 description 1
- 101000586302 Homo sapiens Oncostatin-M-specific receptor subunit beta Proteins 0.000 description 1
- 101100407307 Homo sapiens PDCD1LG2 gene Proteins 0.000 description 1
- 101001095266 Homo sapiens Prolyl endopeptidase Proteins 0.000 description 1
- 101000831286 Homo sapiens Protein timeless homolog Proteins 0.000 description 1
- 101000752245 Homo sapiens Rho guanine nucleotide exchange factor 5 Proteins 0.000 description 1
- 101000836383 Homo sapiens Serpin H1 Proteins 0.000 description 1
- 101000990915 Homo sapiens Stromelysin-1 Proteins 0.000 description 1
- 101000577874 Homo sapiens Stromelysin-2 Proteins 0.000 description 1
- 101000577877 Homo sapiens Stromelysin-3 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101100207070 Homo sapiens TNFSF8 gene Proteins 0.000 description 1
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 1
- 101000638251 Homo sapiens Tumor necrosis factor ligand superfamily member 9 Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 1
- 241000714192 Human spumaretrovirus Species 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Chemical group NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 1
- 108090000571 Hypodermin C Proteins 0.000 description 1
- 208000013016 Hypoglycemia Diseases 0.000 description 1
- 102100020755 Hypoxia up-regulated protein 1 Human genes 0.000 description 1
- 108060006678 I-kappa-B kinase Proteins 0.000 description 1
- 102000001284 I-kappa-B kinase Human genes 0.000 description 1
- 230000004950 I-kappaB phosphorylation Effects 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- 101150106931 IFNG gene Proteins 0.000 description 1
- 102000026633 IL6 Human genes 0.000 description 1
- 230000006133 ISGylation Effects 0.000 description 1
- 108010084019 IgA-specific metalloendopeptidase Proteins 0.000 description 1
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010016648 Immunophilins Proteins 0.000 description 1
- 102000000521 Immunophilins Human genes 0.000 description 1
- 206010022491 Insulin resistant diabetes Diseases 0.000 description 1
- 102100021496 Insulin-degrading enzyme Human genes 0.000 description 1
- 108090000828 Insulysin Proteins 0.000 description 1
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 1
- 102100020990 Interferon lambda-1 Human genes 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 1
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 1
- 102100026018 Interleukin-1 receptor antagonist protein Human genes 0.000 description 1
- 101710144554 Interleukin-1 receptor antagonist protein Proteins 0.000 description 1
- 108010017550 Interleukin-10 Receptors Proteins 0.000 description 1
- 102000004551 Interleukin-10 Receptors Human genes 0.000 description 1
- 102100020790 Interleukin-12 receptor subunit beta-1 Human genes 0.000 description 1
- 108010017511 Interleukin-13 Receptors Proteins 0.000 description 1
- 102000004559 Interleukin-13 Receptors Human genes 0.000 description 1
- 102100020791 Interleukin-13 receptor subunit alpha-1 Human genes 0.000 description 1
- 102100035018 Interleukin-17 receptor A Human genes 0.000 description 1
- 102100039879 Interleukin-19 Human genes 0.000 description 1
- 108050009288 Interleukin-19 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 1
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 1
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 1
- 102100026879 Interleukin-2 receptor subunit beta Human genes 0.000 description 1
- 101710195550 Interleukin-23 receptor Proteins 0.000 description 1
- 102100036679 Interleukin-26 Human genes 0.000 description 1
- 108010066979 Interleukin-27 Proteins 0.000 description 1
- 102100021596 Interleukin-31 Human genes 0.000 description 1
- 101710181613 Interleukin-31 Proteins 0.000 description 1
- 102100033501 Interleukin-32 Human genes 0.000 description 1
- 108091007973 Interleukin-36 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 102100039881 Interleukin-5 receptor subunit alpha Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 102100026244 Interleukin-9 receptor Human genes 0.000 description 1
- 108010036012 Iodide peroxidase Proteins 0.000 description 1
- 239000007760 Iscove's Modified Dulbecco's Medium Substances 0.000 description 1
- 102100033903 Isoaspartyl peptidase/L-asparaginase Human genes 0.000 description 1
- 108010055717 JNK Mitogen-Activated Protein Kinases Proteins 0.000 description 1
- 102000019145 JUN kinase activity proteins Human genes 0.000 description 1
- 102000001399 Kallikrein Human genes 0.000 description 1
- 108060005987 Kallikrein Proteins 0.000 description 1
- 101710176219 Kallikrein-1 Proteins 0.000 description 1
- 102100040441 Keratin, type I cytoskeletal 16 Human genes 0.000 description 1
- 108010066364 Keratin-16 Proteins 0.000 description 1
- 101710172072 Kexin Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical group SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- 108010092694 L-Selectin Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ZUKPVRWZDMRIEO-VKHMYHEASA-N L-cysteinylglycine Chemical compound SC[C@H]([NH3+])C(=O)NCC([O-])=O ZUKPVRWZDMRIEO-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 102000007547 Laminin Human genes 0.000 description 1
- 108010085895 Laminin Proteins 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 102000035176 Lectin chaperones Human genes 0.000 description 1
- 108091005751 Lectin chaperones Proteins 0.000 description 1
- 101710180643 Leishmanolysin Proteins 0.000 description 1
- 108030007165 Leucyl endopeptidases Proteins 0.000 description 1
- 102100021747 Leukemia inhibitory factor receptor Human genes 0.000 description 1
- 108010028275 Leukocyte Elastase Proteins 0.000 description 1
- 241000239218 Limulus Species 0.000 description 1
- 108090000726 Limulus clotting factor C Proteins 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 102100022742 Lupus La protein Human genes 0.000 description 1
- 102000019297 Lupus La proteins Human genes 0.000 description 1
- 108050006655 Lupus La proteins Proteins 0.000 description 1
- 102000010836 Lymphocyte Homing Receptors Human genes 0.000 description 1
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 102100026238 Lymphotoxin-alpha Human genes 0.000 description 1
- 102100026894 Lymphotoxin-beta Human genes 0.000 description 1
- 108090000362 Lymphotoxin-beta Proteins 0.000 description 1
- 102100033320 Lysosomal Pro-X carboxypeptidase Human genes 0.000 description 1
- 108010053229 Lysyl endopeptidase Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 108091007144 MMP23A Proteins 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 1
- 108030001712 Macrophage elastases Proteins 0.000 description 1
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 description 1
- 108010090665 Mannosyl-Glycoprotein Endo-beta-N-Acetylglucosaminidase Proteins 0.000 description 1
- 108090000855 Matrilysin Proteins 0.000 description 1
- 108010016113 Matrix Metalloproteinase 1 Proteins 0.000 description 1
- 108010076497 Matrix Metalloproteinase 10 Proteins 0.000 description 1
- 108010076557 Matrix Metalloproteinase 14 Proteins 0.000 description 1
- 108010016165 Matrix Metalloproteinase 2 Proteins 0.000 description 1
- 108010016160 Matrix Metalloproteinase 3 Proteins 0.000 description 1
- 102000004043 Matrix metalloproteinase-15 Human genes 0.000 description 1
- 108090000560 Matrix metalloproteinase-15 Proteins 0.000 description 1
- 102100030201 Matrix metalloproteinase-15 Human genes 0.000 description 1
- 102100030200 Matrix metalloproteinase-16 Human genes 0.000 description 1
- 102100030219 Matrix metalloproteinase-17 Human genes 0.000 description 1
- 102100030218 Matrix metalloproteinase-19 Human genes 0.000 description 1
- 102100024129 Matrix metalloproteinase-24 Human genes 0.000 description 1
- 102100024128 Matrix metalloproteinase-26 Human genes 0.000 description 1
- 102100024132 Matrix metalloproteinase-27 Human genes 0.000 description 1
- 102100026799 Matrix metalloproteinase-28 Human genes 0.000 description 1
- 108030004769 Membrane dipeptidases Proteins 0.000 description 1
- 108090000265 Meprin A Proteins 0.000 description 1
- 102100030876 Meprin A subunit beta Human genes 0.000 description 1
- 108090000263 Meprin B Proteins 0.000 description 1
- 102000003843 Metalloendopeptidases Human genes 0.000 description 1
- 108090000131 Metalloendopeptidases Proteins 0.000 description 1
- 108090000192 Methionyl aminopeptidases Proteins 0.000 description 1
- 102000034452 Methionyl aminopeptidases Human genes 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 102000016397 Methyltransferase Human genes 0.000 description 1
- 101000975489 Metridium senile U-metritoxin-Msn1a Proteins 0.000 description 1
- 108010013295 Microbial collagenase Proteins 0.000 description 1
- 206010049567 Miller Fisher syndrome Diseases 0.000 description 1
- 108010042046 Mitochondrial processing peptidase Proteins 0.000 description 1
- 102100037808 Mitogen-activated protein kinase 8 Human genes 0.000 description 1
- 108030005453 Mitogen-activated protein kinase kinase kinases Proteins 0.000 description 1
- 102000002568 Multienzyme Complexes Human genes 0.000 description 1
- 108010093369 Multienzyme Complexes Proteins 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 108010027383 Muramoylpentapeptide carboxypeptidase Proteins 0.000 description 1
- 108030003249 Muramoyltetrapeptide carboxypeptidases Proteins 0.000 description 1
- 101000715501 Mus musculus Cathepsin 7 Proteins 0.000 description 1
- 101100335081 Mus musculus Flt3 gene Proteins 0.000 description 1
- 101100153533 Mus musculus Ltbr gene Proteins 0.000 description 1
- 101100261153 Mus musculus Mpl gene Proteins 0.000 description 1
- 101100207071 Mus musculus Tnfsf8 gene Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 102000014415 Muscarinic acetylcholine receptor Human genes 0.000 description 1
- 108050003473 Muscarinic acetylcholine receptor Proteins 0.000 description 1
- 101710109431 Mycolysin Proteins 0.000 description 1
- 102000047918 Myelin Basic Human genes 0.000 description 1
- 108700028031 Myelin Basic Proteins 0.000 description 1
- 102000055324 Myelin Proteolipid Human genes 0.000 description 1
- 108700021862 Myelin Proteolipid Proteins 0.000 description 1
- 108010000123 Myelin-Oligodendrocyte Glycoprotein Proteins 0.000 description 1
- 102100034681 Myeloblastin Human genes 0.000 description 1
- 108090000973 Myeloblastin Proteins 0.000 description 1
- 102100031789 Myeloid-derived growth factor Human genes 0.000 description 1
- 102000007524 N-Acetylgalactosaminyltransferases Human genes 0.000 description 1
- 108010046220 N-Acetylgalactosaminyltransferases Proteins 0.000 description 1
- 230000006181 N-acylation Effects 0.000 description 1
- 108030001194 N-formylmethionyl-peptidases Proteins 0.000 description 1
- 230000004988 N-glycosylation Effects 0.000 description 1
- 108010057466 NF-kappa B Proteins 0.000 description 1
- 102000003945 NF-kappa B Human genes 0.000 description 1
- 108090000970 Nardilysin Proteins 0.000 description 1
- 102100021850 Nardilysin Human genes 0.000 description 1
- 102100035487 Nectin-3 Human genes 0.000 description 1
- 108090000812 Neurolysin Proteins 0.000 description 1
- 102100023072 Neurolysin, mitochondrial Human genes 0.000 description 1
- 108030001564 Neutrophil collagenases Proteins 0.000 description 1
- 102100033174 Neutrophil elastase Human genes 0.000 description 1
- 108010066503 Non-stereospecific dipeptidase Proteins 0.000 description 1
- 108010077991 O-GlcNAc transferase Proteins 0.000 description 1
- 230000006179 O-acylation Effects 0.000 description 1
- 230000004989 O-glycosylation Effects 0.000 description 1
- 102100030098 Oncostatin-M-specific receptor subunit beta Human genes 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 102000016979 Other receptors Human genes 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 206010034277 Pemphigoid Diseases 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- 108090000313 Pepsin B Proteins 0.000 description 1
- 108090000882 Peptidyl-Dipeptidase A Proteins 0.000 description 1
- 108010030544 Peptidyl-Lys metalloendopeptidase Proteins 0.000 description 1
- 108030001199 Peptidyl-glycinamidases Proteins 0.000 description 1
- 102000009658 Peptidylprolyl Isomerase Human genes 0.000 description 1
- 108010020062 Peptidylprolyl Isomerase Proteins 0.000 description 1
- 208000031845 Pernicious anaemia Diseases 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 101000604750 Physarum polycephalum Physarolisin Proteins 0.000 description 1
- 108090000316 Pitrilysin Proteins 0.000 description 1
- 108090000113 Plasma Kallikrein Proteins 0.000 description 1
- 102100034869 Plasma kallikrein Human genes 0.000 description 1
- 102100038124 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 108030005449 Polo kinases Proteins 0.000 description 1
- 101710095622 Polyporopepsin Proteins 0.000 description 1
- 241000605894 Porphyromonas Species 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 208000031951 Primary immunodeficiency Diseases 0.000 description 1
- 108010064622 Procollagen N-Endopeptidase Proteins 0.000 description 1
- 102000015339 Procollagen N-endopeptidase Human genes 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 102000056251 Prolyl Oligopeptidases Human genes 0.000 description 1
- 108010044159 Proprotein Convertases Proteins 0.000 description 1
- 102000006437 Proprotein Convertases Human genes 0.000 description 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 1
- 102100038358 Prostate-specific antigen Human genes 0.000 description 1
- 101800001494 Protease 2A Proteins 0.000 description 1
- 101800001491 Protease 3C Proteins 0.000 description 1
- 108010023294 Protease La Proteins 0.000 description 1
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 description 1
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 description 1
- 101710151715 Protein 7 Proteins 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 102000017975 Protein C Human genes 0.000 description 1
- 102000006010 Protein Disulfide-Isomerase Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 102100037097 Protein disulfide-isomerase A3 Human genes 0.000 description 1
- 101710106224 Protein disulfide-isomerase A3 Proteins 0.000 description 1
- 101000851169 Protobothrops flavoviridis Snake venom metalloproteinase trimerelysin-2 Proteins 0.000 description 1
- 101000851199 Protobothrops flavoviridis Zinc metalloproteinase-disintegrin-like HR1b Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 101000925883 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Elastase Proteins 0.000 description 1
- 101000604548 Pseudomonas sp. (strain 101) Pseudomonalisin Proteins 0.000 description 1
- 108090000919 Pyroglutamyl-Peptidase I Proteins 0.000 description 1
- 102100031108 Pyroglutamyl-peptidase 1 Human genes 0.000 description 1
- 102000004892 Pyroglutamyl-peptidase II Human genes 0.000 description 1
- 108090001002 Pyroglutamyl-peptidase II Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108030005459 Receptor protein serine/threonine kinases Proteins 0.000 description 1
- 108090000040 Russellysin Proteins 0.000 description 1
- 230000006191 S-acylation Effects 0.000 description 1
- 230000006295 S-nitrosylation Effects 0.000 description 1
- 101710149263 Saccharolysin Proteins 0.000 description 1
- 101000715359 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) Carboxypeptidase S Proteins 0.000 description 1
- 101100111629 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KAR2 gene Proteins 0.000 description 1
- 108090000077 Saccharopepsin Proteins 0.000 description 1
- 101000935814 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Periplasmic beta-glucosidase Proteins 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 241000242678 Schistosoma Species 0.000 description 1
- 108010080085 Scytalidium lignicolum acid proteases Proteins 0.000 description 1
- 206010054979 Secondary immunodeficiency Diseases 0.000 description 1
- 108010004832 Serine-Type D-Ala-D-Ala Carboxypeptidase Proteins 0.000 description 1
- 102000030899 Serine-Type D-Ala-D-Ala Carboxypeptidase Human genes 0.000 description 1
- 102100027287 Serpin H1 Human genes 0.000 description 1
- 108090000899 Serralysin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 102000014744 Small Cytoplasmic Ribonucleoproteins Human genes 0.000 description 1
- 108010078688 Small Cytoplasmic Ribonucleoproteins Proteins 0.000 description 1
- 102000004598 Small Nuclear Ribonucleoproteins Human genes 0.000 description 1
- 108010003165 Small Nuclear Ribonucleoproteins Proteins 0.000 description 1
- 241000713675 Spumavirus Species 0.000 description 1
- 241000194048 Streptococcus equi Species 0.000 description 1
- 102100028847 Stromelysin-3 Human genes 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 101710137302 Surface antigen S Proteins 0.000 description 1
- 201000009594 Systemic Scleroderma Diseases 0.000 description 1
- 206010042953 Systemic sclerosis Diseases 0.000 description 1
- 229940123155 T cell inhibitor Drugs 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 108091007178 TNFRSF10A Proteins 0.000 description 1
- 229940123369 TRAIL receptor agonist Drugs 0.000 description 1
- 108091008003 TRAIL-RI Proteins 0.000 description 1
- 108091008004 TRAIL-RII Proteins 0.000 description 1
- 101710181297 Thermomycolin Proteins 0.000 description 1
- 108090000763 Thermopsin Proteins 0.000 description 1
- 102100031293 Thimet oligopeptidase Human genes 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 102000009843 Thyroglobulin Human genes 0.000 description 1
- 102100027188 Thyroid peroxidase Human genes 0.000 description 1
- 102100029337 Thyrotropin receptor Human genes 0.000 description 1
- ISWQCIVKKSOKNN-UHFFFAOYSA-L Tiron Chemical compound [Na+].[Na+].OC1=CC(S([O-])(=O)=O)=CC(S([O-])(=O)=O)=C1O ISWQCIVKKSOKNN-UHFFFAOYSA-L 0.000 description 1
- 102000057032 Tissue Kallikreins Human genes 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 108020000411 Toll-like receptor Proteins 0.000 description 1
- 102000002689 Toll-like receptor Human genes 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 description 1
- 102000011117 Transforming Growth Factor beta2 Human genes 0.000 description 1
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 description 1
- 101800000304 Transforming growth factor beta-2 Proteins 0.000 description 1
- 102000056172 Transforming growth factor beta-3 Human genes 0.000 description 1
- 108090000097 Transforming growth factor beta-3 Proteins 0.000 description 1
- 108010070926 Tripeptide aminopeptidase Proteins 0.000 description 1
- 108010039203 Tripeptidyl-Peptidase 1 Proteins 0.000 description 1
- 102100034197 Tripeptidyl-peptidase 1 Human genes 0.000 description 1
- 102100040411 Tripeptidyl-peptidase 2 Human genes 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 108030000963 Tryptophanyl aminopeptidases Proteins 0.000 description 1
- 102000004342 Tubulinyl-Tyr carboxypeptidases Human genes 0.000 description 1
- 108090000906 Tubulinyl-Tyr carboxypeptidases Proteins 0.000 description 1
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 1
- 108090000138 Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 101710187743 Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 1
- 206010045170 Tumour lysis syndrome Diseases 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- LFTYTUAZOPRMMI-LDDHHVEYSA-N UDP-N-acetyl-D-galactosamine Chemical compound O1[C@H](CO)[C@H](O)[C@H](O)[C@@H](NC(=O)C)C1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-LDDHHVEYSA-N 0.000 description 1
- 108010009135 Uca pugilator serine collagenase 1 Proteins 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 108090000509 Venombin A Proteins 0.000 description 1
- 101001124322 Vibrio proteolyticus Neutral protease Proteins 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 108010038900 X-Pro aminopeptidase Proteins 0.000 description 1
- 102100039662 Xaa-Pro dipeptidase Human genes 0.000 description 1
- 101710171640 Xaa-Pro dipeptidase Proteins 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 210000004093 acidophilic erythroblast Anatomy 0.000 description 1
- 108090000350 actinidain Proteins 0.000 description 1
- 229910052768 actinide Inorganic materials 0.000 description 1
- 150000001255 actinides Chemical class 0.000 description 1
- 230000021917 activation of membrane attack complex Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 229960002964 adalimumab Drugs 0.000 description 1
- 201000009628 adenosine deaminase deficiency Diseases 0.000 description 1
- 230000006154 adenylylation Effects 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 201000009961 allergic asthma Diseases 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- 102000003801 alpha-2-Antiplasmin Human genes 0.000 description 1
- 108090000183 alpha-2-Antiplasmin Proteins 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 108090000449 aminopeptidase B Proteins 0.000 description 1
- 229920001586 anionic polysaccharide Polymers 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 229960005348 antithrombin iii Drugs 0.000 description 1
- 125000000637 arginyl group Chemical group N[C@@H](CCCNC(N)=N)C(=O)* 0.000 description 1
- 108010055066 asparaginylendopeptidase Proteins 0.000 description 1
- 108090000987 aspergillopepsin I Proteins 0.000 description 1
- 108090000871 atrolysin A Proteins 0.000 description 1
- 108010070189 atroxase Proteins 0.000 description 1
- 201000005000 autoimmune gastritis Diseases 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 201000004982 autoimmune uveitis Diseases 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 238000005815 base catalysis Methods 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 229960002537 betamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-DVTGEIKXSA-N betamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-DVTGEIKXSA-N 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 210000001109 blastomere Anatomy 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 239000003114 blood coagulation factor Substances 0.000 description 1
- 238000010504 bond cleavage reaction Methods 0.000 description 1
- 235000019835 bromelain Nutrition 0.000 description 1
- 230000006242 butyrylation Effects 0.000 description 1
- 238000010514 butyrylation reaction Methods 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 108090001015 cancer procoagulant Proteins 0.000 description 1
- 230000021235 carbamoylation Effects 0.000 description 1
- 108091006008 carbamylated proteins Proteins 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000030570 cellular localization Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- BFPSDSIWYFKGBC-UHFFFAOYSA-N chlorotrianisene Chemical compound C1=CC(OC)=CC=C1C(Cl)=C(C=1C=CC(OC)=CC=1)C1=CC=C(OC)C=C1 BFPSDSIWYFKGBC-UHFFFAOYSA-N 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 229960002976 chymopapain Drugs 0.000 description 1
- 108091006007 citrullinated proteins Proteins 0.000 description 1
- 230000006329 citrullination Effects 0.000 description 1
- 238000011281 clinical therapy Methods 0.000 description 1
- 108010065327 clostridial aminopeptidase Proteins 0.000 description 1
- 108090001092 clostripain Proteins 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 229940126051 coagulation factor XIa Drugs 0.000 description 1
- 229910017052 cobalt Inorganic materials 0.000 description 1
- 239000010941 cobalt Substances 0.000 description 1
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 108010027437 compstatin Proteins 0.000 description 1
- 229950007276 conatumumab Drugs 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 108010005430 cortistatin Proteins 0.000 description 1
- DDRPLNQJNRBRNY-WYYADCIBSA-N cortistatin-14 Chemical compound C([C@H]1C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N1)NC(=O)[C@H]1NCCC1)C(=O)N[C@@H](CCCCN)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 DDRPLNQJNRBRNY-WYYADCIBSA-N 0.000 description 1
- 201000003278 cryoglobulinemia Diseases 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 230000006240 deamidation Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Chemical group NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 102000038379 digestive enzymes Human genes 0.000 description 1
- 108091007734 digestive enzymes Proteins 0.000 description 1
- 108090000212 dipeptidyl peptidase II Proteins 0.000 description 1
- FOOBQHKMWYGHCE-UHFFFAOYSA-N diphthamide Chemical compound C[N+](C)(C)C(C(N)=O)CCC1=NC=C(CC(N)C([O-])=O)N1 FOOBQHKMWYGHCE-UHFFFAOYSA-N 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 229960002224 eculizumab Drugs 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 230000006330 eliminylation Effects 0.000 description 1
- 229940073621 enbrel Drugs 0.000 description 1
- 239000006274 endogenous ligand Substances 0.000 description 1
- 108010003914 endoproteinase Asp-N Proteins 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical group NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 230000006163 ethanolamine phosphoglycerol attachment Effects 0.000 description 1
- 230000006203 ethylation Effects 0.000 description 1
- 238000006200 ethylation reaction Methods 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 231100000776 exotoxin Toxicity 0.000 description 1
- 239000002095 exotoxin Substances 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 102000025748 fibrinogen binding proteins Human genes 0.000 description 1
- 235000019836 ficin Nutrition 0.000 description 1
- POTUGHMKJGOKRI-UHFFFAOYSA-N ficin Chemical compound FI=CI=N POTUGHMKJGOKRI-UHFFFAOYSA-N 0.000 description 1
- FVTCRASFADXXNN-SCRDCRAPSA-N flavin mononucleotide Chemical compound OP(=O)(O)OC[C@@H](O)[C@@H](O)[C@@H](O)CN1C=2C=C(C)C(C)=CC=2N=C2C1=NC(=O)NC2=O FVTCRASFADXXNN-SCRDCRAPSA-N 0.000 description 1
- 125000004072 flavinyl group Chemical group 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 102000035175 foldases Human genes 0.000 description 1
- 108091005749 foldases Proteins 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 108090000285 fruit bromelain Proteins 0.000 description 1
- 244000053095 fungal pathogen Species 0.000 description 1
- 108010062699 gamma-Glutamyl Hydrolase Proteins 0.000 description 1
- 230000006251 gamma-carboxylation Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 108010008714 glucose-regulated protein 170 Proteins 0.000 description 1
- 108010017007 glucose-regulated proteins Proteins 0.000 description 1
- 108090000639 glutamyl endopeptidase II Proteins 0.000 description 1
- 230000035430 glutathionylation Effects 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- 102000045442 glycosyltransferase activity proteins Human genes 0.000 description 1
- 108700014210 glycosyltransferase activity proteins Proteins 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 230000006095 glypiation Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 101150028578 grp78 gene Proteins 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 230000002949 hemolytic effect Effects 0.000 description 1
- 230000006149 hemylation Effects 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 208000014342 histiocytosis-lymphadenopathy plus syndrome Diseases 0.000 description 1
- 229940048921 humira Drugs 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Chemical group NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000002218 hypoglycaemic effect Effects 0.000 description 1
- 230000006164 hypusine formation Effects 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000005931 immune cell recruitment Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 229940027941 immunoglobulin g Drugs 0.000 description 1
- 238000002650 immunosuppressive therapy Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 229960000598 infliximab Drugs 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 108010093036 interleukin receptors Proteins 0.000 description 1
- 102000002467 interleukin receptors Human genes 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 108010074109 interleukin-22 Proteins 0.000 description 1
- 108040006862 interleukin-9 receptor activity proteins Proteins 0.000 description 1
- 210000004005 intermediate erythroblast Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 229940029329 intrinsic factor Drugs 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 230000006122 isoprenylation Effects 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- TWNIBLMWSKIRAT-VFUOTHLCSA-N levoglucosan Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@H]2CO[C@@H]1O2 TWNIBLMWSKIRAT-VFUOTHLCSA-N 0.000 description 1
- 229950002884 lexatumumab Drugs 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 230000006144 lipoylation Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 230000006216 lysine-methylation Effects 0.000 description 1
- 108010057284 lysosomal Pro-X carboxypeptidase Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 230000017538 malonylation Effects 0.000 description 1
- 229950001869 mapatumumab Drugs 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 108090000440 matrix metalloproteinase 25 Proteins 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 201000008350 membranous glomerulonephritis Diseases 0.000 description 1
- 231100000855 membranous nephropathy Toxicity 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 210000001589 microsome Anatomy 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- 108010035972 myxobacter alpha-lytic proteinase Proteins 0.000 description 1
- 229960005027 natalizumab Drugs 0.000 description 1
- 230000009527 neddylation Effects 0.000 description 1
- 108010068617 neonatal Fc receptor Proteins 0.000 description 1
- 201000008383 nephritis Diseases 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229910052759 nickel Inorganic materials 0.000 description 1
- 230000036963 noncompetitive effect Effects 0.000 description 1
- 230000000269 nucleophilic effect Effects 0.000 description 1
- 230000005257 nucleotidylation Effects 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 210000004248 oligodendroglia Anatomy 0.000 description 1
- 108090000857 oligopeptidase B Proteins 0.000 description 1
- 108010003052 omptin outer membrane protease Proteins 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 108090000021 oryzin Proteins 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- 108090000155 pancreatic elastase II Proteins 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 229940066716 pepsin a Drugs 0.000 description 1
- 108090000756 peptidyl dipeptidase B Proteins 0.000 description 1
- 230000000737 periodic effect Effects 0.000 description 1
- 210000004976 peripheral blood cell Anatomy 0.000 description 1
- 208000033808 peripheral neuropathy Diseases 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000005261 phosphopantetheinylation Effects 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 108010020708 plasmepsin Proteins 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 108010066381 preproinsulin Proteins 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 108010035833 pro-ocytocin-neurophysin convertase Proteins 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 108010017378 prolyl aminopeptidase Proteins 0.000 description 1
- 230000006289 propionylation Effects 0.000 description 1
- 238000010515 propionylation reaction Methods 0.000 description 1
- 102000008467 protein O-GlcNAc transferase activity proteins Human genes 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 108020003519 protein disulfide isomerase Proteins 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000001698 pyrogenic effect Effects 0.000 description 1
- 229940043131 pyroglutamate Drugs 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 230000006159 retinylidene Schiff base formation Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108010038196 saccharide-binding proteins Proteins 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 108090000710 scutelarin Proteins 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 108090000346 stem bromelain Proteins 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 108090000135 streptogrisin A Proteins 0.000 description 1
- 230000035322 succinylation Effects 0.000 description 1
- 238000010613 succinylation reaction Methods 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 230000010741 sumoylation Effects 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 239000012747 synergistic agent Substances 0.000 description 1
- 230000005737 synergistic response Effects 0.000 description 1
- JBQYATWDVHIOAR-UHFFFAOYSA-N tellanylidenegermanium Chemical group [Te]=[Ge] JBQYATWDVHIOAR-UHFFFAOYSA-N 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 108010031354 thermitase Proteins 0.000 description 1
- 108010073106 thimet oligopeptidase Proteins 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 230000001732 thrombotic effect Effects 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 108040006218 thyroid-stimulating hormone receptor activity proteins Proteins 0.000 description 1
- 229950004742 tigatuzumab Drugs 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 229960005294 triamcinolone Drugs 0.000 description 1
- GFNANZIMVAIWHM-OBYCQNJPSA-N triamcinolone Chemical compound O=C1C=C[C@]2(C)[C@@]3(F)[C@@H](O)C[C@](C)([C@@]([C@H](O)C4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 GFNANZIMVAIWHM-OBYCQNJPSA-N 0.000 description 1
- 108010039189 tripeptidyl-peptidase 2 Proteins 0.000 description 1
- 208000010380 tumor lysis syndrome Diseases 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 244000052613 viral pathogen Species 0.000 description 1
- 210000000605 viral structure Anatomy 0.000 description 1
- 108010021321 xanthomonapepsin Proteins 0.000 description 1
- 239000002676 xenobiotic agent Substances 0.000 description 1
- 229940099073 xolair Drugs 0.000 description 1
- 108010078692 yeast proteinase B Proteins 0.000 description 1
- 238000001086 yeast two-hybrid system Methods 0.000 description 1
- 108010064359 zinc D-Ala-D-Ala carboxypeptidase Proteins 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/18—Erythrocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/19—Cytokines; Lymphokines; Interferons
- A61K38/191—Tumor necrosis factors [TNF], e.g. lymphotoxin [LT], i.e. TNF-beta
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464424—CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0641—Erythrocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- Red blood cells have been considered for use as drug delivery systems, e.g., to degrade toxic metabolites or inactivate xenobiotics, and in other biomedical applications.
- the invention includes compositions and methods related to multimodal therapies.
- the therapies are useful, e.g., for treating immune conditions, e.g., autoimmune or inflammatory diseases.
- a multimodal therapy described herein provides and/or administers a plurality of agents that function in a coordinated manner to provide a therapeutic benefit to a subject in need thereof, e.g., a subject having an autoimmune or inflammatory disease.
- a multimodal therapy described herein includes the administration to a subject of a preparation of engineered red blood cells, e.g., enucleated red blood cells, comprising (e.g., expressing or containing) a plurality of agents (e.g., polypeptides) that function in a coordinated manner (e.g., agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory).
- agents e.g., polypeptides
- the present disclosure provides an enucleated red blood cell, e.g., a reticulocyte, comprising a plurality of agents, e.g., a plurality of polypeptides (e.g., exogenous polypeptides), e.g., a first exogenous polypeptide, a second exogenous polypeptide, and a third exogenous polypeptide.
- a plurality of agents e.g., a plurality of polypeptides (e.g., exogenous polypeptides), e.g., a first exogenous polypeptide, a second exogenous polypeptide, and a third exogenous polypeptide.
- the present disclosure provides an enucleated red blood cell, e.g., a reticulocyte, comprising a plurality of exogenous polypeptides, wherein a first and a second exogenous polypeptide of the plurality have agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity.
- a reticulocyte comprising a plurality of exogenous polypeptides, wherein a first and a second exogenous polypeptide of the plurality have agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity.
- the present disclosure provides an enucleated red blood cell, e.g., a reticulocyte, comprising a first exogenous polypeptide and a second exogenous polypeptide, wherein:
- any of the aspects herein, e.g., the aspects above, can be characterized by one or more of the embodiments herein, e.g., the embodiments below.
- the exogenous polypeptides have synergistic activity. In some embodiments, the exogenous polypeptides have additive activity.
- the exogenous polypeptides have proximity-dependent activity.
- the proximity between the plurality of polypeptides, before, during, or after, interaction with a target moiety or moieties, may confer a property or result which is not seen in the absence of such proximity in vivo or in vitro.
- the first exogenous polypeptide interacts with, e.g., binds, a first target moiety, e.g., a first target cell polypeptide on a target cell (e.g., an immune effector cell, e.g., a T cell), and the second exogenous polypeptide interacts with, e.g., binds, a second target moiety, e.g., a second target cell polypeptide on the target cell (e.g., wherein binding of the first and second target cell polypeptide alters a biological property of the target cell).
- the first and second targets are subunits of a multimeric complex on the target cell.
- the first exogenous polypeptide promotes fusion of the red blood cell with a target cell and the second exogenous polypeptide is a polypeptide of any of Table 1, Table 2, Table 3, or Table 4 (e.g., a human polypeptide of any of Table 1, Table 2, Table 3, or Table 4, e.g., a polypeptide having the amino acid sequence of the human wild type polypeptide).
- the first and second exogenous polypeptides interact with one another, e.g., the first modifies, e.g., by cleavage or phosphorylation, the second, or the first and second form a dimeric or multimeric protein.
- the enucleated red blood cell comprises 3, 4, 5, 6, 7, 8, 9, or 10 different exogenous polypeptides.
- a plurality e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10
- the different exogenous polypeptides have a preselected level of homology to each other, e.g., at least 40, 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 99.5% sequence identity to each other.
- a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10), or all, of the different exogenous polypeptides, have a preselected level of homology to a reference sequence, e.g., at least 40, 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, 99.5%, or 100% sequence identity with a reference sequence (which reference sequence, includes an entire polypeptide sequence, or a portion thereof, e.g., a preselected domain), e.g., a plurality or all of the different exogenous polypeptides are antibodies or antibody molecules.
- the reference sequence is an antibody sequence or fragment thereof.
- the reference sequence comprises a heavy chain constant region or portion thereof, light chain constant region or fragment thereof, heavy chain variable region or portion thereof, light chain variable region or fragment thereof, or any combination of the foregoing.
- the enucleated red blood cells are used to treat an immunodeficient subject, e.g., as a substitute for (or combination with) an IVIG therapy.
- the enucleated red blood cell comprises at least 2 but no more than 5, 6, 7, 8, 9, or 10 different exogenous polypeptides, e.g., exogenous polypeptides that are encoded by one or more exogenous nucleic acids that are not retained by the enucleated red blood cell.
- the exogenous polypeptides are encoded by one or more exogenous nucleic acids that are not retained by the enucleated red blood cell.
- one or more (e.g., two or three) of the first, second, and optionally third exogenous polypeptides are transmembrane polypeptides or surface-anchored polypeptides.
- the first exogenous polypeptide interacts with, e.g., binds, a moiety on a target cell
- the second exogenous polypeptide alters a property of the target cell, e.g., kills, activates, inactivates, or induces tolerance or anergy in the target cell.
- the first exogenous polypeptide and the second exogenous polypeptide have an abundance ratio of about 1:1, from about 2:1 to 1:2, from about 5:1 to 1:5, from about 10:1 to 1:10, from about 20:1 to 1:20, from about 50:1 to 1:50, or from about 100:1 to 1:100 by weight or by copy number.
- both the first and second polypeptides have a stoichiometric mode of action, or both have a catalytic mode of action, and both are present at a similar abundance, e.g., about 1:1 or from about 2:1 to 1:2.
- the first exogenous polypeptide is more abundant than the second exogenous polypeptide by at least about 10%, 20%, 30%, 50%, or a factor of 2, 3, 4, 5, 10, 20, 50, or 100 (and optionally up to 10 or 100 fold) by weight or copy number.
- the second exogenous polypeptide is more abundant than the first exogenous polypeptide by at least about 10%, 20%, 30%, 50%, or a factor of 2, 3, 4, 5, 10, 20, 50, or 100 (and optionally up to 10 or 100 fold) by weight or copy number.
- the first polypeptide has a stoichiometric mode of action and the second polypeptide has a catalytic mode of action, and the first polypeptide is more abundant than the second polypeptide.
- the second polypeptide has a stoichiometric mode of action and the first polypeptide has a catalytic mode of action, and the second polypeptide is more abundant than the first polypeptide.
- the first exogenous polypeptide comprises a targeting moiety.
- the enucleated red blood cell has one or more of the following characteristics:
- At least one, e.g., all, of the plurality of exogenous polypeptides are glycosylated. In some embodiments, at least one, e.g., all, of the plurality of exogenous polypeptides are phosphorylated.
- the enucleated red blood cell is a reticulocyte.
- the exogenous polypeptide or polypeptides lack a sortase transfer signature (i.e., a sequence that can be created by a sortase reaction) such as LPXTG (SEQ ID NO: 17).
- a sortase transfer signature i.e., a sequence that can be created by a sortase reaction
- LPXTG SEQ ID NO: 17
- the present disclosure provides a method of treating a disease or condition described herein, comprising administering to a subject in need thereof an enucleated red blood cell, e.g., a reticulocyte, described herein.
- an enucleated red blood cell e.g., a reticulocyte, described herein.
- the disease or condition is an inflammatory disease, or an autoimmune disease.
- the present disclosure provides a method of bringing into proximity a first and a second cell surface moiety, e.g., transmembrane receptors, comprising administering to a subject in need thereof an enucleated red blood cell, e.g., a reticulocyte, described herein.
- a first and a second cell surface moiety e.g., transmembrane receptors
- the present disclosure provides a method of delivering, presenting, or expressing a plurality of proximity-dependent molecules comprising providing an enucleated red blood cell, e.g., a reticulocyte, described herein.
- the present disclosure provides a method of producing an enucleated red blood cell, e.g., a reticulocyte, described herein, providing contacting a red blood cell precursor with one or more nucleic acids encoding the exogenous polypeptides and placing the cell in conditions that allow enucleation to occur.
- an enucleated red blood cell e.g., a reticulocyte
- the present disclosure provides a preparation, e.g., pharmaceutical preparation, comprising a plurality of enucleated red blood cells, e.g., reticulocytes, described herein, e.g., at least 10 8 , 10 9 , 10 10 , 10 11 , or 10 12 cells.
- the present disclosure provides a cell complex, e.g., an in vitro or in vivo complex, of an engineered red blood cell (RBC), e.g., an enucleated red blood cell, e.g., a reticulocyte, and a target cell, the complex mediated by one of the exogenous polypeptides.
- RBC red blood cell
- the cell complex comprises at least 2, 3, 4, 5, 10, 20, 50, or 100 cells.
- the present disclosure proves a reaction mixture comprising an engineered RBC, e.g., an enucleated red blood cell, e.g., a reticulocyte, and nucleic acid, e.g., one or more nucleic acid molecules, encoding a multimodal pair described herein.
- the nucleic acid comprises at least one promoter that is active in a red blood cell.
- nucleic acid encodes at least two proteins described herein (e.g., in Table 1, Table 2, Table 3, and Table 4).
- the nucleic acid encodes a third exogenous polypeptide.
- the present disclosure comprises a method of making an engineered RBC (e.g., an enucleated red blood cell, e.g., a reticulocyte) described herein, comprising: providing, e.g., receiving, information about a target cell or subject, responsive to that information selecting a plurality of exogenous polypeptides, and introducing nucleic acids encoding the exogenous polypeptides into a RBC or RBC precursor.
- an engineered RBC e.g., an enucleated red blood cell, e.g., a reticulocyte
- the present invention comprises a method of evaluating an engineered RBC (e.g., enucleated RBC, e.g., a reticulocyte), comprising providing a candidate RBC, and determining if nucleic acid encoding a plurality of exogenous polypeptides, e.g., a multimodal pair of the exogenous polypeptides, are present.
- an engineered RBC e.g., enucleated RBC, e.g., a reticulocyte
- an enucleated erythroid cell comprising:
- the second exogenous polypeptide comprises a moiety that cleaves an antibody, e.g., that cleaves at a hinge region, a CH2 region, or between a hinge and CH2 region, e.g., an IdeS polypeptide;
- the second exogenous polypeptide comprises an enzyme (e.g., a protease) that modifies, e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor;
- an enzyme e.g., a protease
- modifies e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor;
- the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme, e.g., a protease, that modifies the secondary, tertiary, or quaternary structure of the target, and, in embodiments, alters, e.g., decreases or increases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide, wherein optionally the target comprises an antibody, or complement factor;
- a polypeptide e.g., an enzyme, e.g., a protease, that modifies the secondary, tertiary, or quaternary structure of the target, and, in embodiments, alters, e.g., decreases or increases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide, wherein optionally the target
- the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme (e.g., a protease) that cleaves the target, e.g., a polypeptide, between a first target domain and a second target domain, e.g., a first target domain that binds a first substrate and a second target domain that binds a second substrate;
- an enzyme e.g., a protease
- the target is a polypeptide (e.g., an autoantibody or a complement factor); a carbohydrate (e.g., a glycan), a lipid (e.g., a phospholipid), or a nucleic acid (e.g., DNA, or RNA);
- a polypeptide e.g., an autoantibody or a complement factor
- carbohydrate e.g., a glycan
- a lipid e.g., a phospholipid
- nucleic acid e.g., DNA, or RNA
- the first exogenous polypeptide binds a target, e.g., an antibody, but does not cleave, and the second exogenous polypeptide cleaves a bond e.g., a covalent bond, e.g., a covalent bond in the antibody;
- the target comprises an antibody and the first exogenous polypeptide binds the variable region of the antibody target
- the target comprises an antibody and first exogenous polypeptide binds the constant region of the antibody target;
- the first exogenous polypeptide has an affinity for the target that is about 1-2 pM, 2-5 pM, 5-10 pM, 10-20 pM, 20-50 pM, 50-100 pM, 100-200 pM, 200-500 pM, 500-1000 pM, 1-2 nM, 2-5 nM, 5-10 nM, 10-20 nM, 20-50 nM, 50-100 nM, 100-200 nM, 200-500 nM, 500-1000 nM, 1-2 ⁇ M, 2-5 ⁇ M, 5-10 ⁇ M, 10-20 ⁇ M, 20-50 ⁇ M, or 50-100 ⁇ M;
- the second exogenous polypeptide has a K M for the target of about 10 ⁇ 1 -10 ⁇ 7 M, 10 ⁇ 1 -10 ⁇ 2 M, 10 ⁇ 2 -10 ⁇ 3 M, 10 ⁇ 3 -10 ⁇ 4 M, 10 ⁇ 4 -10 ⁇ 5 M, 10 ⁇ 5 -10 ⁇ 6 M, or 10 ⁇ 6 -10 ⁇ 7 M;
- a ratio of the K d of the first exogenous polypeptide for the target (measured in M) divided by the K M of the second exogenous polypeptide for the target (measured in M) is about 1 ⁇ 10 ⁇ 9 -2 ⁇ 10 ⁇ 9 , 2 ⁇ 10 ⁇ 9 -5 ⁇ 10 ⁇ 9 , 5 ⁇ 10 ⁇ 9 -1 ⁇ 10 ⁇ 8 , 1 ⁇ 10 ⁇ 8 -2 ⁇ 10 ⁇ 8 , 2 ⁇ 10 ⁇ 8 -5 ⁇ 10 ⁇ 8 , 5 ⁇ 10 ⁇ 8 -1 ⁇ 10 ⁇ 7 , 1 ⁇ 10 ⁇ 7 -2 ⁇ 10 ⁇ 7 , 2 ⁇ 10 ⁇ 7 -5 ⁇ 10 ⁇ 7 , 5 ⁇ 10 ⁇ 7 -1 ⁇ 10 ⁇ 6 , 1 ⁇ 10 ⁇ 6 -2 ⁇ 10 ⁇ 6 , 2 ⁇ 10 ⁇ 6 -5 ⁇ 10 ⁇ 6 , 5 ⁇ 10 ⁇ 6 -1 ⁇ 10 ⁇ 5 , 1 ⁇ 10 ⁇ 5 -2 ⁇ 10 ⁇ 5 , 2 ⁇ 10 ⁇ 5
- a ratio of the average number of the first exogenous polypeptide on the erythroid cell to the average number of the second exogenous polypeptide on the erythroid cell is about 50:1, 20:1, 10:1, 8:1, 6:1, 4:1, 2:1, 1:1, 1:2, 1:4, 1:6, 1:8, 1:10, 1:20, or 1:50;
- affinity of the first exogenous polypeptide for the target is greater than the affinity of the first exogenous polypeptide for the modified (e.g., cleaved) target;
- a therapeutically effective dose of the enucleated erythroid cell is less than stoichiometry (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) to the amount of target in a subject's peripheral blood at the time of administration;
- the number of enucleated erythroid cells in an effective dose is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) the number of targets, e.g., target molecules, in the subject's peripheral blood at the time of administration;
- the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells e.g., an effective dose, or in vitro effective amount of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- the number of first exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells e.g., an effective dose, or in vitro effective amount of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (s) the number of first exogenous polypeptides and the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose, enucleated erythroid cells, is each less than a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- the second exogenous polypeptide modifies (e.g. cleaves) the target with a K M of at least 10 ⁇ 1 M, 10 ⁇ 2 M, 10 ⁇ 3 M, 10 ⁇ 4 M, 10 ⁇ 5 M, 10 ⁇ 6 M, or 10 ⁇ 7 M;
- the second exogenous polypeptide comprises a chaperone
- the first exogenous polypeptide comprises a surface-exposed portion and the second exogenous polypeptide comprises a surface exposed portion;
- an effective amount of the enucleated erythroid cells is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) an effective amount of otherwise similar enucleated erythroid cells that lack the second exogenous polypeptide.
- the second exogenous polypeptide comprises an enzyme (e.g., a protease) that modifies, e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor.
- the modification alters, e.g., increases or decreases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide.
- the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme (e.g., a protease) that cleaves the target, e.g., a polypeptide, between a first target domain and a second target domain, e.g., a first target domain that binds a first substrate and a second target domain that binds a second substrate.
- the first target domain is released from the second target domain.
- cleavage alters the affinity one or both of the first target domain for a first substrate and the affinity of the second target domain for a second substrate.
- the target comprises an antibody and the first target domain comprises one or more CDRs and the second target domain comprises a portion of the constant region, e.g., a Fc region.
- At least two (e.g., at least 3, 4, 5, 6, 7, 8, 9, or 10) of (a)-(w) are present.
- at least (a) and (e) are present.
- at least (a) and (i) are present.
- at least (a) and (j) are present.
- at least (a) and (m) are present.
- at least (a) and (q) are present.
- at least (a) and (r) are present.
- at least (a) and (s) are present.
- at least (e) and (i) are present.
- at least (e) and (j) are present.
- At least (e) and (m) are present. In embodiments, at least (e) and (q) are present. In embodiments, at least (e) and (r) are present. In embodiments, at least (e) and (s) are present. In embodiments, at least (i) and (j) are present. In embodiments, at least (i) and (m) are present. In embodiments, at least (i) and (q) are present. In embodiments, at least (i) and (r) are present. In embodiments, at least (i) and (s) are present. In embodiments, at least (j) and (m) are present. In embodiments, at least (j) and (q) are present. In embodiments, at least (j) and (r) are present.
- At least (j) and (s) are present. In embodiments, at least (m) and (q) are present. In embodiments, at least (m) and (r) are present. In embodiments, at least (m) and (s) are present. In embodiments, at least (q) and (r) are present. In embodiments, at least (q) and (s) are present. In embodiments, at least (r) and (s) are present.
- the target is other than an infectious component, e.g., other than a bacterial component, a viral component, a fungal component, or a parasitic component.
- the first exogenous polypeptide comprises an autoantigen.
- the surface-exposed portion of the first exogenous polypeptide binds the target.
- the surface-exposed portion of the second exogenous polypeptide comprises enzymatic activity, e.g., protease activity.
- the surface-exposed portion of the second exogenous polypeptide enzymatically modifies, e.g., cleaves, the target.
- the target comprises an autoantibody
- the first exogenous polypeptide comprises an autoantigen
- the second exogenous polypeptide comprises a protease that cleaves the autoantibody to produce a Fab portion and an Fc portion.
- the enucleated red blood cell is capable of clearing the target from a subject's body at a faster rate than an otherwise similar enucleated red blood cell that lacks the second exogenous polypeptide.
- the enucleated red blood cell is complexed with the target or a reaction product of the second exogenous protein acting on the target, e.g., during cleavage.
- an enucleated erythroid cell comprising:
- a first exogenous polypeptide comprising a transmembrane domain and a surface-exposed autoantigen capable of binding an autoantibody
- a second exogenous polypeptide comprising a transmembrane domain and a surface-exposed IdeS polypeptide.
- the present disclosure also provides, in some aspects, a polypeptide comprising a protease that can cleave an antibody, e.g., an IdeS polypeptide, and a membrane anchor domain, e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain.
- a polypeptide comprising a protease that can cleave an antibody, e.g., an IdeS polypeptide, and a membrane anchor domain, e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain.
- the disclosure also provides a nucleic acid encoding said polypeptide.
- nucleic acid comprising:
- a first sequence encoding a protease that can cleave an antibody e.g., an IdeS polypeptide
- a second sequence encoding a membrane anchor domain, e.g., a transmembrane domain, wherein the first and second sequences are operatively linked to form a fusion protein
- a promoter sequence that is active in an erythroid cell.
- nucleic acid composition comprising:
- a first nucleic acid sequence encoding a first exogenous polypeptide that interacts with a target, e.g., a first exogenous polypeptide described herein,
- a second nucleic acid sequence encoding a second exogenous polypeptide that modifies the target e.g., a second nucleic acid sequence described herein and
- a promoter sequence that is active in an erythroid cell.
- the first nucleic acid sequence and second nucleic acid sequence are contiguous or are separate molecules (e.g., admixed molecules or in separate containers). In embodiments, the first nucleic acid sequence and second nucleic acid sequence are part of the same open reading frame and have a protease cleavage site situated therebetween. In embodiments, the first nucleic acid is operatively linked to a first promoter and the second nucleic acid is operatively linked to a second promoter.
- kits comprising:
- binding moieties e.g., antibody molecules, e.g., scFv domains
- a plurality of enzymes e.g., proteases
- the present disclosure provides, in some aspects, a method of making a fragment of a target, e.g., a target polypeptide, e.g., a method of making a fragment of a target comprising a first target domain, e.g., a method of making a variable region fragment, or a method of making a constant region containing fragment, comprising contacting the target polypeptide with an erythroid cell described herein.
- the second exogenous polypeptide cleaves the target to provide the fragment.
- the target polypeptide is an antibody, e.g., an autoantibody.
- the fragment of the target polypeptide binds an autoantigen without activating an immune response and/or inflammation.
- the contacting comprises administering the erythroid cell to a subject that comprises the target polypeptide.
- the present disclosure also provides, in certain aspects, a method of making an inhibitor, e.g., a competitive inhibitor, comprising, e.g., contacting a precursor of the inhibitor (a target) with an erythroid cell described herein.
- the second exogenous polypeptide interacts with the target, e.g., cleaves the target.
- the inhibitor is an antibody fragment (e.g., a Fab fragment).
- the target is an antibody which is cleaved to produce an inhibitor which is an antibody fragment, e.g., Fab fragment.
- the inhibitor binds an autoantigen without activating an immune response and/or inflammation.
- the precursor of the inhibitor is an antibody, e.g., an autoantibody.
- the contacting comprises administering the erythroid cell to a subject that comprises the precursor of the inhibitor.
- the present disclosure also provides, in some aspects, a method of converting or activating a target, e.g., a polypeptide, e.g., converting a prodrug to a drug, comprising contacting the polypeptide with an erythroid cell described herein.
- the second exogenous polypeptide interacts with the target (e.g., prodrug), e.g., cleaves the target.
- the prodrug is an antibody, e.g., an autoantibody.
- the drug is an antibody fragment, e.g., a Fab fragment.
- the drug binds an autoantigen without activating an immune response and/or inflammation.
- the contacting comprises administering the erythroid cell to a subject that comprises the polypeptide, e.g., prodrug.
- the present disclosure also provides, in some aspects, a method of converting an endogenous polypeptide from a first activity state to a second activity state (e.g., from an inactive state to an active state or an active state to an inactive state), comprising contacting the endogenous polypeptide with an erythroid cell described herein.
- the second exogenous polypeptide interacts with the target, e.g., covalently modifies, e.g., cleaves the target, or alters its ability to interact with, e.g., bind, another molecule.
- the endogenous polypeptide is an antibody, e.g., an autoantibody.
- the contacting comprises administering the erythroid cell to a subject that comprises the endogenous polypeptide.
- the disclosure provides, in some aspects, a method of reducing a level of a target (e.g., an antibody, e.g., an autoantibody) in a subject, comprising administering to the subject an erythroid cell described herein.
- a target e.g., an antibody, e.g., an autoantibody
- the second exogenous polypeptide interacts with the target, e.g., covalently modifies, e.g., cleaves the target, or alters its ability to interact with, e.g., bind, another molecule.
- the disclosure also provides, in certain aspects, a method of generating an inhibitory fragment of an antibody (e.g., a Fab fragment) in a subject, comprising administering to the subject an erythrocyte cell described herein.
- the disclosure provides, in addition, a method of treating an autoimmune disease in a subject, comprising administering to the subject an erythroid cell described herein.
- the erythroid cell comprises:
- the second exogenous polypeptide comprises a moiety that cleaves an antibody, e.g., that cleaves at a hinge region, a CH2 region, or between a hinge and CH2 region, e.g., an IdeS polypeptide;
- the second exogenous polypeptide comprises an enzyme (e.g., a protease) that modifies, e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor;
- an enzyme e.g., a protease
- modifies e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor;
- the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme, e.g., a protease, that modifies the secondary, tertiary, or quaternary structure of the target, and, in embodiments, alters, e.g., decreases or increases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide, wherein optionally the target comprises an antibody, or complement factor;
- a polypeptide e.g., an enzyme, e.g., a protease, that modifies the secondary, tertiary, or quaternary structure of the target, and, in embodiments, alters, e.g., decreases or increases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide, wherein optionally the target
- the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme (e.g., a protease) that cleaves the target, e.g., a polypeptide, between a first target domain and a second target domain, e.g., a first target domain that binds a first substrate and a second target domain that binds a second substrate;
- an enzyme e.g., a protease
- the target is a polypeptide (e.g., an autoantibody or a complement factor); a carbohydrate (e.g., a glycan), a lipid (e.g., a phospholipid), or a nucleic acid (e.g., DNA, or RNA);
- a polypeptide e.g., an autoantibody or a complement factor
- carbohydrate e.g., a glycan
- a lipid e.g., a phospholipid
- nucleic acid e.g., DNA, or RNA
- the first exogenous polypeptide binds a target, e.g., an antibody, but does not cleave, and the second exogenous polypeptide cleaves a bond e.g., a covalent bond, e.g., a covalent bond in the antibody;
- the target comprises an antibody and the first exogenous polypeptide binds the variable region of the antibody target
- the target comprises an antibody and first exogenous polypeptide binds the constant region of the antibody target;
- the first exogenous polypeptide has an affinity for the target that is about 1-2 pM, 2-5 pM, 5-10 pM, 10-20 pM, 20-50 pM, 50-100 pM, 100-200 pM, 200-500 pM, 500-1000 pM, 1-2 nM, 2-5 nM, 5-10 nM, 10-20 nM, 20-50 nM, 50-100 nM, 100-200 nM, 200-500 nM, 500-1000 nM, 1-2 ⁇ M, 2-5 ⁇ M, 5-10 ⁇ M, 10-20 ⁇ M, 20-50 ⁇ M, or 50-100 ⁇ M;
- the second exogenous polypeptide has a K M for the target of about 10 ⁇ 1 -10 ⁇ 7 M, 10 ⁇ 1 -10 ⁇ 2 M, 10 ⁇ 2 -10 ⁇ 3 M, 10 ⁇ 3 -10 ⁇ 4 M, 10 ⁇ 4 -10 ⁇ 5 M, 10 ⁇ 5 -10 ⁇ 6 M, or 10 ⁇ 6 -10 ⁇ 7 M;
- a ratio of the K d of the first exogenous polypeptide for the target (measured in M) divided by the K M of the second exogenous polypeptide for the target (measured in M) is about 1 ⁇ 10 ⁇ 9 -2 ⁇ 10 ⁇ 9 , 2 ⁇ 10 ⁇ 9 -5 ⁇ 10 ⁇ 9 , 5 ⁇ 10 ⁇ 9 -1 ⁇ 10 ⁇ 8 , 1 ⁇ 10 ⁇ 8 -2 ⁇ 10 ⁇ 8 , 2 ⁇ 10 ⁇ 8 -5 ⁇ 10 ⁇ 8 , 5 ⁇ 10 ⁇ 8 -1 ⁇ 10 ⁇ 7 , 1 ⁇ 10 ⁇ 7 -2 ⁇ 10 ⁇ 7 , 2 ⁇ 10 ⁇ 7 -5 ⁇ 10 ⁇ 7 , 5 ⁇ 10 ⁇ 7 -1 ⁇ 10 ⁇ 6 , 1 ⁇ 10 ⁇ 6 -2 ⁇ 10 ⁇ 6 , 2 ⁇ 10 ⁇ 6 -5 ⁇ 10 ⁇ 6 , 5 ⁇ 10 ⁇ 6 -1 ⁇ 10 ⁇ 5 , 1 ⁇ 10 ⁇ 5 -2 ⁇ 10 ⁇ 5 , 2 ⁇ 10 ⁇ 5
- a ratio of the average number of the first exogenous polypeptide on the erythroid cell to the average number of the second exogenous polypeptide on the erythroid cell is about 50:1, 20:1, 10:1, 8:1, 6:1, 4:1, 2:1, 1:1, 1:2, 1:4, 1:6, 1:8, 1:10, 1:20, or 1:50;
- affinity of the first exogenous polypeptide for the target is greater than the affinity of the first exogenous polypeptide for the modified (e.g., cleaved) target;
- a therapeutically effective dose of the enucleated erythroid cell is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) stoichiometry to the amount of target in a subject's peripheral blood at the time of administration;
- the number of enucleated erythroid cells in an effective dose is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) the number of targets, e.g., target molecules, in the subject's peripheral blood at the time of administration;
- the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells e.g., an effective dose of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- the number of first exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells e.g., an effective dose of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- the second exogenous polypeptide modifies (e.g. cleaves) the target with a K M of at least 10 ⁇ 1 M, 10 ⁇ 2 M, 10 ⁇ 3 M, 10 ⁇ 4 M, 10 ⁇ 5 M, 10 ⁇ 6 M, or 10 ⁇ 7 M;
- the second exogenous polypeptide comprises a chaperone
- the first exogenous polypeptide comprises a surface-exposed portion and the second exogenous polypeptide comprises a surface exposed portion;
- an effective amount of the enucleated erythroid cells is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) an effective amount of otherwise similar enucleated erythroid cells that lack the second exogenous polypeptide.
- compositions and methods described herein involving an exogenous polypeptide e.g., a fusion protein:
- the cell systems described herein may be used in combination with another (one or more) autoimmune therapies or anti-inflammatory agents.
- Such therapies and agents include a steroid, e.g., a corticosteroid (e.g., methylprednisolone, prednisolone, hydrocortisone, cortisone, dexamethasone, betamethasone, triamcinolone), or an interferon, e.g., interferon beta-1.
- a corticosteroid e.g., methylprednisolone, prednisolone, hydrocortisone, cortisone, dexamethasone, betamethasone, triamcinolone
- an interferon e.g., interferon beta-1.
- sequence database reference numbers e.g., sequence database reference numbers
- GenBank, Unigene, and Entrez sequences referred to herein, e.g., in any Table herein are incorporated by reference.
- sequence accession numbers specified herein, including in any Table herein refer to the database entries current as of Jan. 11, 2016.
- FIG. 1 is a set of graphs showing results of a Raji apoptosis assay measured through flow cytometry.
- Raji cells are CFSE labeled and co-cultured with erythroid differentiated cells that are untransduced (control) and transduced with single or multiple TRAIL variants or co-cultured with two different singly transduced cells.
- Percent apoptosis determined by percent of cells that are Raji (CFSE+) and annexin V+.
- Top Flow cytometry plots of CFSE and annexin V staining of various conditions.
- Bottom Graph of percent apoptosis of the various conditions.
- FIG. 2 is a bar graph showing the mean fluorescent intensity from control erythroid cells (UNT) or IdeS-expressing erythroid cells (IDES) labelled with an anti-Rabbit Fc fluorophore labeled antibody, before or after a 5 hour incubation.
- FIG. 3 is a Western blot showing intact heavy chain of target antibodies or fragments of the heavy chain in supernatant from control cells (UNT) or Ide-S expressing cells (IdeS-RCT). Arrows indicate the heavy chain (Hc), heavy chain fragment (Hc-fragment), and light chain (Lc).
- FIG. 4 is a diagram of an erythroid cell comprising a first exogenous polypeptide (white), a second exogenous polypeptide (hatching), and a third exogenous polypeptide (close hatching) wherein each exogenous polypeptide comprises a capture agent capable of trapping a target, e.g., an unwanted target.
- the erythroid cell can engage in dual trapping, where it uses more than one exogenous polypeptide to bind a single or multiple soluble factors.
- FIG. 5 is a diagram of an erythroid cell comprising a first exogenous polypeptide and a second exogenous polypeptide wherein each exogenous polypeptide is capable of trapping an antibody, e.g., unwanted antibody.
- FIG. 6 is a diagram of an erythroid cell comprising a first exogenous polypeptide that binds a target, e.g., an antibody, e.g., an unwanted antibody, and a second exogenous polypeptide that modifies the target, e.g., cleaves the target.
- the second exogenous polypeptide may comprise a protease such as IdeS.
- FIG. 7 is a diagram of an erythroid cell comprising a first exogenous polypeptide that binds a target, e.g., an unwanted anti-drug antibody produced by a subject in reaction to treatment with a drug, a second exogenous polypeptide that cleaves the target, and an optional third exogenous polypeptide comprising a therapeutic protein, e.g., an alternative to the drug against which the subject produced anti-drug antibodies.
- a target e.g., an unwanted anti-drug antibody produced by a subject in reaction to treatment with a drug
- a second exogenous polypeptide that cleaves the target e.g., an unwanted anti-drug antibody produced by a subject in reaction to treatment with a drug
- an optional third exogenous polypeptide comprising a therapeutic protein, e.g., an alternative to the drug against which the subject produced anti-drug antibodies.
- FIG. 8 is a diagram of an erythroid cell comprising a first exogenous polypeptide with therapeutic activity, a second exogenous polypeptide that inhibits the first exogenous polypeptide, and optionally a third exogenous polypeptide that comprises a targeting agent, e.g., an anti-CD20 antibody molecule.
- a targeting agent e.g., an anti-CD20 antibody molecule.
- FIG. 9 is a diagram of an erythroid cell comprising a first exogenous polypeptide with a first targeting agent (e.g., an anti-VCAM antibody molecule) and a second exogenous polypeptide with a second targeting agent (e.g., an anti-E-selectin antibody molecule).
- a first targeting agent e.g., an anti-VCAM antibody molecule
- a second targeting agent e.g., an anti-E-selectin antibody molecule
- FIG. 10 is a diagram of an erythroid cell comprising an antagonist and/or agonist.
- FIG. 11 is a diagram or an erythroid cell comprising a targeting agent (e.g., an anti-CD4 antibody molecule) and an internal payload (e.g., IDO).
- a targeting agent e.g., an anti-CD4 antibody molecule
- an internal payload e.g., IDO
- FIG. 12 is a diagram of an erythroid cell comprising a first exogenous polypeptide comprising a targeting agent (e.g., an anti-MAdCAM-1 antibody molecule) and a second exogenous polypeptide comprising an agonist of a target (e.g., wherein the agonist comprises IL10 and the target comprises IL10 Receptor).
- a targeting agent e.g., an anti-MAdCAM-1 antibody molecule
- a second exogenous polypeptide comprising an agonist of a target (e.g., wherein the agonist comprises IL10 and the target comprises IL10 Receptor).
- FIG. 13 is a diagram of an erythroid cell comprising a first exogenous polypeptide comprising a targeting agent (e.g., an anti-BCMA antibody molecule) and a second exogenous polypeptide comprising a capture agent.
- a targeting agent e.g., an anti-BCMA antibody molecule
- FIG. 14 is a diagram of an erythroid cell comprising a first exogenous polypeptide comprising a targeting agent (e.g., an AQP4 epitope) and a second exogenous polypeptide (e.g., TRAIL) that promotes a given activity, e.g., apoptosis.
- a targeting agent e.g., an AQP4 epitope
- TRAIL e.g., TRAIL
- antibody molecule refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence.
- antibody molecule encompasses antibodies and antibody fragments.
- an antibody molecule is a multispecific antibody molecule, e.g., a bispecific antibody molecule.
- antibody molecules include, but are not limited to, Fab, Fab′, F(ab′)2, Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CH1 domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, an isolated epitope binding fragment of an antibody, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv.
- a “combination therapy” or “administered in combination” means that two (or more) different agents or treatments are administered to a subject as part of a treatment regimen for a particular disease or condition.
- the treatment regimen includes the doses and periodicity of administration of each agent such that the effects of the separate agents on the subject overlap.
- the delivery of the two or more agents is simultaneous or concurrent and the agents may be co-formulated.
- the two or more agents are not co-formulated and are administered in a sequential manner as part of a prescribed regimen.
- administration of two or more agents or treatments in combination is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one agent or treatment delivered alone or in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive (e.g., synergistic).
- Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues.
- the therapeutic agents can be administered by the same route or by different routes. For example, a first therapeutic agent of the combination may be administered by intravenous injection while a second therapeutic agent of the combination may be administered orally.
- coordinated means that a plurality of agents work together to provide a therapeutic benefit.
- Types of coordinated activity include agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, and compensatory activity.
- the level of therapeutic benefit conferred by a plurality of exogenous polypeptides delivered in the same enucleated RBC is greater than would be seen if each of the plurality of polypeptides were delivered from different enucleated RBCs.
- nucleated refers to a cell that lacks a nucleus, e.g., a cell that lost its nucleus through differentiation into a mature red blood cell.
- exogenous polypeptide refers to a polypeptide that is not produced by a wild-type cell of that type or is present at a lower level in a wild-type cell than in a cell containing the exogenous polypeptide.
- an exogenous polypeptide is a polypeptide encoded by a nucleic acid that was introduced into the cell, which nucleic acid is optionally not retained by the cell.
- multimodal therapy refers to a therapy, e.g., an enucleated red blood cell therapy, that provides a plurality (e.g., 2, 3, 4, or 5 or more) of exogenous agents (e.g., polypeptides) that have a coordinated function (e.g., agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity).
- a therapy e.g., an enucleated red blood cell therapy
- a coordinated function e.g., agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity.
- pathway refers to a plurality of biological molecules, e.g., polypeptides, that act together in a sequential manner. Examples of pathways include signal transduction cascades and complement cascades.
- a pathway begins with detection of an extracellular signal and ends with a change in transcription of a target gene.
- a pathway begins with detection of a cytoplasmic signal and ends with a change in transcription of a target gene.
- a pathway can be linear or branched. If branched, it can have a plurality of inputs (converging), or a plurality of outputs (diverging).
- a “proximity-dependent” molecule refers to a first molecule that has a different, e.g., greater, activity when in proximity with a second molecule than when alone.
- a pair of proximity-dependent ligands activates a downstream factor more strongly when the ligands are in proximity than when they are distant from each other.
- receptor component refers to a polypeptide that functions as a receptor, by itself or as part of a complex.
- a receptor component encompasses a polypeptide receptor and a polypeptide that functions as part of a receptor complex.
- synergy or “synergistic” means a more than additive effect of a combination of two or more agents (e.g., polypeptides that are part of an enucleated red blood cell) compared to their individual effects.
- synergistic activity is a more-than-additive effect of an enucleated red blood cell comprising a first polypeptide and a second polypeptide, compared to the effect of an enucleated red blood cell comprising the first polypeptide and an enucleated red blood cell comprising the second polypeptide.
- synergistic activity is present when a first agent produces a detectable level of an output X, a second agent produces a detectable level of the output X, and the first and second agents together produce a more-than-additive level of the output X.
- the term “variant” of a polypeptide refers to a polypeptide having at least one sequence difference compared to that polypeptide, e.g., one or more substitutions, insertions, or deletions. In some embodiments, the variant has at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to that polypeptide.
- a variant includes a fragment. In some embodiments, a fragment lacks up to 1, 2, 3, 4, 5, 10, 20, or 100 amino acids on the N-terminus, C-terminus, or both (each independently), compared to the full-length polypeptide.
- the red blood cell therapeutics described herein comprise one or more (e.g., 2, 3, 4, 5, 6, 10 or more) different exogenous agents, e.g., exogenous polypeptides, lipids, or small molecules.
- a red blood cell therapeutic comprises an exogenous fusion polypeptide comprising two or more different proteins described herein.
- an enucleated red blood cell e.g., a reticulocyte, comprises two or more different exogenous polypeptides described herein.
- one or more (e.g., all) of the exogenous polypeptides are human polypeptides or fragments or variants thereof.
- the two or more polypeptides act on the same target, and in other embodiments, they act on two or more different targets.
- the single target or plurality of targets is chosen from an endogenous human protein or a soluble factor (e.g., a polypeptide, small molecule, or cell-free nucleic acid).
- One or more of the exogenous proteins may have post-translational modifications characteristic of eukaryotic cells, e.g., mammalian cells, e.g., human cells.
- one or more (e.g., 2, 3, 4, 5, or more) of the exogenous proteins are glycosylated, phosphorylated, or both.
- PPS Periodic acid-Schiff
- Post-translation modifications also include conjugation to a hydrophobic group (e.g., myristoylation, palmitoylation, isoprenylation, prenylation, or glypiation), conjugation to a cofactor (e.g., lipoylation, flavin moiety (e.g., FMN or FAD), heme C attachment, phosphopantetheinylation, or retinylidene Schiff base formation), diphthamide formation, ethanolamine phosphoglycerol attachment, hypusine formation, acylation (e.g.
- O-acylation, N-acylation, or S-acylation formylation, acetylation, alkylation (e.g., methylation or ethylation), amidation, butyrylation, gamma-carboxylation, malonylation, hydroxylation, iodination, nucleotide addition such as ADP-ribosylation, oxidation, phosphate ester (O-linked) or phosphoramidate (N-linked) formation, (e.g., phosphorylation or adenylylation), propionylation, pyroglutamate formation, S-glutathionylation, S-nitrosylation, succinylation, sulfation, ISGylation, SUMOylation, ubiquitination, Neddylation, or a chemical modification of an amino acid (e.g., citrullination, deamidation, eliminylation, or carbamylation), formation of a disulfide bridge, racemization (e.g.
- glycosylation includes the addition of a glycosyl group to arginine, asparagine, cysteine, hydroxylysine, serine, threonine, tyrosine, or tryptophan, resulting in a glycoprotein.
- the glycosylation comprises, e.g., O-linked glycosylation or N-linked glycosylation.
- one or more of the exogenous polypeptides is a fusion protein, e.g., is a fusion with an endogenous red blood cell protein or fragment thereof, e.g., a transmembrane protein, e.g., GPA or a transmembrane fragment thereof.
- one or more of the exogenous polypeptides is fused with a domain that promotes dimerization or multimerization, e.g., with a second fusion exogenous polypeptide, which optionally comprises a dimerization domain.
- the dimerization domain comprises a portion of an antibody molecule, e.g., an Fc domain or CH3 domain.
- the first and second dimerization domains comprise knob-in-hole mutations (e.g., a T366Y knob and a Y407T hole) to promote heterodimerization.
- An exemplary human polypeptide e.g., a human polypeptide selected from any of Tables 1-6, includes:
- a naturally occurring form of the human polypeptide e.g., a naturally occurring form of the human polypeptide that is not associated with a disease state
- the human polypeptide having a sequence appearing in a database e.g., GenBank database, on Jan. 11, 2017, for example a naturally occurring form of the human polypeptide that is not associated with a disease state having a sequence appearing in a database, e.g., GenBank database, on Jan. 11, 2017;
- a biological activity e.g., an enzymatic activity (e.g., specificity or turnover) or binding activity (e.g., binding specificity or affinity) from a human polypeptide having the sequence of a) or b).
- a biological activity e.g., an enzymatic activity (e.g., specificity or turnover) or binding activity (e.g., binding specificity or affinity) from a human polypeptide having the sequence of a) or b).
- binding activity e.g., binding specificity or affinity
- an exogenous polypeptide comprises a human polypeptide or fragment thereof, e.g., all or a fragment of a human polypeptide of a), b), c), d), e), or f) of the preceding paragraph.
- the exogenous polypeptide comprises a fusion polypeptide comprising all or a fragment of a human polypeptide of a), b), c), d), e), or f) of the preceding paragraph and additional amino acid sequence.
- the additional amino acid sequence comprises all or a fragment of human polypeptide of a), b), c), d), e), or f) of the preceding paragraph for a different human polypeptide.
- the invention contemplates that functional fragments or variants thereof (e.g., a ligand-binding fragment or variant thereof of the receptors listed in Table 1, 2 or 3 or the antigens listed in Table 4) can be made and screened for similar activity as described herein and would be equivalent hereunder if expressed in enucleated RBCs as described herein).
- a ligand-binding fragment or variant thereof of the receptors listed in Table 1, 2 or 3 or the antigens listed in Table 4 can be made and screened for similar activity as described herein and would be equivalent hereunder if expressed in enucleated RBCs as described herein).
- the two or more exogenous agents e.g., polypeptides
- the two or more exogenous agents have related functions that are agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory, as described herein.
- more than one of these descriptors applies to a given RBC.
- agents e.g., polypeptides
- the effect of the agents acting together is greater than the effect of either agent acting alone.
- two agents have different (e.g., complementary) functions in the RBC (e.g., on the RBC surface) and act together to have a stronger effect (compared to either of the agents acting alone), e.g., a higher binding affinity for the target, or a greater degree of modulation of signal transduction by the target, e.g., a single target.
- two or more agents each bind to the same target, e.g., to different epitopes within the same target protein.
- the agents associate with one another, e.g., are members of a heterodimeric complex. In an embodiment, the agents have greater avidity for a target when acting together than when acting alone.
- the two or more agents enable tighter binding to a target than either agent alone.
- a heterodimer of receptor components e.g., cytokine receptor components, e.g., interleukin receptor components, e.g., IL-1 receptor components
- cytokine receptor components e.g., interleukin receptor components, e.g., IL-1 receptor components
- IL-1 interleukin receptor components
- Many signaling molecules form heterodimers or heteromultimers on the cell surface to bind to their ligand.
- Cytokine receptors for example, can be heterodimers or heteromultimers.
- IL-2 receptor comprises three different molecules: IL2Ra, IL2Rb, and IL2Rg.
- the IL-13 receptor is a heterodimer of IL13Ra and IL4R.
- the IL-23 receptor is a heterodimer of IL23R and IL12Rb1.
- the TNFa receptor is, in embodiments, a heterodimer of TNFR1 and TNFR2.
- a red blood cell e.g., a reticulocyte
- a red blood cell e.g., a reticulocyte
- IL23R and IL12Rb1 binds and sequesters IL-23, an inflammatory mediator of the disease.
- a table of cytokines and their receptors is provided herein as Table 1.
- the agents are antibody molecules that bind cytokines, e.g., one or more cytokines of Table 1.
- an enucleated RBC comprises one or more (e.g., 2, 3, 4, 5, or more) cytokine receptor subunits from Table 1 or cytokine-binding variants or fragments thereof.
- an enucleated RBC comprises two or three (e.g., all) cytokine receptor subunits from a single row of Table 1 or cytokine-binding variants or functional fragments thereof.
- the cytokine receptors can be present on the surface of the RBC.
- the expressed receptors typically have the wild type human receptor sequence or a variant or fragment thereof that is able to bind and sequester its target ligand.
- two or more cytokine receptor subunits are linked to each other, e.g., as a fusion protein.
- the first polypeptide comprises a cytokine or fragment or variant thereof, e.g., a cytokine of Table 1 or a fragment or variant thereof.
- the second polypeptide comprises a second cytokine or fragment or variant thereof, e.g., a cytokine of Table 1 or a fragment or variant thereof.
- one or more (e.g., 2 or all) of the cytokines are fused to transmembrane domains (e.g., a GPA transmembrane domain or other transmembrane domain described herein), e.g., such that the cytokine is on the surface of the erythroid cell.
- the erythroid cell further comprises a targeting moiety, e.g., a targeting moiety described in FIG. 12 herein or the section herein entitled “Localization Configurations.”
- a targeting moiety e.g., a targeting moiety described in FIG. 12 herein or the section herein entitled “Localization Configurations.”
- an erythroid cell comprising a plurality of cytokines is used to treat an autoimmune disease, e.g., SLE.
- the agents are different antibody-binding molecules, e.g., Fc-binding molecules, for the capture of antibodies in circulation.
- the agents are non-competitive with one another to enable higher affinity binding of individual antibodies or opsonized particles.
- one or more agent is chosen from protein A, Fc receptor 1 (FcR1), FcR2a, FcR2b, FcR3, FcR4, FcRn (neonatal Fc receptor) or an antibody-binding fragment or variant thereof.
- one or more agent is chosen from an autoantigen or autoantibody-binding fragments or variants thereof, or an anti-idiotypic antibody molecule that binds autoantibodies.
- the enucleated RBC is used to treat an autoimmune disease.
- An enucleated erythroid cell can comprise a first exogenous polypeptide (e.g., an autoantigen) that interacts with a target (e.g., an autoantibody) and a second exogenous polypeptide (e.g., a protease, e.g., IdeS) that modifies the target.
- a first exogenous polypeptide e.g., an autoantigen
- a target e.g., an autoantibody
- a second exogenous polypeptide e.g., a protease, e.g., IdeS
- the erythroid cell is administered to a subject, e.g., a subject having an autoimmune disorder of Table 4.
- an effective amount of the enucleated erythroid cells comprising a first exogenous polypeptide and a second exogenous polypeptide is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) an effective amount of otherwise similar enucleated erythroid cells that lack the first exogenous polypeptide or lack the second exogenous polypeptide.
- the preselected amount is an effective dose or an in vitro effective amount of enucleated erythroid cells.
- the preselected amount is an amount that is effective in an assay, e.g., to convert at least 10%, 20%, 30%, 405, 50%, 60%, 70%, 80%, or 90% of substrate into produce in a preselected amount of time, e.g., 1, 2, 3, 4, 5, or 6 hours.
- the preselected amount is effective to cleave at least 50% of a target antibody in 5 hours.
- the assay may measure, e.g., reduction in levels of soluble, unmodified (e.g., non-cleaved) target in a solution.
- the reference value for targets is the number of targets in the peripheral blood of the subject at the time of administration. In embodiments (e.g., embodiments involving an in vitro effective amount of cells) the reference value for targets is the number of targets in a reaction mixture for an assay.
- First Exogenous Polypeptide e.g., Autoantigen
- the first exogenous polypeptide can bind a target.
- the first exogenous polypeptide comprises a binding domain that recognizes an antibody, e.g., an autoantibody.
- the first domain comprises an autoantigen, e.g., comprises a full length protein or a fragment thereof that binds an autoantibody.
- the first exogenous polypeptide comprises an autoantigen from a protein of Table 4, e.g., comprises a full length protein or a fragment thereof that binds an autoantibody.
- the first exogenous polypeptide comprises a binding domain (e.g., an autoantigen capable of binding an autoantibody) and a membrane anchor domain (e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain).
- a binding domain e.g., an autoantigen capable of binding an autoantibody
- a membrane anchor domain e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain.
- the membrane anchor domain is C-terminal or N-terminal of the modifier (e.g., protease) domain.
- the transmembrane domain comprises GPA or a transmembrane portion thereof, e.g., as set out in SEQ ID NO: 9 herein or a transmembrane portion thereof, or a polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing.
- the GPA polypeptide is C-terminal of the binding domain.
- the first exogenous polypeptide comprises an address moiety or targeting moiety described in WO2007030708, e.g., in pages 34-45 therein, which application is herein incorporated by reference in its entirety.
- the first exogenous polypeptide can comprise a receptor ligand where the target is the receptor.
- a target ligand can be a polypeptide or a small molecule ligand.
- a first exogenous polypeptide may comprise a domain derived from a polypeptide that has an immunoglobulin-like fold, such as the 10th type III domain of human fibronectin (“Fn3”).
- Fn3 is small (about 95 residues), monomeric, soluble and stable. It does not have disulfide bonds which permit improved stability in reducing environments.
- the structure may be described as a beta-sandwich similar to that of Ab VH domain except that Fn3 has seven beta-strands instead of nine. There are three loops on each end of Fn3; and the positions of three of these loops correspond to those of CDR1, 2 and 3 of the VH domain.
- the 94 amino acid Fn3 sequence is:
- the amino acid positions of the CDR-like loops will be defined as residues 23-30 (BC Loop), 52-56 (DE Loop) and 77-87 (FG Loop). Accordingly, one or more of the CDR-like loops may be modified or randomized, to generate a library of Fn3 binding domains which may then be screened for binding to a desired address binding site. See also PCT Publication WO0232925.
- Fn3 is an example of a large subfamily of the immunoglobulin superfamily (IgSF).
- the Fn3 family includes cell adhesion molecules, cell surface hormone and cytokine receptors, chaperonin, and carbohydrate-binding domains, all of which may also be adapted for use as binding agents.
- the structure of the DNA binding domains of the transcription factor NF-kB is also closely related to the Fn3 fold and may also be adapted for use as a binding agent.
- serum albumin such as human serum albumin contains an immunoglobulin-like fold that can be adapted for use as a targeting moiety.
- the first exogenous polypeptide can comprise an engineered polypeptide sequence that was selected, e.g., synthetically evolved, based on its kinetics and selectivity for binding to the address site.
- the sequence of the first exogenous polypeptide is designed using a screen or selection method, e.g., by phage display or yeast two-hybrid screen.
- the first exogenous polypeptide comprises a peptide ligand for a soluble receptor (and optionally the target comprises a soluble receptor), a synthetic peptide that binds a target, a complement regulatory domain (and optionally the target comprises a complement factor), or a ligand for a cell surface receptor (and optionally the target comprises the cell surface receptor).
- Second Exogenous Polypeptide e.g., Protease
- the second exogenous polypeptide (which modifies the target) is a factor set out in Table 5.
- the protease is a protease set out in Table 5.
- the protease is a bacterial protease, a human protease, or a plant protease, or a fragment or variant thereof.
- the second exogenous polypeptide (which modifies the target) is a protease.
- proteases include those classified as Aminopeptidases; Dipeptidases; Dipeptidyl-peptidases and tripeptidyl peptidases; Peptidyl-dipeptidases; Serine-type carboxypeptidases; Metallocarboxypeptidases; Cysteine-type carboxypeptidases; Omegapeptidases; Serine proteinases; Cysteine proteinases; Aspartic proteinases; Metalloproteinases; or Proteinases of unknown mechanism.
- Aminopeptidases include cytosol aminopeptidase (leucyl aminopeptidase), membrane alanyl aminopeptidase, cystinyl aminopeptidase, tripeptide aminopeptidase, prolyl aminopeptidase, arginyl aminopeptidase, glutamyl aminopeptidase, x-pro aminopeptidase, bacterial leucyl aminopeptidase, thermophilic aminopeptidase, clostridial aminopeptidase, cytosol alanyl aminopeptidase, lysyl aminopeptidase, x-trp aminopeptidase, tryptophanyl aminopeptidase, methionyl aminopeptidase, d-stereospecific aminopeptidase, and aminopeptidase.
- cytosol aminopeptidase leucyl aminopeptidase
- membrane alanyl aminopeptidase cystinyl aminopeptidase
- Dipeptidases include x-his dipeptidase, x-arg dipeptidase, x-methyl-his dipeptidase, cys-gly dipeptidase, glu-glu dipeptidase, pro-x dipeptidase, x-pro dipeptidase, met-x dipeptidase, non-stereospecific dipeptidase, cytosol non-specific dipeptidase, membrane dipeptidase, and beta-ala-his dipeptidase.
- Dipeptidyl-peptidases and tripeptidyl peptidases include dipeptidyl-peptidase I, dipeptidyl-peptidase II, dipeptidyl peptidase III, dipeptidyl-peptidase IV, dipeptidyl-dipeptidase, tripeptidyl-peptidase I, and tripeptidyl-peptidase II.
- Peptidyl-dipeptidases include peptidyl-dipeptidase A and peptidyl-dipeptidase B.
- Serine-type carboxypeptidases include lysosomal pro-x carboxypeptidase, serine-type D-ala-D-ala carboxypeptidase, carboxypeptidase C, and carboxypeptidase D.
- Metallocarboxypeptidases include carboxypeptidase A, carboxypeptidase B, lysine(arginine) carboxypeptidase, gly-X carboxypeptidase, alanine carboxypeptidase, muramoylpentapeptide carboxypeptidase, carboxypeptidase H, glutamate carboxypeptidase, carboxypeptidase M, muramoyltetrapeptide carboxypeptidase, zinc D-ala-D-ala carboxypeptidase, carboxypeptidase A2, membrane pro-x carboxypeptidase, tubulinyl-tyr carboxypeptidase, and carboxypeptidase T.
- Omegapeptidases include acylaminoacyl-peptidase, peptidyl-glycinamidase, pyroglutamyl-peptidase I, beta-aspartyl-peptidase, pyroglutamyl-peptidase II, n-formylmethionyl-peptidase, pteroylpoly-[gamma]-glutamate carboxypeptidase, gamma-glu-X carboxypeptidase, and acylmuramoyl-ala peptidase.
- Serine proteinases include chymotrypsin, chymotrypsin C, metridin, trypsin, thrombin, coagulation factor Xa, plasmin, enteropeptidase, acrosin, alpha-lytic protease, glutamyl, endopeptidase, cathepsin G, coagulation factor VIIa, coagulation factor IXa, cucumisi, prolyl oligopeptidase, coagulation factor XIa, brachyurin, plasma kallikrein, tissue kallikrein, pancreatic elastase, leukocyte elastase, coagulation factor XIIa, chymase, complement component c1r55, complement component c1s55, classical-complement pathway c3/c5 convertase, complement factor I, complement factor D, alternative-complement pathway c3/c5 convertase, cerevisin, hypodermin C, lysyl end
- Cysteine proteinases include cathepsin B, papain, ficin, chymopapain, asclepain, clostripain, streptopain, actinide, cathepsin 1, cathepsin H, calpain, cathepsin T, glycyl, endopeptidase, cancer procoagulant, cathepsin S, picornain 3C, picornain 2A, caricain, ananain, stem bromelain, fruit bromelain, legumain, histolysain, and interleukin 1-beta converting enzyme.
- Aspartic proteinases include pepsin A, pepsin B, gastricsin, chymosin, cathepsin D, neopenthesin, renin, retropepsin, pro-opiomelanocortin converting enzyme, aspergillopepsin I, aspergillopepsin II, penicillopepsin, rhizopuspepsin, endothiapepsin, mucoropepsin, candidapepsin, saccharopepsin, rhodotorulapepsin, physaropepsin, acrocylindropepsin, polyporopepsin, pycnoporopepsin, scytalidopepsin A, scytalidopepsin B, xanthomonapepsin, cathepsin E, barrierpepsin, bacterial leader peptida
- Metalloproteinases include atrolysin A, microbial collagenase, leucolysin, interstitial collagenase, neprilysin, envelysin, IgA-specific metalloendopeptidase, procollagen N-endopeptidase, thimet oligopeptidase, neurolysin, stromelysin 1, meprin A, procollagen C-endopeptidase, peptidyl-lys metalloendopeptidase, astacin, stromelysin 2, matrilysin gelatinase, aeromonolysin, pseudolysin, thermolysin, bacillolysin, aureolysin, coccolysin, mycolysin, beta-lytic metalloendopeptidase, peptidyl-asp metalloendopeptidase, neutrophil collagenase, gelatinase B, leishmanolysin
- the second exogenous polypeptide comprises an IdeS polypeptide.
- the IdeS polypeptide comprises the sequence set out below as SEQ ID NO: 8 or a proteolytically active fragment of the sequence of SEQ ID NO: 8 (e.g., a fragment of at least 100, 150, 200, 250, or 300 amino acids) or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing.
- the nucleic acid encodes an IdeS polypeptide having the sequence set out below as SEQ ID NO: 8, or a proteolytically active fragment thereof, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing.
- the second exogenous polypeptide comprises a modifier domain (e.g., a protease domain, e.g., an IdeS polypeptide) and a membrane anchor domain (e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain).
- the membrane anchor domain is C-terminal or N-terminal of the modifier (e.g., protease) domain.
- the transmembrane domain comprises GPA or a transmembrane portion thereof.
- the GPA polypeptide has a sequence of:
- the GPA polypeptide is C-terminal of the modifier (e.g., protease) domain.
- a linker is disposed between the IdeS polypeptide and the transmembrane polypeptide, e.g., a glycine-serine linker, e.g., a linker comprising a sequence of GGSGGSGG (SEQ ID NO: 10) and/or GGGSGGGS (SEQ ID NO: 11).
- the exogenous polypeptide e.g., the second exogenous polypeptide, e.g., a protease, e.g., IdeS polypeptide
- comprises a leader sequence e.g., a GPA leader sequence, e.g., MYGKIIFVLLLSEIVSISA (SEQ ID NO: 12).
- the exogenous polypeptide e.g., the second exogenous polypeptide further comprises a tag, e.g., an HA tag or a FLAG tag.
- the protease cleaves an immunoglobulin at a hinge region, a CH2 region, or between a hinge and CH2 region.
- the protease cleaves an immunoglobulin at one of the sequences below, e.g., between the two italicized glycines or the italicized alanine and glycine in the sequences below.
- the protease cleaves IgG, e.g., IdeS or IgA protease.
- the protease cleaves an immunoglobulin between the Fc and Fab regions, e.g., a histidine-threonine bond between positions 224 and 225 of the heavy chain and/or a glutamic acid-leucine bond between positions 233 and 234 of the heavy chain.
- the protease or other modifier acts on a target listed in Table 5 or Table 6.
- the protease or other modifier acts on (e.g., inactivates or inhibits) a TNF molecule (such as TNF-alpha), e.g., in a subject having sepsis, e.g. bacterial sepsis.
- a TNF molecule such as TNF-alpha
- the first exogenous polypeptide can comprise a TNF-alpha binding moiety such as an anti-TNF-alpha antibody
- the second exogenous polypeptide can comprise a protease that cleaves TNF-alpha, e.g., MT1-MMP, MMP12, tryptase, MT2-MMP, elastase, MMPI, chymotrypsin, or trypsin, or active variants or fragments thereof.
- the second exogenous polypeptide comprises a catalytic moiety described in WO2007030708, e.g., in pages 45-46 therein, which application is herein incorporated by reference in its entirety.
- the second exogenous polypeptide can comprise a moiety capable of acting on a target to induce a chemical change, thereby modulate its activity, e.g., a moiety capable of catalyzing a reaction within a target.
- the second exogenous polypeptide can comprise a naturally occurring enzyme, an active (e.g., catalytically active) fragment thereof, or an engineered enzyme, e.g., a protein engineered to have an enzymatic activity, such as a protein designed to contain a serine protease active motif.
- a catalytic domain of a second exogenous polypeptide may comprise the arrangement of amino acids that are effective to induce the desired chemical change in the target. They may be N- terminal or C-terminal truncated versions of natural enzymes, mutated versions, zymogens, or complete globular domains.
- the second exogenous polypeptide can comprise an enzymatically active site that alone is promiscuous, binding with a cleavage site it recognizes on many different biomolecules, and may have relatively poor reaction kinetics.
- the first exogenous polypeptide supplies or improves specificity by increasing the local concentration of target near the second exogenous polypeptide.
- the second exogenous polypeptide can, in embodiments, modify the target so that it is recognized and acted upon by another enzyme (e.g., an enzyme that is already present in a subject).
- the second exogenous polypeptide comprises a moiety that alters the structure of the target so that its activity is inhibited or upregulated. Many naturally occurring enzymes activate other enzymes, and these can be exploited in accordance with the compositions and methods described herein.
- the second exogenous polypeptide can comprise a protease, a glycosidase, a lipase, or other hydrolases, an amidase (e.g., N-acetylmuramoyl-L-alanine amidase, PGRP-L amidase), or other enzymatic activity, including isomerases, transferases (including kinases), lyases, oxidoreductases, oxidases, aldolases, ketolases, glycosidases, transferases and the like.
- an amidase e.g., N-acetylmuramoyl-L-alanine amidase, PGRP-L amidase
- isomerases including isomerases, transferases (including kinases), lyases, oxidoreductases, oxidases, aldolases, ketolases, glycosidases, transferases and the like
- the second exogenous polypeptide comprises human lysozyme, a functional portion of a human lysozyme, a human PGRP-L, a functional portion of a human PGRP-L, a phospholipase A2, a functional portion of a phospholipase A2, or a matrix metalloproteinase (MMP) extracellular enzyme such as MMP-2 (gelatinase A) or MMP-9 (gelatinase B).
- MMP matrix metalloproteinase
- the second exogenous polypeptide is a serine proteinase, e.g., of the chymotrypsin family which includes the mammalian enzymes such as chymotrypsin, trypsin or elastase or kallikrein, or the substilisin family which includes the bacterial enzymes such as subtilisin.
- the general three-dimensional structure is different in the two families but they have the same active site geometry and catalysis proceeds via the same mechanism.
- the serine proteinases exhibit different substrate specificities which are related to amino acid substitutions in the various enzyme subsites interacting with the substrate residues. Three residues which form the catalytic triad are important in the catalytic process: His-57, Asp-102 and Ser-195 (chymotrypsinogen numbering).
- the second exogenous polypeptide is a cysteine proteinase which includes the plant proteases such as papain, actinidin or bromelain, several mammalian lysosomal cathepsins, the cytosolic calpains (calcium-activated), and several parasitic proteases (e.g., Trypanosoma, Schistosoma).
- Papain is the archetype and the best studied member of the family.
- catalysis proceeds through the formation of a covalent intermediate and involves a cysteine and a histidine residue.
- the essential Cys-25 and His-159 (papain numbering) play the same role as Ser-195 and His-57 respectively.
- the nucleophile is a thiolate ion rather than a hydroxyl group.
- the thiolate ion is stabilized through the formation of an ion pair with neighboring imidazolium group of His-159.
- the attacking nucleophile is the thiolate-imidazolium ion pair in both steps and then a water molecule is not required.
- the second exogenous polypeptide is an aspartic proteinase, most of which belong to the pepsin family.
- the pepsin family includes digestive enzymes such as pepsin and chymosin as well as lysosomal cathepsins D, processing enzymes such as renin, and certain fungal proteases (penicillopepsin, rhizopuspepsin, endothiapepsin).
- a second family comprises viral proteinases such as the protease from the AIDS vims (HIV) also called retropepsin.
- HIV AIDS vims
- catalysis by aspartic proteinases does not involve a covalent intermediate, though a tetrahedral intermediate exists.
- the nucleophilic attack is achieved by two simultaneous proton transfers: one from a water molecule to the dyad of the two carboxyl groups and a second one from the dyad to the carbonyl oxygen of the substrate with the concurrent CO—NH bond cleavage.
- This general acid-base catalysis which may be called a “push-pull” mechanism leads to the formation of a non-covalent neutral tetrahedral intermediate.
- the second exogenous polypeptide is a metalloproteinase, which can be found in bacteria, fungi as well as in higher organisms. They differ widely in their sequences and their structures but the great majority of enzymes contain a zinc (Zn) atom which is catalytically active. In some cases, zinc may be replaced by another metal such as cobalt or nickel without loss of the activity.
- Bacterial thermolysin has been well characterized and its crystallographic structure indicates that zinc is bound by two histidines and one glutamic acid.
- HEXXH histidine ligands for the zinc whereas the third ligand is either a glutamic acid (thermolysin, neprilysin, alanyl aminopeptidase) or a histidine (astacin).
- Other families exhibit a distinct mode of binding of the Zn atom.
- the catalytic mechanism leads to the formation of a non-covalent tetrahedral intermediate after the attack of a zinc-bound water molecule on the carbonyl group of the scissile bond. This intermediate is further decomposed by transfer of the glutamic acid proton to the leaving group.
- the second exogenous polypeptide comprises an isomerase (e.g., an isomerase that breaks and forms chemical bonds or catalyzes a conformational change).
- the isomerase is a racemase (e.g., amino acid racemase), epimerase, cis-trans isomerase, intramolecular oxidoreductase, intramolecular transferase, or intramolecular lyase.
- the second exogenous protease comprises a chaperone, or an active variant or fragment thereof.
- the chaperone can be a general chaperone (e.g., GRP78/BiP, GRP94, GRP170), a lectin chaperone (e.g., calnexin or calreticulin), a non-classical molecular chaperone (e.g., HSP47 or ERp29), a folding chaperone (e.g., PDI, PPI, or ERp57), a bacterial or archaeal chaperone (e.g., Hsp60, GroEL/GroES complex, Hsp70, DnaK, Hsp90, HtpG, Hsp100, C1p family (e.g., C1pA and C1pX), Hsp104).
- a general chaperone e.g., GRP78/BiP, GRP94, GRP170
- the enucleated erythrocyte comprises a co-chaperone, or an active variant or fragment thereof, e.g., immunophilin, Stil, p50 (Cdc37), or Ahal.
- the molecular chaperone is a chaperonin.
- Candidates for the second exogenous protein can be screened based on their activity.
- an assay appropriate for that molecule can be used.
- the assay used to screen the protease can be an assay to detect cleavage products generated by the protease, e.g., a chromatography or gel electrophoresis based assay.
- the second exogenous polypeptide may have kinase activity.
- An assay for kinase activity could measure the amount of phosphate that is covalently incorporated into the target of interest.
- the phosphate incorporated into the target of interest could be a radioisotope of phosphate that can be quantitated by measuring the emission of radiation using a scintillation counter.
- Targets e.g., Antibodies or Complement Pathway Factors
- the target is a target listed in Table 5 or Table 6.
- the target is an immune checkpoint molecule selected from PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 or TGF beta.
- the target is an inhibitory ligand listed in Table 3, and the first exogenous polypeptide optionally comprises a binding domain from a corresponding target receptor of Table 3.
- the target is a target receptor of Table 3, and the first exogenous polypeptide optionally comprises a binding domain from a corresponding inhibitory ligand of Table 3.
- the second exogenous polypeptide comprises a protease that cleaves an immune checkpoint molecule, e.g., trypsin.
- a T cell is inhibited, e.g., by contacting its receptor (e.g., a receptor of Table 3) with an inhibitory ligand of Table 3.
- the target is an antibody e.g., a human antibody.
- the antibody can be, e.g., an autoantibody.
- the antibody can be, e.g., IgA, IgD, IgE, IgG (e.g., IgG1, IgG2, IgG3, or IgG4), or IgM.
- the target is an autoantibody that binds an autoantigen of Table 4.
- the target is an anti-AQP4 autoantibody, wherein the first exogenous polypeptide binds an anti-AQP4 autoantibody and the second polypeptide cleaves the autoantibody (e.g., comprises an IdeS polypeptide), e.g., for treating Neuromyelitis optica.
- the target is an anti-PLA2R autoantibody, wherein the first exogenous polypeptide binds an anti-PLA2R autoantibody and the second polypeptide cleaves the autoantibody (e.g., comprises an IdeS polypeptide), e.g., for treating membranous nephropathy.
- the target is a complement factor, e.g., a factor that acts in the classical complement pathway or the alternative complement pathway.
- the complement factor is a pro-protein or an activated (e.g., cleaved) protein.
- the complement factor comprises C1, C2a, C4b, C3, C3a, C3b, C5, C5a, C5b, C6, C7, C8, or C9.
- the second exogenous polypeptide cleaves the complement factor.
- the second exogenous polypeptide activates the complement factor, e.g., to promote an immune response.
- the second exogenous polypeptide may comprise a complement control protein and/or complement activation family protein such as Factor H or Factor I (which promote C3b cleavage), or a fragment or variant thereof.
- the second exogenous polypeptide inactivates the complement factor, e.g., by cleaving it to yield one or more inactive fragments, e.g., to reduce an unwanted immune response, e.g., to treat an autoimmune or inflammatory disease.
- the first exogenous polypeptide binds a complement factor (e.g., binds complement factor C3b) and the second exogenous polypeptide cleaves the complement factor, e.g., to iC3b.
- the first exogenous polypeptide could comprise Factor H or CR1 or a fragment or variant thereof and the second exogenous polypeptide could comprise Factor I or a fragment or variant thereof.
- Engineered erythroid cells described herein can also be used to treat a subject that has antibodies against a drug (e.g., see FIG. 7 ).
- the erythroid cell can reduce levels of anti-drug antibodies in a subject, and can optionally further comprise a therapeutic protein that treats the disease.
- the erythroid cell comprises a first exogenous polypeptide that binds a target, e.g., wherein the target is an anti-drug antibody.
- the erythroid cell can further comprise a second exogenous polypeptide (e.g., IdeS, or a fragment or variant thereof) that inactivates, e.g., cleaves the target.
- a second exogenous polypeptide e.g., IdeS, or a fragment or variant thereof
- the erythroid cell may optionally further comprise a third exogenous polypeptide, e.g., a therapeutic protein that treats the same disease as the prior therapeutic to which the subject developed anti-drug antibodies, e.g., a therapeutic protein which is the same as or different from the prior therapeutic to which the subject developed anti-drug antibodies.
- a third exogenous polypeptide e.g., a therapeutic protein that treats the same disease as the prior therapeutic to which the subject developed anti-drug antibodies, e.g., a therapeutic protein which is the same as or different from the prior therapeutic to which the subject developed anti-drug antibodies.
- the subject comprises anti-drug antibodies against erythropoietin, an anti-TNF antibody molecule (adalimumab or infliximab), an anti-EGFR antibody (e.g., cetuximab), an anti-CD20 antibody molecule, insulin, an anti-alpha4 integrin antibody molecule (e.g., natalizumab), or an interferon e.g. IFN ⁇ 1a or IFN ⁇ 1b.
- an anti-TNF antibody molecule adalimumab or infliximab
- an anti-EGFR antibody e.g., cetuximab
- an anti-CD20 antibody molecule e.g., insulin
- an anti-alpha4 integrin antibody molecule e.g., natalizumab
- an interferon e.g. IFN ⁇ 1a or IFN ⁇ 1b.
- the first polypeptide comprises an anti-MAdCAM-1 antibody molecule and the second polypeptide comprises LysC or LysN (which can cleave MAdCAM-1 at 1 or more (e.g., 2, 3, or 4 sites), or a fragment or variant thereof having protease activity, e.g., wherein the target tissue is inflamed gut or liver tissue.
- the patient may be tested for the presence of anti-drug antibodies, e.g., for the presence of neutralizing anti-drug antibodies, before, during and/or after administration of the engineered erythroid cells described herein.
- the agents act on two or more different targets within a single pathway.
- the action of the two or more agents together is greater than the action of any of the individual agents.
- the first and second polypeptides are ligands for cellular receptors that signal to the same downstream target.
- the first exogenous polypeptide comprises a ligand for a first target cellular receptor
- the second exogenous polypeptide comprises a ligand for a second target cellular receptor, e.g., which first and second target cellular receptors signal to the same downstream target.
- the first exogenous polypeptide acts on the first target and the second exogenous polypeptide acts on the second target simultaneously, e.g., there is some temporal overlap in binding of the first exogenous polypeptide to the first target and binding of the second exogenous polypeptide to the second target.
- the simultaneous action generates a synergistic response of greater magnitude than would be expected when either target is acted on alone or in isolation.
- the first and second polypeptides are ligands for a first cellular receptor and a second cellular receptor that mediates apoptosis.
- the agents comprise two or more TRAIL receptor ligands, e.g., wild-type or mutant TRAIL polypeptides, or antibody molecules that bind TRAIL receptors, and induce apoptosis in a target cell, e.g., an autoreactive T cell.
- a RBC comprising TRAIL receptor ligands further comprises a targeting moiety, e.g., a targeting moiety described herein.
- the first target and the second target interacts with the same substrate, e.g., a substrate protein.
- the first target and the second target interact with different substrates.
- TRAIL TNF-related apoptosis inducing ligand
- TRAIL has at least two receptors, TRAIL R1 and TRAIL R2.
- TRAIL receptor agonists e.g., mutants of TRAIL that bind one or more of the receptors, or antibody molecules that bind one or both of TRAIL R1 or TRAIL R2 (see, e.g. Gasparian et al., Apoptosis 2009 Jun. 14(6), Buchsbaum et al. Future Oncol 2007 Aug. 3(4)), have been developed as a clinical therapy for a wide range of cancers.
- the agents expressed on the engineered blood cell are single receptor-specific TRAIL agonists that, in combination, enable the cell to engage and agonize both TRAIL receptors simultaneously, thus leading to a synergistic induction of apoptosis of a target cell.
- the enucleated red blood cell (e.g., reticulocyte) comprises on its surface a first polypeptide that binds TRAIL R1 and a second polypeptide that binds TRAIL R2.
- each polypeptide has a Kd for TRAIL R1 or TRAIL R2 that is 2, 3, 4, 5, 10, 20, 50, 100, 200, or 500-fold stronger than the Kd for the other receptor.
- an enucleated red blood cell comprising a TRAIL R1-specific ligand and a TRAIL R2-specific ligand promote better heterodimerization of TRAIL R1 and TRAIL R2 than an enucleated red blood cell comprising a ligand that binds to TRAIL R1 and TRAIL R2 with about the same affinity.
- one, two, or more of the exogenous polypeptides are members of the TNF superfamily.
- the exogenous polypeptides bind to one or both of death receptors DR4 (TRAIL-R1) and DR5 (TRAIL-R2).
- the exogenous polypeptides bind to one or more of TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, or TNFRSF11B/OPG.
- the exogenous polypeptides activate one or more of MAPK8/JNK, caspase 8, and caspase 3.
- a TRAIL polypeptide is a TRAIL agonist having a sequence of any of SEQ ID NOS: 1-5 herein, or a sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. Sequence identity is measured, e.g., by BLAST (Basic Local Alignment Search Tool). SEQ ID Nos. 1-5 are further described in Mohr et al. BMC Cancer (2015) 15:494), which is herein incorporated by reference in its entirety.
- Soluble TRAIL variant DR4-1 SEQ ID NO: 1 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC WQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRRRSNTLSSPNSKNEKALGRKINSW ESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCW SKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG Soluble TRAIL variant DR4-2 SEQ ID NO: 2 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC W
- the first and second agents comprise SEQ ID NO: 1 and SEQ ID NO: 2; SEQ ID NO: 1 and SEQ ID NO: 3; SEQ ID NO: 1 and SEQ ID NO: 4; SEQ ID NO: 1 and SEQ ID NO: 5; SEQ ID NO: 2 and SEQ ID NO: 3; SEQ ID NO: 2 and SEQ ID NO: 4; SEQ ID NO: 2 and SEQ ID NO: 5; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 3 and SEQ ID NO: 5; or SEQ ID NO: 4 and SEQ ID NO: 5, or a fragment or variant of any of the foregoing.
- the TRAIL receptor ligand comprises an antibody molecule.
- the antibody molecule recognizes one or both of TRAIL R1 and TRAIL R2.
- the antibody molecule may be, e.g., Mapatumumab (human anti-DR4 mAb), Tigatuzumab (humanized anti-DR5 mAb), Lexatumumab (human anti-DR5 mAb), Conatumumab (human anti-DR5 mAb), or Apomab (human anti-DR5 mAb), or a fragment or variant thereof, e.g., a variant having the same CDRs as any of the aforementioned antibodies, e.g., by the Chothia or Kabat definitions.
- the enucleated red blood cell (e.g., reticulocyte) comprises two or more (e.g., three, four, five, or more) different antibody molecules that bind a TRAIL receptor.
- the enucleated red blood cell (e.g., reticulocyte) comprises at least one antibody molecule that binds a TRAIL receptor and at least one TRAIL polypeptide.
- the agents are modulators of a multi-step pathway that act agent-synergistically by targeting upstream and downstream steps of the pathway, e.g., simultaneously.
- the target pathway is the complement cascade, which has several parallel activation paths (classical, alternative, lectin pathways) and multiple auto-catalytic enzymes to enhance its potency in responding to infection and leading to membrane-attack complex formation (see, e.g. Bu et al., Clin Dev Immunol. 2012; 2012: 370426).
- Inhibitors of complement cascade exist, both as synthetic antibodies and peptides, that act on different levels of the cascade, e.g.
- Non-enzymatic complement inhibitors include include Efb (extracellular fibrinogen-binding protein, e.g., from S. aureus, which binds C3b), Ehp (binds C3d and inhibits C3 conversion), SCIN (staphylococcal complement inhibitor, which stabilize C3 convertase into a non-functional state), CHIPS (chemotaxis inhibitory protein of S.
- Enzymatic complement inhibitors include LysC, LysN, PaE, PaAP, 56 kDa protease from Serratia marcescens, C5a peptidases, Plasmin, SpeB, PrtH, Staphylokinase, and MMPs (see Table 1).
- the exogenous polypeptide can also comprise a fragment or variant of any of the complement inhibitors described herein. To treat diseases of complement over-activation it can be beneficial to inhibit the complement cascade, and it can be especially beneficial to intervene at two or more stages of the cascade to obtain a more potent inhibition.
- the agents expressed on the engineered red blood cell are inhibitors of the complement cascade that act on different levels of the cascade, e.g. CFI and MCP, CD55 and CD59, or anti-C3 and anti-C5.
- the enucleated RBC comprises two or more agents that are anti-inflammatory.
- the agents can comprise an anti-TNFa antibody molecule (e.g., humira), an anti-IgE antibody molecule (e.g., Xolair), or a molecule that inhibits T cells (e.g., IL-10 or PD-L1; also see Table 1 and Table 3), or any combination thereof.
- one or more agents capture a factor such as a cytokine.
- one or more agents modulate immune cells.
- a first agent acts on a first molecule that is part of a first pathway and a second agent acts on a second molecule that is part of a second pathway, which pathways act in concert toward a desired response.
- the desired response is inactivation (e.g., anergy) of an inappropriately activated immune cell, e.g., T cell.
- the agents inhibit multiple T cell activation pathways.
- one or more (e.g., 2, 3, 4, or 5 or more) T cell inhibition ligands comprise an inhibiting variant (e.g., fragment) of a ligand of Table 2.
- one or more (e.g., 2, 3, 4, or 5 or more) T cell inhibition ligands comprise an inhibitory antibody molecule that binds a target receptor of Table 2 or a T-cell inhibiting variant (e.g., fragment) thereof.
- these proteins signal through complementary activation pathways.
- the ligands are inhibitory cytokines, interferons, or TNF family members.
- the agents are combinations of the above classes of molecules.
- the agents can be derived from endogenous ligands or antibody molecules to the target receptors.
- TABLE 2 T cell activation Activating Ligand Target Receptor on T cell B7-H2 (e.g., Accession Number ICOS, CD28 (e.g., Accession NP_056074.1) Number NP_006130.1) B7-1 (e.g., Accession Number CD28 (e.g., Accession Number NP_005182.1) NP_006130.1) B7-2 (e.g., Accession Number CD28 (e.g., Accession Number AAA86473) NP_006130.1) CD70 (e.g., Accession Number CD27 (e.g., Accession Number NP_001243.1) NP_001233.1) LIGHT (e.g., Accession Number HVEM (e.g., Accession Number NP_003798.2) AAQ89238.1) HVEM (e.g., Accession Number LIGHT (e.g., Accession Number AAQ89238.1) NP_003798.2) CD40L (e.
- an anti-IL6 or TNFa antibody molecule comprises a sequence of either of SEQ ID NO: 6 or 7 herein, or a sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- Anti-IL6 scFv SEQ ID NO: 6 EVQLVESGGGLVQPGGSLRLSCAASGFNFNDYFMNWVRQAPGKGLEWVAQ MRNKNYQYGTYYAESLEGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR ESYYGFTSYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASV GDRVTITCQASQDIGISLSWYQQKPGKAPKLLIYNANNLADGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCLQHNSAPYTFGQGTKLEIKR Anti-TNF ⁇ scFv- SEQ ID NO: 7 EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSA ITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVS YLSTASSLDYWGQGTLVTVSSGGGGSG
- a T cell (e.g., autoreactive T cell) is inhibited using a ligand or receptor of Table 3, or a fragment or variant thereof.
- the first and second exogenous polypeptide can comprise a T cell inhibiting ligand (e.g., an inhibitory ligand of Table 3 or a fragment or variant thereof) and an agent that inhibits activation of a T cell (e.g., through a receptor of Table 2).
- the agent that inhibits a T cell is an inhibitory ligand of Table 3, or a fragment or variant thereof.
- the agent is an antibody molecule that binds a target receptor of Table 3, or a fragment or variant thereof.
- an engineered red blood cell targets multiple T cell inhibitory pathways in combination (e.g., as described in Table 3), e.g., using ligands or antibody molecules, or both, co-expressed on an engineered red blood cell.
- the agents comprise a receptor or antibody molecule that captures inflammatory cytokines, e.g., to prevent additional activation of the target T cell.
- the agents may comprise an agonist antibody molecule to the receptor CTLA-4 and an antibody molecule against TNFalpha.
- the objective is to activate or to inhibit T cells.
- one of the agents on the red blood cell may comprise a targeting moiety, e.g., an antibody molecule that binds the T cell receptor (TCR) or another T cell marker.
- TCR T cell receptor
- Targeting moieties are described in more detail in the section entitled “Localization configurations” herein.
- a specific T cell subtype or clone may be enhanced (a T cell with anti-tumor specificity) or inhibited (a T cell with autoimmune reactivity).
- one or more of the agents on the red blood cell is a peptide-MHC molecule that will selectively bind to a T cell receptor in an antigen-specific manner.
- the first and second exogenous polypeptides comprise, in some embodiments, an antigen and an inhibitory ligand so that antigen presentation by APCs induces tolerance instead of immunity.
- the antigen is an autoimmune antigen, e.g., an autoantigen of Table 4, or an allergen, e.g., an allergen from plants such as pollen, an allergen from food, or an allergen from an animal.
- the inhibitory ligand comprises FasL, B7, PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGF beta, or a functional variant (e.g., fragment) thereof.
- the agent that inhibits a T cell is an inhibitory ligand of Table 3, or an inhibitory fragment or variant thereof.
- the agent that inhibits a T cell is an antibody molecule that binds a target receptor of Table 3, or an inhibitory fragment or variant thereof.
- the red blood cell (e.g., reticulocyte) further comprises an antibody molecule that binds a dendritic cell receptor, e.g. CD205 or CD206.
- a dendritic cell receptor e.g. CD205 or CD206.
- this agent promotes uptake by antigen presenting cells.
- CD205 induces tolerogenic antigen presentation in the absence of additional co-stimulatory signals.
- the first and second exogenous polypeptides comprise, in some embodiments, an antigen and a costimulatory molecule, e.g., wherein the erythroid cell can act as an APC.
- Acute rheumatic fever cross reactive antibodies to cardiac muscle alopecia areata Trychohyalin, keratin 16 ANCA-associated vasculitis Neutrophil cytoplasmic antigen, proteinase 3, myeloperodixase, bacterial permiability increasing factor autoimmune gastritis H, K adenosine triphosphatase autoimmune hemolytic anemia Rh blood group antigens, I antigen autoimmune hepatitis nuclear protein, liver-kidney microsome type 1, liver cytosol type 1 autoimmune myocarditis cardiac myosin Autoimmune thyroiditis Thyroid peroxidase, thyroglobulin, thyroid-stimulating hormone receptor Autoimmune uveitis Retinal arrestin (S-antigen) dermatomyositis Mi2 ATPase diabetes (type 1) Pancreatic beta cell antigen, insulin goodpasture's syndrome Noncollagenous domain of basement membrane collagen
- an enucleated red blood cell (e.g., reticulocyte) comprising a first exogenous polypeptide and a second exogenous polypeptide is administered to a subject having a first target and a second target.
- the first exogenous polypeptide acts on (e.g., binds) the first target and the second exogenous polypeptide acts on the second target.
- the enucleated red blood cell comprises a third exogenous polypeptide and the patient comprises a third target.
- the third exogenous polypeptide acts on the third target.
- an erythroid cell comprises a first exogenous polypeptide which is an agonist or antagonist of a first target in a first pathway, and further comprises a second exogenous polypeptide which is an agonist or antagonist of a second target in a second pathway, wherein the first and second pathways act in concert toward a desired response.
- the first and second exogenous polypeptides can both be agonists; can both be antagonists; or one can be an agonist and the other can be an antagonist. In some embodiments (e.g., see FIG.
- the first exogenous polypeptide comprises a surface-exposed anti-CD28 antibody molecule and the second exogenous polypeptide comprises a surface-exposed anti-CTLA4 antibody molecule, e.g., for treating systemic lupus erythematosus or rheumatoid arthritis.
- the first exogenous polypeptide comprises a surface-exposed anti-ICOSL antagonist and the second exogenous polypeptide comprises a surface-exposed anti-CD40 antagonist, e.g., wherein the target is an antigen presenting cell, e.g., for treating systemic lupus erythematosus.
- the target cell or tissue comprises immune cells or diseased tissue.
- one or more of the exogenous polypeptides are immune checkpoint agonists or antagonists.
- the erythroid cell further comprises a targeting agent.
- agents e.g., polypeptides
- the agents have two distinct (e.g., complementary) functions.
- a first agent binds a first target and the second agent binds a second target.
- the patient may lack the first or second target.
- the first and second agents are in different pathways.
- the damage is driven by a diverse mix of inflammatory cytokines.
- Existing monotherapies against one cytokine are often insufficient to treat these acute conditions.
- the first and second peptides are molecules (e.g., antibody molecules) that bind two different cytokines.
- the agents bind and neutralize different cytokines and thus the engineered red cell product provides multifaceted protection from cytokine storm.
- the cytokines comprise interleukins, e.g., IL-1, IL02, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-35, or IL-36.
- the cytokine is a cytokine of Table 1 or a fragment or variant thereof.
- the first cytokine is TNFa and the second is an interleukin, e.g., IL-6, or a fragment or variant of any of the foregoing.
- the agents comprise anti-TNFa, anti-IL-6, or anti-IFNg antibody molecules, or any combination thereof, or a fragment or variant of any of the foregoing.
- the agents comprise a plurality of antibody molecules, which plurality of antibody molecules binds a plurality of common bacterial, fungal, or viral pathogens.
- the antibodies are generated from human B cells, e.g., a combinatorial library of pooled human B cells.
- the poly-antibody engineered red blood cells serve as an alternative, replacement, or supplement to intravenous immunoglobulin (IVIG). IVIG is in embodiments administered to immunodeficient patients, e.g., patients who lack the capacity to produce endogenous antibodies.
- the red blood cell e.g., reticulocyte
- an enucleated red blood cell (e.g., reticulocyte) comprising a first exogenous polypeptide and a second exogenous polypeptide is administered to a subject having a first target but not a second target, or wherein the patient is not known to have a first target or second target.
- the first exogenous polypeptide acts on (e.g., binds) the first target and the second exogenous polypeptide remains substantially unbound.
- the enucleated red blood cell comprises a third exogenous polypeptide and the patient lacks a third target, or is not known to have the third target.
- the enucleated red blood cell comprises a plurality of exogenous polypeptides, and the patient does not have, or is not known to have, targets for one or a subset of the plurality of exogenous polypeptides.
- the erythroid cell of FIG. 4 comprises a first exogenous polypeptide (white), a second exogenous polypeptide (hatching), and an optional third exogenous polypeptide (close hatching).
- the first exogenous polypeptide can bind a first target, e.g., cytokine A
- the second exogenous polypeptide can independently bind a second target, e.g., cytokine B.
- This engineered erythroid cell trap and clear both cytokines if both are present in the subject. If only one of the cytokines is present in the subject, the engineered erythroid cell can clear that cytokine.
- one or more (e.g., two or all) of the exogenous polypeptides comprise antibody molecules, e.g., scFvs, and optionally further comprise a transmembrane domain.
- the targets comprise a plurality of cytokines, chemokines, or a combination thereof.
- the first exogenous polypeptide could bind TNF-alpha and the second exogenous polypeptide could bind IL6, e.g., to treat rheumatoid arthritis; the first exogenous polypeptide could bind IL4 and the second exogenous polypeptide could bind IL13, e.g., to treat asthma and/or ectopic dermatitis; the first exogenous polypeptide could bind IL33 and the second exogenous polypeptide could bind IL15, e.g., to treat celiac disease or inflammatory bowel disease; or the first exogenous polypeptide could bind IL35 and the second exogenous polypeptide could bind IL25, e.g., to treat allergy.
- IL6 e.g., to treat rheumatoid arthritis
- the first exogenous polypeptide could bind IL4 and the second exogenous polypeptide could bind IL13, e.g., to treat asthma
- the first target and second target are unwanted antibodies, e.g., endogenous antibodies, e.g., autoimmune antibodies or anti-drug antibodies (e.g., as illustrated in FIG. 5 ).
- the first exogenous polypeptide could bind MOG and the second exogenous polypeptide could bind MBP, e.g., to treat multiple sclerosis.
- a first agent localizes the RBC to a site of action that enhances the activity of the second or other agent or agents compared to their activity when not localized to the site of action (e.g., by binding of the first agent to its target, there is an increase in the local concentration of the second agent in the area of its target).
- one agent serves to target the red blood cell (e.g., reticulocyte) to a site of action and one or more agents have a therapeutic effect.
- binding of the first agent increases the activity of an entity, e.g., polypeptide, bound by the second agent.
- the first agent binds to a substrate or product of the entity, e.g., polypeptide, bound by the second agent.
- the agent that localizes the RBC may be, e.g., a ligand for a receptor on a target cell, or an antibody that binds a cell surface molecule on a target cell.
- a RBC comprises a targeting agent that binds to inflamed vasculature and also comprises an anti-inflammatory molecule.
- the targeting agent binds an inflammatory integrin, e.g., a avB3 integrin or an addres sin such as MADCAM1.
- the targeting agent comprises a lymphocyte homing receptor (e.g., CD34 or GLYCAM-1) or integrin-binding portion or variant thereof.
- the anti-inflammatory molecule comprises an anti-inflammatory cytokine (e.g., IL-1 receptor antagonist, IL-4, IL-6, IL-10, IL-11, and IL-13), an inhibitor of TNF (e.g., an antibody molecule such as Enbrel), an inhibitor of a pro-inflammatory cytokine, an inhibitor against alpha4beta7 integrin (e.g., an antibody molecule), a colony-stimulating factor, a peptide growth factor, Monocyte Locomotion Inhibitory Factor (MLIF), Cortistatin, or an inhibitor of immune cell activation (e.g. PDL1 or another molecule described in Table 3 or antibody molecule thereto), or an anti-inflammatory variant (e.g., fragment) thereof.
- cytokine e.g., IL-1 receptor antagonist, IL-4, IL-6, IL-10, IL-11, and IL-13
- TNF e.g., an antibody molecule such as Enbrel
- the erythroid cell targets an endothelial cell, e.g., in an inflamed tissue.
- the cell can comprise one or more targeting agents, e.g., exogenous polypeptides that bind surface markers of inflamed tissue.
- the targeting agent can be an exogenous polypeptide comprising, e.g., an anti-VCAM antibody molecule or an anti-E-selectin antibody molecule.
- an erythroid cell comprises two targeting agents, which may increase the specificity and/or affinity and/or avidity of the erythroid cell binding to its target, compared to an otherwise similar erythroid cell comprising only one of the targeting agents.
- the targeting moieties comprise: a surface exposed anti-VCAM antibody molecule and a surface exposed anti-E-selectin antibody molecule; a surface exposed alpha4Beta1 integrin or fragment or variant thereof and a surface exposed anti-E-selectin antibody molecule; or a surface exposed alphavbeta2 integrin or fragment or variant thereof and a surface exposed anti-E-selectin antibody molecule.
- the erythroid cell optionally further comprises an exogenous polypeptide with therapeutic activity, e.g., anti-inflammatory activity.
- the exogenous polypeptide with therapeutic activity can comprise an enzyme, capture reagent, agonist, or antagonist.
- the erythroid cell can also target, in embodiments, immune cells or diseased tissue.
- the targeting moiety comprises a receptor or a fragment or variant thereof.
- the targeting moiety comprises an antibody molecule such as an scFv.
- the first exogenous polypeptide comprises a targeting moiety, e.g., a surface-exposed anti-CD20 antibody molecule that can target the erythroid cell to a B cell or a targeting moiety specific to autoreactive cells
- the second exogenous polypeptide comprises a moiety that can kill or anergize the T cell, e.g., a TRAIL ligand.
- the erythroid cell can further comprise an inhibitor of the second exogenous polypeptide, e.g., as illustrated in FIG. 8 .
- the first exogenous polypeptide can comprise a targeting agent and the second exogenous polypeptide can comprise an enzyme (e.g., FIG. 11 ).
- the erythroid cell comprises a first polypeptide comprising a targeting agent that binds an immune cell and a second polypeptide that inhibits (e.g., kills, induces anergy in, inhibits growth of) the immune cell.
- the targeting agent can comprise an anti-CD4 antibody which binds CD4 on the surface of a T cell, e.g., an autoreactive T cell.
- the second polypeptide can comprise an enzyme which can be surface-exposed or intracellular, e.g., intracellular and not membrane associated.
- the enzyme may be IDO or a fragment or variant thereof, which depletes tryptophan and can induce anergy in the autoreactive T cell, or ADA or a fragment or variant thereof.
- the enzyme may be a protease.
- the first polypeptide comprises an anti-MAdCAM-1 antibody molecule and the second polypeptide comprises LysC or LysN (which can cleave MAdCAM-1 at 1 or more (e.g., 2, 3, or 4 sites), e.g., wherein the target tissue is inflamed gut or liver tissue.
- the targeting agent comprises an anti-IL13R antibody molecule or IL13 or a fragment or variant thereof, and the payload comprises IDO or ADA, e.g., for treating an allergy or asthma.
- the targeting agent comprises an anti-IL23R antibody molecule or IL23 or a fragment or variant thereof, and the payload comprises IDO or ADA, e.g., for treating psoriasis.
- the target cell is an immune cell, e.g., a T cell, e.g., a helper T cell, and/or a disease cell.
- the targeting agent may comprise an antibody molecule, e.g., an scFv.
- the first exogenous polypeptide can comprise a targeting agent and the second exogenous polypeptide can comprise an agonist of a target (see, e.g., FIG. 12 ).
- the first exogenous polypeptide comprises an anti-MAdCAM-1 antibody molecule, e.g., which can bind MAdCAM-1, e.g., on inflamed tissue.
- the second exogenous polypeptide may comprise an anti-inflammatory molecule, e.g., IL10 or a fragment or variant thereof.
- the target cell is a pathogenic immune cell.
- the targeting agent comprises a receptor or fragment or variant thereof, an antibody molecule, a ligand or fragment or variant thereof, a cytokine or fragment or variant thereof.
- the second exogenous polypeptide comprises an attenuator, an activator, a cell-killing agent, or a cytotoxic molecule (e.g., a small molecule, protein, RNA e.g., antisense RNA, or TLR ligand).
- the second exogenous polypeptide is intracellular, e.g., not membrane associated, and in some embodiments, the second exogenous polypeptide is surface-exposed.
- the targeting moiety binds a hepatocyte and the second exogenous polypeptide comprises TGF beta or a fragment or variant thereof, e.g., for treating non-alcoholic fatty liver disease (NAFLD) or non-alcoholic steatohepatitis (NASH).
- NAFLD non-alcoholic fatty liver disease
- NASH non-alcoholic steatohepatitis
- the erythroid cell can comprise a targeting agent and a capture agent (e.g., FIG. 13 ).
- the first exogenous polypeptide can comprise a targeting agent that binds a plasma cell, e.g., an anti-BCMA antibody molecule.
- the second exogenous polypeptide may capture cytokines, e.g., may comprise TACI or a fragment or variant thereof which can capture BLyS (also called BAFF) and/or APRIL.
- the second exogenous polypeptide binds its target in a way that prevents the target from interacting with an endogenous receptor, e.g., binds the target at a moiety that overlaps with the receptor binding site.
- the targeting moiety binds a receptor at the site of disease, e.g., binds an integrin.
- the target cell is a pathogenic immune cell or diseased tissue.
- the targeting agent comprises a ligand or a cytokine or fragment or variant thereof, or an antibody molecule, e.g., an scFv.
- the capture agent comprises a receptor or fragment or variant thereof, or an antibody molecule, e.g., an scFv.
- the ligand is an unwanted cytokine or chemokine.
- a targeting agent can direct an erythroid cell to a particular sub-type of cell, e.g., an immune cell with a particular antigen specificity, e.g., an autoreactive immune cell.
- the cell can further comprise a second exogenous polypeptide that promotes a given activity or pathway in the target cell, e.g., can attenuate, activate, or induce cell death.
- FIG. 14 depicts an erythroid cell comprising a first exogenous polypeptide comprising an AQP4 epitope that can bind an anti-AQP4 B-cell receptor (BCR) on an autoreactive plasma cell; other exemplary first exogenous polypeptides include ACHR or insulin or fragments or variants thereof.
- the erythroid cell can further comprise a second exogenous polypeptide that inhibits (e.g., kills, induces anergy in, inhibits growth of) the immune cell.
- the second exogenous polypeptide can comprise a cell-killing agent, e.g., a pro-apoptotic agent, e.g., a TRAIL polypeptide that induces apoptosis in an autoreactive immune cell.
- the erythroid cell can have antigen presentation activity, e.g., can comprise MOG and/or MBP peptide on MHCII, and further comprise one or both or IL10 and TGFbeta or a fragment or variant thereof, e.g., for treating multiple sclerosis.
- the erythroid cell may also comprise an antigen and an attenuator or activator that is surface exposed or intracellular.
- the cell can comprise an antigen and PDL1 or a fragment or variant thereof.
- the cell can comprise an antigen and an enzyme such as IDO or ADA.
- the erythroid cell may also comprise an antigen and a cell targeting agent, e.g., an antigen specific for a type of B cell (e.g., an autoantigen specific for autoreactive B cells) and an anti-BCMA antibody molecule that targets plasma cells.
- a cell targeting agent e.g., an antigen specific for a type of B cell (e.g., an autoantigen specific for autoreactive B cells) and an anti-BCMA antibody molecule that targets plasma cells.
- the two agents function more strongly, e.g., exert a more pronounced effect, when they are in proximity to each other than when they are physically separate.
- the two agents are in proximity when they are directly binding to each other, when they are part of a complex (e.g., linked by a third agent), when they are present on the same cell membrane, or when they are present on the same subsection of a cell membrane (e.g., within a lipid raft, outside a lipid raft, or bound directly or indirectly to an intracellular structure such as a cytoskeleton component).
- first polypeptide binds a first target molecule and the second polypeptide binds a second target molecule, and this binding causes the first target molecule and the second target molecule to move into closer proximity with each other, e.g., to bind each other.
- the first and second target molecules are cell surface receptors on a target cells.
- FIG. 4 An example of a proximity-based configuration is shown in FIG. 4 .
- the erythroid cell of FIG. 4 comprises an optional first exogenous polypeptide (white), a second exogenous polypeptide (hatching), and a third exogenous polypeptide (close hatching).
- the second and third exogenous polypeptides bind to different epitopes within the same polypeptide chain of a target, e.g., cytokine B.
- the second and third exogenous polypeptides which are mounted on the erythrocyte, bind to the target with higher avidity than if the second and third exogenous polypeptides were free polypeptides.
- two or more exogenous polypeptides could bind different sites on the same target, wherein the target is a cytokine, a complement factor (e.g., C5), an enzyme, an antibody, or an immune complex.
- the first exogenous polypeptide comprises an antigen (e.g., an autoantigen, e.g., an autoantigen of Table 6) that binds a specific antibody (e.g., an autoantibody) and the second exogenous polypeptide binds antibody Fc (e.g., could comprise CD16A which binds Fc) to increase avidity for the antibody that binds the first exogenous polypeptide.
- an antigen e.g., an autoantigen, e.g., an autoantigen of Table 6
- the second exogenous polypeptide binds antibody Fc (e.g., could comprise CD16A which binds Fc) to increase avidity for the antibody that binds the first exogenous polypeptide.
- the agents bring two or more targets together, to increase the likelihood of the targets interacting with each other.
- the first and second agent are associated with each other (forming a scaffold) at the surface of the RBC, e.g., two complexed polypeptides.
- the red blood cell e.g., reticulocyte
- the red blood cell comprises a bispecific antibody molecule, e.g., an antibody molecule that recognizes one or more (e.g., 2) proteins described herein, e.g., in any of Table 1, Table 2, Table 3, and Table 4.
- the targets may comprise, e.g., proteins, cells, small molecules, or any combination thereof.
- the first and second targets are proteins.
- the first and second targets are cells.
- the RBC brings an immune effector cell into proximity with another immune cell, e.g., to promote antigen presentation (e.g., when one cell is an antigen presenting cell and the other cell is a T cell) or anergy (e.g., when one cell is a Treg and the other cell is an immune effector cell, e.g., an autoreactive immune effector cell).
- another immune cell e.g., to promote antigen presentation (e.g., when one cell is an antigen presenting cell and the other cell is a T cell) or anergy (e.g., when one cell is a Treg and the other cell is an immune effector cell, e.g., an autoreactive immune effector cell).
- a RBC expresses an exogenous fusion polypeptide comprising a first antibody molecule domain and a second antibody molecule domain, wherein the exogenous polypeptide functions as a bispecific antibody, e.g., wherein the first antibody molecule domain binds a first target on a first cell and the second antibody molecule domain binds a second target on a second cell, e.g., a different cell type.
- the agents When two or more agents (e.g., polypeptides) have a multimer configuration, the agents combine with each other, e.g., bind each other, to form a complex that has a function or activity on a target.
- the agents are subunits of a cell surface complex, e.g., MHCI, and a function is to bind a peptide.
- the agents are subunits of MHCII, and a function is to bind a peptide.
- the agents are subunits of a cell surface molecule, e.g., MHCI and a peptide, e.g., a peptide loaded on the MHCI molecule, and a function is to present the peptide.
- the agents are subunits of a MHCII and a peptide, e.g., a peptide loaded on the MHCII molecule, and a function is to present the peptide.
- the complex is a functional MHC I
- the agents are MHC I (alpha chain 1-3) and beta-2 microglobulin.
- the complex is MHC II and the agents are MHC II alpha chain and MHC II beta chain.
- the MHC molecule comprises human MHC class I or II, e.g., MHC II alpha subunit and MHC II beta subunit or a fusion molecule comprising both subunits or antigen-presenting fragments thereof.
- a RBC with these two polypeptides is used, in some embodiments, for immune induction or antigen presentation.
- the RBC comprises a single protein that is a fusion between an MHC molecule and an antigen, e.g., a single-chain peptide-MHC construct.
- a non-membrane tethered component of the complex e.g.
- the peptide, or the beta-2 microglobulin is assembled with another agent within the cell prior to trafficking to the surface, is secreted by the cell then captured on the surface by the membrane-tethered component of the multimer, or is added in a purified form to an engineered red blood cell.
- the antigen is, in some embodiments, an autoimmune antigen, e.g., a protein or fragment or variant thereof of Table 4. In some embodiments, the antigen is about 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, or 35 amino acids in length.
- a red blood cell e.g., reticulocyte
- a complement cascade Some complement regulatory proteins act in concert as co-factors for one another, e.g. CFH and CD55 are co-factors for the enzymatic activity of CFI.
- the agents comprise an enzymatic protein or domain, e.g., CFI, and a co-factor, e.g., CFH or CD55, that accelerates and enhances the activity of CFI on the target complement molecule.
- the complex comprises multiple subdomains derived from different polypeptide chains, all of which must be expressed in order for the complex to be active.
- a first agent reduces an undesirable characteristic of a second agent.
- the second agent has a given level of immunogenicity, and the first agent reduces the immunogenicity, e.g., by negatively signaling immune cells (see Table 3), or by shielding an antigenic epitope of the second agent.
- the second agent has a given half-life, and the first agent increases the half-life of the second agent.
- the first agent can comprise a chaperone or fragment or variant thereof.
- An enucleated erythroid cell can co-express a therapeutic protein and its inhibitor (e.g., FIG. 8 ).
- the inhibitor can be released (e.g., cease binding the therapeutic but remain on the surface of the cell) in at the desired location in the body, to activate the therapeutic protein.
- the erythroid cell comprises a first exogenous polypeptide with therapeutic activity (e.g., an anti-TNFalpha antibody molecule), a second exogenous polypeptide (e.g., TNFalpha or a fragment or variant thereof) that inhibits the first exogenous polypeptide.
- the second polypeptide e.g., TNFalpha
- the second polypeptide may inhibit activity of the first exogenous polypeptide (e.g., anti-TNFalpha) until the erythroid cell is at a desired location, e.g., at inflamed tissue, e.g., limiting off-target effects.
- the second exogenous polypeptide may comprise a variant of the target (e.g., endogenous TNFalpha) that the first exogenous polypeptide (e.g., anti-TNFalpha) binds.
- the variant can be a weakly-binding variant that is competed away in the presence of the target.
- the Kd of the first exogenous polypeptide for the second exogenous polypeptide is at least 2, 3, 5, 10, 20, 50, or 100-fold greater than the Kd of the first exogenous polypeptide for its target.
- the erythroid cell optionally comprises a third exogenous polypeptide that comprises a targeting agent.
- the enucleated erythroid cell comprises a prodrug (e.g., pro-insulin) that becomes a drug (e.g., insulin) at a desired site in a subject.
- a prodrug e.g., pro-insulin
- a drug e.g., insulin
- a red blood cell e.g., reticulocyte
- a red blood cell comprises three or more, e.g., at least 4, 5, 10, 20, 50, 100, 200, 500, or 1000 agents.
- a population of red blood cells described herein comprises three or more, e.g., at least 4, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, or 5000 agents, e.g., wherein different RBCs in the population comprise different agents or wherein different RBCs in the population comprise different pluralities of agents.
- two or more (e.g., all) of the agents in the RBC or population or RBCs have agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity.
- the RBC is produced by contacting a RBC progenitor cell with a plurality of mRNAs encoding the agents.
- a combinatorial, high-diversity pool of cells is produced, e.g., for use in an in vitro or in vivo binding assay.
- a combinatorial, high-diversity nucleic acid library encoding cell-surface proteins can be created.
- Such a library could, e.g., consist of entirely variable sequences, or comprise a fixed sequence fused to a highly variable, combinatorial sequence.
- These can be introduced into red blood cell progenitors as a mixture or individually, using methods such as electroporation, transfection or viral transduction.
- the cells are subsequently grown in differentiation media until the desired level of maturity.
- the cells are used for a highly multiplexed in-vitro assay.
- Cells are incubated with a biological sample in a microtiter plate.
- Wells are washed using a cell-compatible buffer, with a desired level of stringency.
- the remaining cells are isolated and analyzed for the enrichment of specific sequences.
- the analysis is performed at the protein level, e.g., using mass spectrometry, to identify the amino acid motifs that are enriched in the bound population.
- the analysis is performed at the nucleic acid level (RNA or DNA) to identify the nucleic acid sequences identifying the corresponding amino-acid motif enriched in the bound population.
- the high-diversity cell population is injected into an animal model (either healthy or diseased).
- the cells are fluorescently labeled to visualize their in vivo distribution or localization.
- Various tissues of the animal could then be collected and analyzed for the relative enrichment of specific amino-acid motifs or nucleic acid sequences identifying the corresponding amino-acid motif.
- a library of protein coding sequences are designed and synthesized with a diversity of 5′ untranslated regions, 3′ untranslated regions, codon representations, amino acid changes, and other sequence differences.
- This library would be introduced into red blood cell progenitors as a mixture or individually, using methods such as electroporation, transfection or viral transduction.
- the cells are subsequently grown in differentiation media until the desired level of maturity.
- the RBCs e.g., reticulocytes
- the RBCs have one or more (e.g., 2, 3, 4, or more) physical characteristics described herein, e.g., osmotic fragility, cell size, hemoglobin concentration, or phosphatidylserine content.
- osmotic fragility e.g., cell size, hemoglobin concentration, or phosphatidylserine content.
- an enucleated RBC that expresses an exogenous protein has physical characteristics that resemble a wild-type, untreated RBC.
- a hypotonically loaded RBC sometimes displays aberrant physical characteristics such as increased osmotic fragility, altered cell size, reduced hemoglobin concentration, or increased phosphatidylserine levels on the outer leaflet of the cell membrane.
- the enucleated RBC comprises an exogenous protein that was encoded by an exogenous nucleic acid that was not retained by the cell, has not been purified, or has not existed fully outside an RBC.
- the RBC is in a composition that lacks a stabilizer.
- the enucleated red blood cell exhibits substantially the same osmotic membrane fragility as an isolated, uncultured erythroid cell that does not comprise an exogenous polypeptide.
- the population of enucleated red blood cells has an osmotic fragility of less than 50% cell lysis at 0.3%, 0.35%, 0.4%, 0.45%, or 0.5% NaCl. Osmotic fragility can be assayed using the method of Example 59 of WO2015/073587.
- the enucleated RBC has approximately the diameter or volume as a wild-type, untreated RBC.
- the population of RBC has an average diameter of about 4, 5, 6, 7, or 8 microns, and optionally the standard deviation of the population is less than 1, 2, or 3 microns. In some embodiments, the one or more RBC has a diameter of about 4-8, 5-7, or about 6 microns.
- the diameter of the RBC is less than about 1 micron, larger than about 20 microns, between about 1 micron and about 20 microns, between about 2 microns and about 20 microns, between about 3 microns and about 20 microns, between about 4 microns and about 20 microns, between about 5 microns and about 20 microns, between about 6 microns and about 20 microns, between about 5 microns and about 15 microns or between about 10 microns and about 30 microns.
- Cell diameter is measured, in some embodiments, using an Advia 120 hematology system.
- the volume of the mean corpuscular volume of the RBCs is greater than 10 fL, 20 fL, 30 fL, 40 fL, 50 fL, 60 fL, 70 fL, 80 fL, 90 fL, 100 fL, 110 fL, 120 fL, 130 fL, 140 fL, 150 fL, or greater than 150 fL.
- the mean corpuscular volume of the RBCs is less than 30 fL, 40 fL, 50 fL, 60 fL, 70 fL, 80 fL, 90 fL, 100 fL, 110 fL, 120 fL, 130 fL, 140 fL, 150 fL, 160 fL, 170 fL, 180 fL, 190 fL, 200 fL, or less than 200 fL.
- the mean corpuscular volume of the RBCs is between 80-100, 100-200, 200-300, 300-400, or 400-500 femtoliters (fL).
- a population of RBCs has a mean corpuscular volume set out in this paragraph and the standard deviation of the population is less than 50, 40, 30, 20, 10, 5, or 2 fL.
- the mean corpuscular volume is measured, in some embodiments, using a hematological analysis instrument, e.g., a Coulter counter.
- the enucleated RBC has a hemoglobin content similar to a wild-type, untreated RBC.
- the RBCs comprise greater than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% or greater than 10% fetal hemoglobin.
- the RBCs comprise at least about 20, 22, 24, 26, 28, or 30 pg, and optionally up to about 30 pg, of total hemoglobin. Hemoglobin levels are determined, in some embodiments, using the Drabkin's reagent method of Example 33 of WO2015/073587.
- the enucleated RBC has approximately the same phosphatidylserine content on the outer leaflet of its cell membrane as a wild-type, untreated RBC.
- Phosphatidylserine is predominantly on the inner leaflet of the cell membrane of wild-type, untreated RBCs, and hypotonic loading can cause the phosphatidylserine to distribute to the outer leaflet where it can trigger an immune response.
- the population of RBC comprises less than about 30, 25, 20, 15, 10, 9, 8, 6, 5, 4, 3, 2, or 1% of cells that are positive for Annexin V staining.
- Phosphatidylserine exposure is assessed, in some embodiments, by staining for Annexin-V-FITC, which binds preferentially to PS, and measuring FITC fluorescence by flow cytometry, e.g., using the method of Example 54 of WO2015/073587.
- the population of RBC comprises at least about 50%, 60%, 70%, 80%, 90%, or 95% (and optionally up to 90 or 100%) of cells that are positive for GPA.
- the presence of GPA is detected, in some embodiments, using FACS.
- the RBCs have a half-life of at least 30, 45, or 90 days in a subject.
- a population of cells comprising RBCs comprises less than about 10, 5, 4, 3, 2, or 1% echinocytes.
- an RBC is enucleated, e.g., a population of cells comprising RBCs used as a therapeutic preparation described herein is greater than 50%, 60%, 70%, 80%, 90% enucleated.
- a cell e.g., an RBC, contains a nucleus that is non-functional, e.g., has been inactivated.
- enucleated red blood cells e.g., reticulocytes
- exogenous agent e.g., polypeptides
- hematopoietic progenitor cells e.g., CD34+ hematopoietic progenitor cells
- a nucleic acid or nucleic acids encoding one or more exogenous polypeptides are contacted with a nucleic acid or nucleic acids encoding one or more exogenous polypeptides, and the cells are allowed to expand and differentiate in culture.
- the two or more polypeptides are encoded in a single nucleic acid, e.g. a single vector.
- the single vector has a separate promoter for each gene, has two proteins that are initially transcribed into a single polypeptide having a protease cleavage site in the middle, so that subsequent proteolytic processing yields two proteins, or any other suitable configuration.
- the two or more polypeptides are encoded in two or more nucleic acids, e.g., each vector encodes one of the polypeptides.
- the nucleic acid may be, e.g., DNA or RNA.
- viruses may be used as gene transfer vehicles including retroviruses, Moloney murine leukemia virus (MMLV), adenovirus, adeno-associated virus (AAV), herpes simplex virus (HSV), lentiviruses such as human immunodeficiency virus 1 (HIV 1), and spumaviruses such as foamy viruses, for example.
- MMLV Moloney murine leukemia virus
- AAV adenovirus
- AAV adeno-associated virus
- HSV herpes simplex virus
- lentiviruses such as human immunodeficiency virus 1 (HIV 1)
- spumaviruses such as foamy viruses, for example.
- the cells are produced using sortagging, e.g., as described in WO2014/183071 or WO2014/183066, each of which is incorporated by reference in its entirety.
- the RBCs are expanded at least 1000, 2000, 5000, 10,000, 20,000, 50,000, or 100,000 fold (and optionally up to 100,000, 200,000, or 500,000 fold). Number of cells is measured, in some embodiments, using an automated cell counter.
- the population of RBC comprises at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 98% (and optionally up to about 80, 90, or 100%) enucleated RBC.
- the population of RBC contains less than 1% live enucleated cells, e.g., contains no detectable live enucleated cells. Enucleation is measured, in some embodiments, by FACS using a nuclear stain.
- At least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80% (and optionally up to about 70, 80, 90, or 100%) of RBC in the population comprise one or more (e.g., 2, 3, 4 or more) of the exogenous polypeptides. Expression of the polypeptides is measured, in some embodiments, by FACS using labeled antibodies against the polypeptides. In some embodiments, at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80% (and optionally up to about 70, 80, 90, or 100%) of RBC in the population are enucleated and comprise one or more (e.g., 2, 3, 4, or more) of the exogenous polypeptides.
- the population of RBC comprises about 1 ⁇ 10 9 -2 ⁇ 10 9 , 2 ⁇ 10 9 -5 ⁇ 10 9 , 5 ⁇ 10 9 -1 ⁇ 10 10 , 1 ⁇ 10 10 -2 ⁇ 10 10 , 2 ⁇ 10 10 -5 ⁇ 10 10 , 5 ⁇ 10 10 -1 ⁇ 10 11 , 1 ⁇ 10 11 -2 ⁇ 10 11 , 2 ⁇ 10 11 -5 ⁇ 10 11 , 5 ⁇ 10 11 -1 ⁇ 10 12 , 1 ⁇ 10 12 -2 ⁇ 10 12 , 2 ⁇ 10 12 -5 ⁇ 10 12 , or 5 ⁇ 10 12 -1 ⁇ 10 13 cells.
- the present disclosure provides a composition comprising a first agent and a second agent in physical proximity to each other.
- agents act synergistically when they are in physical proximity to each other but not when they are separate.
- the first and second agent are covalently linked, e.g., are part of a fusion protein or are chemically conjugated together.
- the first and second agent are non-covalently linked, e.g., are bound directly to each other or to a scaffold.
- the first and second agents are part of (e.g., linked to) a nanoparticle (e.g., 1-100, 100-2,500, or 2,500-10,000 nm in diameter) liposome, vesicle, bead, polymer, implant, or polypeptide complex.
- a nanoparticle e.g., 1-100, 100-2,500, or 2,500-10,000 nm in diameter
- the composition comprises at least 3, 4, 5, 6, 7, 8, 9, or 10 different agents that are in physical proximity to each other (e.g., covalently or noncovalently linked).
- the composition comprises one or more (e.g., 2, 3, 4, 5, or more) agents described herein, e.g., exogenous polypeptides described herein, e.g., polypeptides of any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an antibody molecule thereto.
- agents described herein e.g., exogenous polypeptides described herein, e.g., polypeptides of any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an antibody molecule thereto.
- one or more (e.g., 2, 3, or more) of the exogenous polypeptides comprise cytokines, interleukins, cytokine receptors, Fc-binding molecules, T-cell activating ligands, T cell receptors, immune inhibitory molecules, costimulatory molecule, MHC molecules, APC-binding molecule, autoantigen, allergen, toxin, targeting agent, or TRAIL receptor ligands.
- one or more (e.g., 2, 3, or more) of the exogenous polypeptides comprise TRAIL receptor ligands, e.g., a sequence of any of SEQ ID NOS: 1-5 herein, or a sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, or an antibody molecule that binds a TRAIL receptor.
- the first agent binds to a first TRAIL receptor, e.g., TRAIL-RI
- the second agent binds to a second TRAIL receptor, e.g., TRAIL-RII.
- the two TRAIL receptor ligands in proximity provide a synergistic degree of apoptosis in a target cell, compared to either TRAIL receptor ligand alone.
- Example 1 herein demonstrates a synergistic activity when target cells are treated with a composition comprising two TRAIL receptor ligands in close proximity (e.g., on the surface of an enucleated red blood cell).
- Engineered Red Blood Cells comprising One or more Agents
- the present disclosure provides an engineered red blood cell (e.g., reticulocyte) comprising an exogenous agent. More specifically, in some aspects, the present disclosure provides an enucleated red blood cell (e.g., reticulocyte) comprising an exogenous polypeptide.
- the red blood cell optionally further comprises a second, different, exogenous polypeptide.
- the exogenous polypeptide e.g., an exogenous polypeptide comprised by a red blood cell that optionally further comprises a second exogenous polypeptide
- the polypeptide is selected from any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an antibody molecule thereto.
- the exogenous polypeptide (e.g., an exogenous polypeptide comprised by a red blood cell that optionally further comprises a second exogenous polypeptide) comprises a stimulatory ligand, e.g., CD80, CD86, 41BBL, or any combination thereof.
- the exogenous polypeptide comprises a T cell inhibitor such as IL-10 and PD-L1 or a combination thereof, e.g., for the treatment of an inflammatory disease.
- the one or more (e.g., two or more) exogenous polypeptides are situated on or in a red blood cell
- any exogenous polypeptide or combination of exogenous polypeptides described herein can also be situated on or in another vehicle.
- the vehicle can comprise, e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome.
- the present disclosure provides a vehicle (e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome) comprising, e.g., on its surface, one or more agents described herein.
- a vehicle e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome
- a vehicle e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome
- the one or more agent comprises a polypeptide that binds PD-1 (e.g., an antibody molecule that binds PD-1 or an agonist of PD-1 such as PD-L1), a polypeptide that binds PD-Ll (e.g., an antibody molecule that binds PD-L1), a polypeptide that binds CD20 (e.g., an antibody molecule that binds CD20), or a polypeptide that binds a TRAIL receptor (e.g., an agonist of a TRAIL receptor).
- PD-1 e.g., an antibody molecule that binds PD-1 or an agonist of PD-1 such as PD-L1
- a polypeptide that binds PD-Ll e.g., an antibody molecule that binds PD-L1
- CD20 e.g., an antibody molecule that binds CD20
- TRAIL receptor e.g., an agonist of
- the one or more agents comprise an agent selected a polypeptide of any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an agonist or antagonist thereof, or an antibody molecule thereto.
- the vehicle comprises two or more agents described herein, e.g., any pair of agents described herein.
- the vehicle comprises an erythroid cell.
- the erythroid cell is a nucleated red blood cell, red blood cell precursor, or enucleated red blood cell.
- the erythroid cell is a cord blood stem cell, a CD34+ cell, a hematopoietic stem cell (HSC), a spleen colony forming (CFU-S) cell, a common myeloid progenitor (CMP) cell, a blastocyte colony-forming cell, a burst forming unit-erythroid (BFU-E), a megakaryocyte-erythroid progenitor (MEP) cell, an erythroid colony-forming unit (CFU-E), a reticulocyte, an erythrocyte, an induced pluripotent stem cell (iPSC), a mesenchymal stem cell (MSC), a polychromatic normoblast, an orthochromatic normoblast, or a combination thereof.
- HSC hematopoietic
- enucleated erythroid cells or other vehicles described herein are encapsulated in a membrane, e.g., semi-permeable membrane.
- the membrane comprises a polysaccharide, e.g., an anionic polysaccharide alginate.
- the semipermeable membrane does not allow cells to pass through, but allows passage of small molecules or macromolecules, e.g., metabolites, proteins, or DNA.
- the membrane is one described in Lienert et al., “Synthetic biology in mammalian cells: next generation research tools and therapeutics” Nature Reviews Molecular Cell Biology 15, 95-107 (2014), incorporated herein by reference in its entirety. While not wishing to be bound by theory, in some embodiments, the membrane shields the cells from the immune system and/or keeps a plurality of cells in proximity, facilitating interaction with each other or each other's products.
- enucleated red blood cells e.g., reticulocytes
- exogenous agent e.g., polypeptides
- the enucleated red blood cells described herein are administered to a subject, e.g., a mammal, e.g., a human.
- a subject e.g., a mammal, e.g., a human.
- mammals that can be treated include without limitation, humans, domestic animals (e.g., dogs, cats and the like), farm animals (e.g., cows, sheep, pigs, horses and the like) and laboratory animals (e.g., monkey, rats, mice, rabbits, guinea pigs and the like).
- farm animals e.g., cows, sheep, pigs, horses and the like
- laboratory animals e.g., monkey, rats, mice, rabbits, guinea pigs and the like.
- the methods described herein are applicable to both human therapy and veterinary applications.
- the RBCs are administered to a patient every 1, 2, 3, 4, 5, or 6 months.
- a dose of RBC comprises about 1 ⁇ 10 9 -2 ⁇ 10 9 , 2 ⁇ 10 9 -5 ⁇ 10 9 , 5 ⁇ 10 9 -1 ⁇ 10 10 , 1 ⁇ 10 10 -2 ⁇ 10 10 , 2 ⁇ 10 10 -5 ⁇ 10 10 , 5 ⁇ 10 10 -1 ⁇ 10 11 , 1 ⁇ 10 11 -2 ⁇ 10 11 , 2 ⁇ 10 11 -5 ⁇ 10 11 , 5 ⁇ 10 11 -1 ⁇ 10 12 , 1 ⁇ 10 12 -2 ⁇ 10 12 , 2 ⁇ 10 12 -5 ⁇ 10 12 , or 5 ⁇ 10 12 -1 ⁇ 10 13 cells.
- the RBCs are administered to a patient in a dosing regimen (dose and periodicity of administration) sufficient to maintain function of the administered RBCs in the bloodstream of the patient over a period of 2 weeks to a year, e.g., one month to one year or longer, e.g., at least 2 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 6 months, a year, 2 years.
- dose and periodicity of administration sufficient to maintain function of the administered RBCs in the bloodstream of the patient over a period of 2 weeks to a year, e.g., one month to one year or longer, e.g., at least 2 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 6 months, a year, 2 years.
- the present disclosure provides a method of treating a disease or condition described herein, comprising administering to a subject in need thereof a composition described herein, e.g., an enucleated red blood cell (e.g., reticulocyte) described herein.
- a composition described herein e.g., an enucleated red blood cell (e.g., reticulocyte) described herein.
- the disease or condition is an inflammatory disease or an autoimmune disease.
- the disclosure provides a use of a RBC described herein for treating a disease or condition described herein, e.g., an immune condition, e.g., an inflammatory disease or an autoimmune disease, e.g., an autoimmune disease of Table 4.
- the disclosure provides a use of a RBC described herein for manufacture of a medicament for treating a disease or condition described herein, e.g., an immune condition, e.g., an inflammatory disease or an autoimmune disease, e.g., an autoimmune disease of Table 4.
- a disease or condition described herein e.g., an immune condition, e.g., an inflammatory disease or an autoimmune disease, e.g., an autoimmune disease of Table 4.
- Inflammatory disease include sepsis e.g., bacterial sepsis, rheumatoid arthritis, age related macular degeneration (AMD), systemic lupus erythematosus (an inflammatory disorder of connective tissue), glomerulonephritis (inflammation of the capillaries of the kidney), Crohn's disease, ulcerative colitis, celiac disease, or other idiopathic inflammatory bowel diseases, and allergic asthma.
- sepsis e.g., bacterial sepsis, rheumatoid arthritis, age related macular degeneration (AMD), systemic lupus erythematosus (an inflammatory disorder of connective tissue), glomerulonephritis (inflammation of the capillaries of the kidney), Crohn's disease, ulcerative colitis, celiac disease, or other idiopathic inflammatory bowel diseases, and allergic asthma.
- Immunodeficiencies include primary immunodeficiencies, e.g., Adenosine Deaminase Deficiency-Severe Combined Immunodeficiency (ADA-SCID), and e.g., secondary immunodeficiencies, e.g., secondary to an immunosuppressive therapy.
- primary immunodeficiencies e.g., Adenosine Deaminase Deficiency-Severe Combined Immunodeficiency (ADA-SCID)
- secondary immunodeficiencies e.g., secondary to an immunosuppressive therapy.
- modifiers e.g., proteases Modifier
- Exemplary target Proteases IdeS IgG IdeZ (an immunoglobulin-degrading enzyme from IgG Streptococcus equi subspecies zooepidemicus)
- IgA protease IgG Papain IgG ADAM17/TACE TNF-alpha mesotrypsin Peptides comprising linkages involving the carboxyl group of lysine or arginine Lysozyme peptidoglycan Endolysin peptidoglycan Endoproteinase, e.g., LysC (can cleave proteins Protein having a Lys-Xaa motif on C-terminal side of lysine residues)
- Metalloendopeptidase e.g., LysN (can cleave Protein having an Xaa-Lys motif proteins on amino side of lysine residues)
- Elastase
- Exemplary first exogenous polypeptides that interact with a target Polypeptide Exemplary target(s) CD16A IgG Fc CD14 LPS TLR4 LPS scFv Complement (e.g., C3 or C5) or cytokine (e.g., TNF-alpha or IL-6 or another cytokine of Table 1) Aquaporin 4 (AQP4) and variants Anti-AQP4 autoantibodies Phospholipase A2 receptor (PLA2R) and Anti-PLA2R variants (shortened domains & peptides) autoantibodies Acetylcholine receptor (AChR) and Anti-AChR variants (shortened domains & peptides) autoantibodies Insulin and variants (proinsulin, Anti-insulin preproinsulin, etc.) autoantibodies B2-glycoprotein 1 (b2GP1) and variants Anti-b2GP1 (shortened domains & peptides) autoantibodies ADAMTS13
- the genes for TRAIL receptor agonists DR4.2 (SEQ ID 2) and DR5.2 (SEQ ID 5) were synthesized.
- the genes were cloned into a lentivirus vector (SBI) upstream of the gene for human glycophorin A and separated by a sequence encoding a 12-amino acid Gly-Ser (GGGSGGGSGGGS (SEQ ID NO: 19)) flexible linker and an HA epitope tag (YPYDVPDY (SEQ ID NO: 20)).
- Human CD34+ cells derived from mobilized peripheral blood cells from normal human donors were purchased frozen from AllCells Inc. Cells were thawed in PBS with 1% FBS. Cells were then cultured in StemSpan SFEM media with StemSpan CC100 Cytokine Mix at a density of 1E5 cells/mL. Media was swapped to differentiation media on day 5.
- Virus production protocol was conducted as follows. Briefly, HEK293T cells were seeded 24 hours before transfection. Cells were transfected with lentivector containing the construct along with packaging plasmids. A media swap was performed 24 hours after transfection and viruses were harvested 72 hours after transfection. On day 6 after thaw, cells were transduced with equal volumes of each virus in a 1:1 cell volume to virus volume ratio, and spinoculated at 845 ⁇ g for 1.5 hours with 5-10 ⁇ g/ml of polybrene.
- Transduced cells were differentiated in defined media to erythroid lineage cells and to mature enucleated reticulocytes following the method of Hu et al., Blood 18 Apr. 2013 Vol 121, 16.
- the cell culture procedure was comprised of 3 phases.
- Composition of the base culture medium was Iscove's Modified Dulbecco's Medium, 2% human peripheral blood plasma, 3% human AB serum, 200 mg/mL Holohuman transferrin, 3 IU/mL heparin, and 10 mg/mL insulin.
- CD341 cells at a concentration of 10 ⁇ 5/mL were cultured in the presence of 10 ng/mL stem cell factor, 1 ng/mL IL-3, and 3 IU/mL erythropoietin.
- IL-3 was omitted from the culture medium.
- the cell concentration was adjusted to 10 ⁇ 6/mL on day 11 and to 5 ⁇ 10 ⁇ 6/mL on day 15, respectively.
- the medium for this phase was the base medium plus 3 IU/mL erythropoietin, and the concentration of transferrin was adjusted to 1 mg/mL.
- soluble TRAIL R1 and TRAIL R2 purchased from Sigma-Aldrich Inc.
- TRAIL R2 obtained from Sigma-Aldrich Inc.
- Fusion TRAIL R1 and TRAIL R2 purchased from Sigma-Aldrich Inc.
- complementary fluorescent dyes Fluorescein and DyLight 650 and staining by flow cytometry.
- Expression levels of both ligands DR4.2 and DR5.2 were verified through flow cytometry.
- apoptosis assay was conducted according to a modified version of Marconi et al., Cell Death and Disease 2013. In short, fully mature enucleated reticulocytes expressing DR4.2 and DR5.2 were incubated with CFSE-labeled Raji Cells for 24 hours at a 1:1 ratio. Afterwards cells were stained with annexin V and analyzed by flow cytometry. Apoptosis percentages were determined from CFSE positive Raji cells that also stained positive for annexin V.
- a cell population comprising TRAIL receptor agonists, and optionally further comprising a moiety that targets autoreactive immune cells may be formulated in AS-3 additive solution and administered intravenously to a patient, e.g., a patient suffering from an autoimmune disease.
- Capture eRBC comprising 5 Cytokines for Use in Treating Sepsis
- the genes for anti-TNFa (SEQ ID 7), anti-IL6 (SEQ ID 6), CD14 (Uniprot #P08571), IFNGR1 (Uniprot #P15260), and IL12R1 (Uniprot #P42701) are synthesized by a commercial vendor.
- the genes are cloned into a lentivirus vector (SBI) upstream of the gene for human glycophorin A and separated by a sequence encoding a 12-amino acid Gly-Ser (GGGSGGGSGGGS (SEQ ID NO: 19)) flexible linker and an HA epitope tag (YPYDVPDY (SEQ ID NO: 20)).
- Human CD34+ cells can be cultured, and virus can be produced, as described in Example 1. Transduced cells are differentiated as described herein.
- cells are labeled simultaneously with the ligands TNFa, IL-6, IFNg, and IL-12 (purchased from Life Technologies), as well as lipopolysaccharide (ThermoFisher), that are chemically conjugated to complementary fluorescent dyes.
- the cells are analyzed by flow cytometry to verify that (a) the agents are all expressed on the surface of the cell and (b) the agents are capable of binding to their target ligands.
- the cell population is formulated in AS-3 additive solution and administered intravenously to a patient who is developing sepsis. It is anticipated that the patient then exhibits an improvement in his symptoms as measured by a reduction in circulating cytokine levels, a reduction or prevention of vascular leak syndrome, and improved survival.
- transgenic enucleated erythroid cells were used to capture and modify a target protein.
- the control cells and the experimental cells each comprise endogenous glycophorin A (GPA) in their membranes, which was used to bind the target protein.
- the experimental cells expressed an exogenous protein comprising surface-exposed IdeS fused to GPA as a membrane anchor. IdeS is capable of cleaving antibodies to produce a F(ab′)2 fragment and a Fc fragment.
- the target protein is an anti-GPA antibody that is fluorescently labelled with FITC. Both the constant and variable regions of the target antibody were FITC-labelled, so that if the antibody was cleaved, both fragments could be detected.
- control cells and IdeS-expressing cells were tested by FACS for the ability to bind the anti-GPA antibody. Both control and IdeS-expressing cells bound the antibody as measured by association of FITC with the cells (data not shown). In addition, both control and IdeS-expressing cells bound the antibody as measured by or using a second detection method with a fluorescently labeled anti-rabbit Fc antibody (data not shown). These measurements were taken at an early timepoint, before cells were incubated to allow IdeS-mediated cleavage of the target antibody.
- the IdeS-expressing cells were able to cleave the target antibody. This was shown by incubating the control or IdeS-expressing cells with the target antibody to allow antibody cleavage to occur. Fluorescently labeled anti-rabbit Fc antibody was added to the reaction in order to detect intact antibodies on the surface of the erythroid cells. The IdeS-expressing cells showed a decrease in anti-rabbit Fc association with the cells ( FIG. 2 ), indicating lower levels of Fc on the surface of the IdeS-expressing cells compared to the control cells.
- control cells were able to bind the target antibody, but only the IdeS-expressing cells were able to bind and cleave the target antibody.
- a cell population comprising TRAIL ligand, anti-CD20 moeity, and optionally further comprising a moiety that specifically targets autoreactive immune cells may be formulated in AS-3 additive solution and administered intravenously to a patient, e.g., a patient suffering from an autoimmune disease.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Genetics & Genomics (AREA)
- Mycology (AREA)
- Hematology (AREA)
- Wood Science & Technology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Engineering & Computer Science (AREA)
- Oncology (AREA)
- Dermatology (AREA)
- Endocrinology (AREA)
- Toxicology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
Description
- This application is a continuation of PCT Application No. PCT/US2017/013033, filed Jan. 11, 2017, which claims priority to U.S. Ser. No. 62/277,130, filed Jan. 11 2016, U.S. Ser. No. 62/359,448, filed Jul. 7, 2016, U.S. Ser. No. 62/370,915, filed Aug. 4, 2016, and U.S. Ser. No. 62/420,973, filed Nov. 11, 2016, the contents of which are incorporated herein by reference in their entirety.
- The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Jan. 5, 2017, is named R2081-7013WO_SL.txt and is 24,800 bytes in size.
- Red blood cells have been considered for use as drug delivery systems, e.g., to degrade toxic metabolites or inactivate xenobiotics, and in other biomedical applications.
- The invention includes compositions and methods related to multimodal therapies. The therapies are useful, e.g., for treating immune conditions, e.g., autoimmune or inflammatory diseases. A multimodal therapy described herein provides and/or administers a plurality of agents that function in a coordinated manner to provide a therapeutic benefit to a subject in need thereof, e.g., a subject having an autoimmune or inflammatory disease. In general, a multimodal therapy described herein includes the administration to a subject of a preparation of engineered red blood cells, e.g., enucleated red blood cells, comprising (e.g., expressing or containing) a plurality of agents (e.g., polypeptides) that function in a coordinated manner (e.g., agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory).
- In some aspects, the present disclosure provides an enucleated red blood cell, e.g., a reticulocyte, comprising a plurality of agents, e.g., a plurality of polypeptides (e.g., exogenous polypeptides), e.g., a first exogenous polypeptide, a second exogenous polypeptide, and a third exogenous polypeptide.
- In some aspects, the present disclosure provides an enucleated red blood cell, e.g., a reticulocyte, comprising a plurality of exogenous polypeptides, wherein a first and a second exogenous polypeptide of the plurality have agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity.
- In some aspects, the present disclosure provides an enucleated red blood cell, e.g., a reticulocyte, comprising a first exogenous polypeptide and a second exogenous polypeptide, wherein:
-
- a) the first and second exogenous polypeptides act on the same target, wherein optionally the target is a cell surface receptor and/or an endogenous human protein;
- b) the first exogenous polypeptide binds to a first endogenous human protein and the second exogenous polypeptide binds to a second endogenous human target protein, e.g., with a Kd of less than 500, 200, 100, 50, 20, 10, 5, 2, or 1 nM;
- c) the first exogenous polypeptide acts on (e.g., binds) a first target, and the second exogenous polypeptide act on (e.g., binds) a second target, wherein the first and second targets are members of the same biological pathway, wherein optionally the targets are cell surface receptors, endogenous human proteins, or both;
- d) the first exogenous polypeptide comprises a first pro-apoptotic polypeptide and the second exogenous polypeptide comprises a second pro-apoptotic polypeptide, e.g., a TRAIL receptor ligand, e.g., a TRAIL polypeptide;
- e) the first and second exogenous polypeptides are in close proximity to each other, e.g., are less than 10, 7, 5, 4, 3, 2, 1, 0.5, 0.2, or 0.1 nm apart for a duration of at least 1, 2, 5, 10, 30, or 60 seconds; 1, 2, 5, 10, 30, or 60 minutes, or 1, 2, 3, 6, 12, or 14 hours;
- f) the first and second exogenous polypeptides have a Kd of less than 500, 200, 100, 50, 20, 10, 5, 2, or 1 nM for each other;
- g) the first exogenous polypeptide comprises an antigen-presenting polypeptide, e.g., an MHC molecule, e.g., an MHC class II molecule, and the second exogenous polypeptide comprises an antigen;
- h) the first and second exogenous polypeptides act on different targets, wherein optionally at least one of the targets is a cell surface receptor and/or an endogenous human protein, e.g., the first exogenous polypeptide binds a first cell type, e.g., an immune effector cell, and the second exogenous polypeptide binds a second cell type, e.g., an immune effector cell, e.g., a T cell;
- i) the first exogenous polypeptide and the second exogenous polypeptide have an abundance ratio of about 1:1, from about 2:1 to 1:2, from about 5:1 to 1:5, from about 10:1 to 1:10, from about 20:1 to 1:20, from about 50:1 to 1:50, from about 100:1 to 1:100 by weight or by copy number;
- j) the first exogenous polypeptide and the second exogenous polypeptide have a Kd for a first target and a second target, respectively, with a ratio of about 1:1, from about 2:1 to 1:2, from about 5:1 to 1:5, from about 10:1 to 1:10, from about 20:1 to 1:20, from about 50:1 to 1:50, from about 100:1 to 1:100;
- k) the first exogenous polypeptide has a first activity (e.g., binding) towards a first target, and the second exogenous polypeptide has a second activity (e.g., binding) towards the first target, e.g., the first and second exogenous polypeptides bind a single target;
- l) the first exogenous polypeptide acts on (e.g., binds) a first target and the second exogenous polypeptide acts on (e.g., binds) a second target, and the first and second targets are part of the same pathway, wherein optionally the first exogenous polypeptide acts on the first target and the second exogenous polypeptide acts on the second target simultaneously;
- m) the first exogenous polypeptide acts on (e.g., binds) a first target and the second exogenous polypeptide acts on (e.g., binds) a second target, and the first and second targets are part of different pathways, wherein optionally the first and second pathways both act to promote a given cellular response;
- n) the first exogenous polypeptide localizes the enucleated red blood cell to a desired site, e.g., a human cell, and the second exogenous polypeptide has a therapeutic activity, e.g., an immunomodulation activity such as a T cell inhibition activity or antigen presenting activity;
- o) the first exogenous polypeptide binds a first target, e.g., a first cell, e.g., a first cell type, e.g., an immune effector cell, and the second exogenous polypeptide binds a second target, e.g., a second cell, e.g., a second cell type, e.g., an immune effector cell, e.g., a T cell;
- p) the first exogenous polypeptide and the second exogenous polypeptide are non-human proteins;
- q) the first exogenous polypeptide and the second exogenous polypeptide are both enzymes, e.g., biosynthetic enzymes;
- r) the first exogenous polypeptide promotes formation of an intermediate molecule and the second exogenous polypeptide acts on the intermediate molecule; or
- s) the first exogenous polypeptide and the second exogenous polypeptide act on successive steps of a pathway.
- Any of the aspects herein, e.g., the aspects above, can be characterized by one or more of the embodiments herein, e.g., the embodiments below.
- In some embodiments, the exogenous polypeptides have synergistic activity. In some embodiments, the exogenous polypeptides have additive activity.
- In some embodiments, the exogenous polypeptides have proximity-dependent activity. The proximity between the plurality of polypeptides, before, during, or after, interaction with a target moiety or moieties, may confer a property or result which is not seen in the absence of such proximity in vivo or in vitro.
- In some embodiments, the first exogenous polypeptide interacts with, e.g., binds, a first target moiety, e.g., a first target cell polypeptide on a target cell (e.g., an immune effector cell, e.g., a T cell), and the second exogenous polypeptide interacts with, e.g., binds, a second target moiety, e.g., a second target cell polypeptide on the target cell (e.g., wherein binding of the first and second target cell polypeptide alters a biological property of the target cell). In an embodiment the first and second targets are subunits of a multimeric complex on the target cell.
- In some embodiments, the first exogenous polypeptide promotes fusion of the red blood cell with a target cell and the second exogenous polypeptide is a polypeptide of any of Table 1, Table 2, Table 3, or Table 4 (e.g., a human polypeptide of any of Table 1, Table 2, Table 3, or Table 4, e.g., a polypeptide having the amino acid sequence of the human wild type polypeptide).
- In some embodiments the first and second exogenous polypeptides interact with one another, e.g., the first modifies, e.g., by cleavage or phosphorylation, the second, or the first and second form a dimeric or multimeric protein.
- In some embodiments, the enucleated red blood cell comprises 3, 4, 5, 6, 7, 8, 9, or 10 different exogenous polypeptides. In an embodiment a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10), or all, of the different exogenous polypeptides, have a preselected level of homology to each other, e.g., at least 40, 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 99.5% sequence identity to each other. In an embodiment a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10), or all, of the different exogenous polypeptides, have a preselected level of homology to a reference sequence, e.g., at least 40, 50, 60, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, 99.5%, or 100% sequence identity with a reference sequence (which reference sequence, includes an entire polypeptide sequence, or a portion thereof, e.g., a preselected domain), e.g., a plurality or all of the different exogenous polypeptides are antibodies or antibody molecules. In some embodiments, the reference sequence is an antibody sequence or fragment thereof. In some embodiments, the reference sequence comprises a heavy chain constant region or portion thereof, light chain constant region or fragment thereof, heavy chain variable region or portion thereof, light chain variable region or fragment thereof, or any combination of the foregoing. In embodiments, the enucleated red blood cells are used to treat an immunodeficient subject, e.g., as a substitute for (or combination with) an IVIG therapy.
- In some embodiments, the enucleated red blood cell comprises at least 2 but no more than 5, 6, 7, 8, 9, or 10 different exogenous polypeptides, e.g., exogenous polypeptides that are encoded by one or more exogenous nucleic acids that are not retained by the enucleated red blood cell.
- In some embodiments, the exogenous polypeptides are encoded by one or more exogenous nucleic acids that are not retained by the enucleated red blood cell.
- In some embodiments, one or more (e.g., two or three) of the first, second, and optionally third exogenous polypeptides are transmembrane polypeptides or surface-anchored polypeptides.
- In some embodiments, the first exogenous polypeptide interacts with, e.g., binds, a moiety on a target cell, and the second exogenous polypeptide alters a property of the target cell, e.g., kills, activates, inactivates, or induces tolerance or anergy in the target cell.
- In some embodiments, the first exogenous polypeptide and the second exogenous polypeptide have an abundance ratio of about 1:1, from about 2:1 to 1:2, from about 5:1 to 1:5, from about 10:1 to 1:10, from about 20:1 to 1:20, from about 50:1 to 1:50, or from about 100:1 to 1:100 by weight or by copy number. In some embodiments, both the first and second polypeptides have a stoichiometric mode of action, or both have a catalytic mode of action, and both are present at a similar abundance, e.g., about 1:1 or from about 2:1 to 1:2. In some embodiments, the first exogenous polypeptide is more abundant than the second exogenous polypeptide by at least about 10%, 20%, 30%, 50%, or a factor of 2, 3, 4, 5, 10, 20, 50, or 100 (and optionally up to 10 or 100 fold) by weight or copy number. In some embodiments, the second exogenous polypeptide is more abundant than the first exogenous polypeptide by at least about 10%, 20%, 30%, 50%, or a factor of 2, 3, 4, 5, 10, 20, 50, or 100 (and optionally up to 10 or 100 fold) by weight or copy number. In some embodiments, the first polypeptide has a stoichiometric mode of action and the second polypeptide has a catalytic mode of action, and the first polypeptide is more abundant than the second polypeptide. In some embodiments, the second polypeptide has a stoichiometric mode of action and the first polypeptide has a catalytic mode of action, and the second polypeptide is more abundant than the first polypeptide.
- In some embodiments, the first exogenous polypeptide comprises a targeting moiety.
- In some embodiments, the enucleated red blood cell has one or more of the following characteristics:
-
- a) an osmotic fragility of less than 50% cell lysis at 0.3%, 0.35%, 0.4%, 0.45%, or 0.5% NaCl;
- b) a cell volume of about 10-200 fL or a cell diameter of between about 1 micron and about 20 microns, between about 2 microns and about 20 microns, between about 3 microns and about 20 microns, between about 4 microns and about 20 microns, between about 5 microns and about 20 microns, between about 6 microns and about 20 microns, between about 5 microns and about 15 microns, or between about 10 microns and about 30 microns;
- c) greater than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% or 10% fetal hemoglobin; or at least about 20, 25, or 30 pg/cell of hemoglobin; or
- d) phosphatidylserine content of the outer leaflet is less than 30%, 25%, 20%, 15%, 10%, or 5% as measured by Annexin V staining.
- In some embodiments, at least one, e.g., all, of the plurality of exogenous polypeptides are glycosylated. In some embodiments, at least one, e.g., all, of the plurality of exogenous polypeptides are phosphorylated.
- In some embodiments, the enucleated red blood cell is a reticulocyte.
- In some embodiments, the exogenous polypeptide or polypeptides lack a sortase transfer signature (i.e., a sequence that can be created by a sortase reaction) such as LPXTG (SEQ ID NO: 17).
- In some aspects, the present disclosure provides a method of treating a disease or condition described herein, comprising administering to a subject in need thereof an enucleated red blood cell, e.g., a reticulocyte, described herein. In some embodiments, the disease or condition is an inflammatory disease, or an autoimmune disease.
- In some aspects, the present disclosure provides a method of bringing into proximity a first and a second cell surface moiety, e.g., transmembrane receptors, comprising administering to a subject in need thereof an enucleated red blood cell, e.g., a reticulocyte, described herein.
- In some aspects, the present disclosure provides a method of delivering, presenting, or expressing a plurality of proximity-dependent molecules comprising providing an enucleated red blood cell, e.g., a reticulocyte, described herein.
- In some aspects, the present disclosure provides a method of producing an enucleated red blood cell, e.g., a reticulocyte, described herein, providing contacting a red blood cell precursor with one or more nucleic acids encoding the exogenous polypeptides and placing the cell in conditions that allow enucleation to occur.
- In some aspects, the present disclosure provides a preparation, e.g., pharmaceutical preparation, comprising a plurality of enucleated red blood cells, e.g., reticulocytes, described herein, e.g., at least 108, 109, 1010, 1011, or 1012 cells.
- In some aspects, the present disclosure provides a cell complex, e.g., an in vitro or in vivo complex, of an engineered red blood cell (RBC), e.g., an enucleated red blood cell, e.g., a reticulocyte, and a target cell, the complex mediated by one of the exogenous polypeptides. In some embodiments, the cell complex comprises at least 2, 3, 4, 5, 10, 20, 50, or 100 cells.
- In some aspects, the present disclosure proves a reaction mixture comprising an engineered RBC, e.g., an enucleated red blood cell, e.g., a reticulocyte, and nucleic acid, e.g., one or more nucleic acid molecules, encoding a multimodal pair described herein. In some embodiments, the nucleic acid comprises at least one promoter that is active in a red blood cell. In some embodiments, nucleic acid encodes at least two proteins described herein (e.g., in Table 1, Table 2, Table 3, and Table 4). In some embodiments, the nucleic acid encodes a third exogenous polypeptide.
- In some aspects, the present disclosure comprises a method of making an engineered RBC (e.g., an enucleated red blood cell, e.g., a reticulocyte) described herein, comprising: providing, e.g., receiving, information about a target cell or subject, responsive to that information selecting a plurality of exogenous polypeptides, and introducing nucleic acids encoding the exogenous polypeptides into a RBC or RBC precursor.
- In some aspects, the present invention comprises a method of evaluating an engineered RBC (e.g., enucleated RBC, e.g., a reticulocyte), comprising providing a candidate RBC, and determining if nucleic acid encoding a plurality of exogenous polypeptides, e.g., a multimodal pair of the exogenous polypeptides, are present.
- The present disclosure provides, in some aspects, an enucleated erythroid cell comprising:
- a first exogenous polypeptide that interacts with a target, and
- a second exogenous polypeptide that modifies the target;
- wherein one or more of:
- (a) the second exogenous polypeptide comprises a moiety that cleaves an antibody, e.g., that cleaves at a hinge region, a CH2 region, or between a hinge and CH2 region, e.g., an IdeS polypeptide;
- (b) the second exogenous polypeptide comprises an enzyme (e.g., a protease) that modifies, e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor;
- (c) the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme, e.g., a protease, that modifies the secondary, tertiary, or quaternary structure of the target, and, in embodiments, alters, e.g., decreases or increases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide, wherein optionally the target comprises an antibody, or complement factor;
- (d) the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme (e.g., a protease) that cleaves the target, e.g., a polypeptide, between a first target domain and a second target domain, e.g., a first target domain that binds a first substrate and a second target domain that binds a second substrate;
- (e) the target is a polypeptide (e.g., an autoantibody or a complement factor); a carbohydrate (e.g., a glycan), a lipid (e.g., a phospholipid), or a nucleic acid (e.g., DNA, or RNA);
- (f) the first exogenous polypeptide binds a target, e.g., an antibody, but does not cleave, and the second exogenous polypeptide cleaves a bond e.g., a covalent bond, e.g., a covalent bond in the antibody;
- (g) the target comprises an antibody and the first exogenous polypeptide binds the variable region of the antibody target;
- (h) the target comprises an antibody and first exogenous polypeptide binds the constant region of the antibody target;
- (i) the first exogenous polypeptide has an affinity for the target that is about 1-2 pM, 2-5 pM, 5-10 pM, 10-20 pM, 20-50 pM, 50-100 pM, 100-200 pM, 200-500 pM, 500-1000 pM, 1-2 nM, 2-5 nM, 5-10 nM, 10-20 nM, 20-50 nM, 50-100 nM, 100-200 nM, 200-500 nM, 500-1000 nM, 1-2 μM, 2-5 μM, 5-10 μM, 10-20 μM, 20-50 μM, or 50-100 μM;
- (j) the second exogenous polypeptide has a KM for the target of about 10−1-10−7M, 10−1-10−2M, 10−2-10−3M, 10−3-10−4M, 10−4-10−5M, 10−5-10−6M, or 10−6-10−7M;
- (k) a ratio of the Kd of the first exogenous polypeptide for the target (measured in M) divided by the KM of the second exogenous polypeptide for the target (measured in M) is about 1×10−9-2×10−9, 2×10−9-5×10−9, 5×10−9-1×10−8, 1×10−8-2×10−8, 2×10−8-5×10−8, 5×10−8-1×10−7, 1×10−7-2×10−7, 2×10−7-5×10−7, 5×10−7-1×10−6, 1×10−6-2×10−6, 2×10−6-5×10−6, 5×10−6-1×10−5, 1×10−5-2×10−5, 2×10−5-5×10−5, 5×10−5-1×10−4, 1×10−4-2×10−4, 2×10−4-5×10−4, 5×10−4-1×10−3, 1×10−3-2×10−3, 2×10−3-5×10−3, 5×10−3-1×10−2, 1×10−2-2×10−2, 2×10−2-5×10−2, 5×10−2-1×10−1, 1×10−1-2×10−1, 2×10−1-5×10−1, or 5×10−1-1;
- (l) the observed reaction rate of the second exogenous polypeptide modifying the target is greater than the reaction rate of an enucleated cell which is similar but which lacks the first exogenous polypeptide under otherwise similar reaction conditions;
- (m) a ratio of the average number of the first exogenous polypeptide on the erythroid cell to the average number of the second exogenous polypeptide on the erythroid cell is about 50:1, 20:1, 10:1, 8:1, 6:1, 4:1, 2:1, 1:1, 1:2, 1:4, 1:6, 1:8, 1:10, 1:20, or 1:50;
- (n) affinity of the first exogenous polypeptide for the target is greater than the affinity of the first exogenous polypeptide for the modified (e.g., cleaved) target;
- (o) a therapeutically effective dose of the enucleated erythroid cell is less than stoichiometry (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) to the amount of target in a subject's peripheral blood at the time of administration;
- (p) the number of enucleated erythroid cells in an effective dose, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) the number of targets, e.g., target molecules, in the subject's peripheral blood at the time of administration;
- (q) the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose, or in vitro effective amount of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (r) the number of first exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose, or in vitro effective amount of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (s) the number of first exogenous polypeptides and the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose, enucleated erythroid cells, is each less than a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (t) the second exogenous polypeptide modifies (e.g. cleaves) the target with a KM of at least 10−1 M, 10−2 M, 10−3 M, 10−4 M, 10−5 M, 10−6 M, or 10−7 M;
- (u) the second exogenous polypeptide comprises a chaperone;
- (v) the first exogenous polypeptide comprises a surface-exposed portion and the second exogenous polypeptide comprises a surface exposed portion; or
- (w) an effective amount of the enucleated erythroid cells is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) an effective amount of otherwise similar enucleated erythroid cells that lack the second exogenous polypeptide.
- In embodiments, (b) the second exogenous polypeptide comprises an enzyme (e.g., a protease) that modifies, e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor. In embodiments the modification alters, e.g., increases or decreases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide.
- In embodiments, (d) the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme (e.g., a protease) that cleaves the target, e.g., a polypeptide, between a first target domain and a second target domain, e.g., a first target domain that binds a first substrate and a second target domain that binds a second substrate. In embodiments the first target domain is released from the second target domain. In embodiments cleavage alters the affinity one or both of the first target domain for a first substrate and the affinity of the second target domain for a second substrate. In an embodiment the target comprises an antibody and the first target domain comprises one or more CDRs and the second target domain comprises a portion of the constant region, e.g., a Fc region.
- In embodiments, at least two (e.g., at least 3, 4, 5, 6, 7, 8, 9, or 10) of (a)-(w) are present. In embodiments, at least (a) and (e) are present. In embodiments, at least (a) and (i) are present. In embodiments, at least (a) and (j) are present. In embodiments, at least (a) and (m) are present. In embodiments, at least (a) and (q) are present. In embodiments, at least (a) and (r) are present. In embodiments, at least (a) and (s) are present. In embodiments, at least (e) and (i) are present. In embodiments, at least (e) and (j) are present. In embodiments, at least (e) and (m) are present. In embodiments, at least (e) and (q) are present. In embodiments, at least (e) and (r) are present. In embodiments, at least (e) and (s) are present. In embodiments, at least (i) and (j) are present. In embodiments, at least (i) and (m) are present. In embodiments, at least (i) and (q) are present. In embodiments, at least (i) and (r) are present. In embodiments, at least (i) and (s) are present. In embodiments, at least (j) and (m) are present. In embodiments, at least (j) and (q) are present. In embodiments, at least (j) and (r) are present. In embodiments, at least (j) and (s) are present. In embodiments, at least (m) and (q) are present. In embodiments, at least (m) and (r) are present. In embodiments, at least (m) and (s) are present. In embodiments, at least (q) and (r) are present. In embodiments, at least (q) and (s) are present. In embodiments, at least (r) and (s) are present.
- In embodiments, at least:
- (a) and (b), (a) and (c), (a) and (d), (a) and (e), (a) and (f), (a) and (g), (a) and (h), (a) and (i), (a) and (j), (a) and (k), (a) and (l), (a) and (m), (a) and (n), (a) and (o), (a) and (p), (a) and (q), (a) and (r), (a) and (s), (a) and (t), (a) and (u), (a) and (v), (a) and (w),
- (b) and (c), (b) and (d), (b) and (e), (b) and (f), (b) and (g), (b) and (h), (b) and (i), (b) and (j), (b) and (k), (b) and (l), (b) and (m), (b) and (n), (b) and (o), (b) and (p), (b) and (q), (b) and (r), (b) and (s), (b) and (t), (b) and (u), (b) and (v), (b) and (w),
- (c) and (d), (c) and (e), (c) and (f), (c) and (g), (c) and (h), (c) and (i), (c) and (j), (c) and (k), (c) and (l), (c) and (m), (c) and (n), (c) and (o), (c) and (p), (c) and (q), (c) and (r), (c) and (s), (c) and (t), (c) and (u), (c) and (v), (c) and (w),
- (d) and (e), (d) and (f), (d) and (g), (d) and (h), (d) and (i), (d) and (j), (d) and (k), (d) and (l), (d) and (m), (d) and (n), (d) and (o), (d) and (p), (d) and (q), (d) and (r), (d) and (s), (d) and (t), (d) and (u), (d) and (v), (d) and (w),
- (e) and (f), (e) and (g), (e) and (h), (e) and (i), (e) and (j), (e) and (k), (e) and (l), (e) and (m), (e) and (n), (e) and (o), (e) and (p), (e) and (q), (e) and (r), (e) and (s), (e) and (t), (e) and (u), (e) and (v), (e) and (w),
- (f) and (g), (f) and (h), (f) and (i), (f) and (j), (f) and (k), (f) and (l), (f) and (m), (f) and (n), (f) and (o), (f) and (p), (f) and (q), (f) and (r), (f) and (s), (f) and (t), (f) and (u), (f) and (v), (f) and (w),
- (g) and (h), (g) and (i), (g) and (j), (g) and (k), (g) and (l), (g) and (m), (g) and (n), (g) and (o), (g) and (p), (g) and (q), (g) and (r), (g) and (s), (g) and (t), (g) and (u), (g) and (v), (g) and (w),
- (h) and (i), (h) and (j), (h) and (k), (h) and (l), (h) and (m), (h) and (n), (h) and (o), (h) and (p), (h) and (q), (h) and (r), (h) and (s), (h) and (t), (h) and (u), (h) and (v), (h) and (w),
- (i) and (j), (i) and (k), (i) and (l), (i) and (m), (i) and (n), (i) and (o), (i) and (p), (i) and (q), (i) and (r), (i) and (s), (i) and (t), (i) and (u), (i) and (v), (i) and (w),
- (j) and (k), (j) and (l), (j) and (m), (j) and (n), (j) and (o), (j) and (p), (j) and (q), (j) and (r), (j) and (s), (j) and (t), (j) and (u), (j) and (v), (j) and (w),
- (k) and (l), (k) and (m), (k) and (n), (k) and (o), (k) and (p), (k) and (q), (k) and (r), (k) and (s), (k) and (t), (k) and (u), (k) and (v), (k) and (w),
- (l) and (m), (l) and (n), (l) and (o), (l) and (p), (l) and (q), (l) and (r), (l) and (s), (l) and (t), (l) and (u), (l) and (v), (l) and (w),
- (m) and (n), (m) and (o), (m) and (p), (m) and (q), (m) and (r), (m) and (s), (m) and (t), (m) and (u), (m) and (v), (m) and (w),
- (n) and (o), (n) and (p), (n) and (q), (n) and (r), (n) and (s), (n) and (t), (n) and (u), (n) and (v), (n) and (w),
- (o) and (p), (o) and (q), (o) and (r), (o) and (s), (o) and (t), (o) and (u), (o) and (v), (o) and (w),
- (p) and (q), (p) and (r), (p) and (s), (p) and (t), (p) and (u), (p) and (v), (p) and (w),
- (q) and (r), (q) and (s), (q) and (t), (q) and (u), (q) and (v), (q) and (w),
- (r) and (s), (r) and (t), (r) and (u), (r) and (v), (r) and (w),
- (s) and (t), (s) and (u), (s) and (v), (s) and (w),
- (t and (u), (t) and (v), (t) and (w),
- (u) and (v), (u) and (w), or
- (v) and (w), are present.
- In embodiments, the target is other than an infectious component, e.g., other than a bacterial component, a viral component, a fungal component, or a parasitic component. In embodiments, the first exogenous polypeptide comprises an autoantigen. In embodiments, the surface-exposed portion of the first exogenous polypeptide binds the target. In embodiments, the surface-exposed portion of the second exogenous polypeptide comprises enzymatic activity, e.g., protease activity. In embodiments, the surface-exposed portion of the second exogenous polypeptide enzymatically modifies, e.g., cleaves, the target. In embodiments, the target comprises an autoantibody, the first exogenous polypeptide comprises an autoantigen, and the second exogenous polypeptide comprises a protease that cleaves the autoantibody to produce a Fab portion and an Fc portion. In embodiments, the enucleated red blood cell is capable of clearing the target from a subject's body at a faster rate than an otherwise similar enucleated red blood cell that lacks the second exogenous polypeptide. In embodiments, the enucleated red blood cell is complexed with the target or a reaction product of the second exogenous protein acting on the target, e.g., during cleavage.
- The present disclosure also provides, in certain aspects, an enucleated erythroid cell comprising:
- a first exogenous polypeptide comprising a transmembrane domain and a surface-exposed autoantigen capable of binding an autoantibody, and
- a second exogenous polypeptide comprising a transmembrane domain and a surface-exposed IdeS polypeptide.
- The present disclosure also provides, in some aspects, a polypeptide comprising a protease that can cleave an antibody, e.g., an IdeS polypeptide, and a membrane anchor domain, e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain. The disclosure also provides a nucleic acid encoding said polypeptide.
- The present disclosure also provides, in some aspects, a nucleic acid comprising:
- a first sequence encoding a protease that can cleave an antibody, e.g., an IdeS polypeptide,
- a second sequence encoding a membrane anchor domain, e.g., a transmembrane domain, wherein the first and second sequences are operatively linked to form a fusion protein; and
- optionally, a promoter sequence that is active in an erythroid cell.
- The present disclosure also provides, in some aspects, a nucleic acid composition comprising:
- a first nucleic acid sequence encoding a first exogenous polypeptide that interacts with a target, e.g., a first exogenous polypeptide described herein,
- a second nucleic acid sequence encoding a second exogenous polypeptide that modifies the target, e.g., a second nucleic acid sequence described herein and
- optionally, a promoter sequence that is active in an erythroid cell.
- In embodiments, the first nucleic acid sequence and second nucleic acid sequence are contiguous or are separate molecules (e.g., admixed molecules or in separate containers). In embodiments, the first nucleic acid sequence and second nucleic acid sequence are part of the same open reading frame and have a protease cleavage site situated therebetween. In embodiments, the first nucleic acid is operatively linked to a first promoter and the second nucleic acid is operatively linked to a second promoter.
- The disclosure provides, in some aspects, a kit comprising:
- (A) nucleic acids encoding: (A-i) a plurality of binding moieties (e.g., antibody molecules, e.g., scFv domains), fused to (A-ii) a membrane anchor domain, e.g., a transmembrane domain, wherein (A-i) and (A-ii) are operatively linked to a nucleic acid that directs expression in an erythroid cell; and
- (B) nucleic acids encoding (B-i) a plurality of enzymes (e.g., proteases), optionally fused to (B-ii) a membrane anchor domain, e.g., a transmembrane domain, wherein (B-i) and (B-ii) are operatively linked to nucleic acid that directs expression in an erythroid cell.
- The present disclosure provides, in some aspects, a method of making a fragment of a target, e.g., a target polypeptide, e.g., a method of making a fragment of a target comprising a first target domain, e.g., a method of making a variable region fragment, or a method of making a constant region containing fragment, comprising contacting the target polypeptide with an erythroid cell described herein. In embodiments, the second exogenous polypeptide cleaves the target to provide the fragment. In embodiments, the target polypeptide is an antibody, e.g., an autoantibody. In embodiments, the fragment of the target polypeptide binds an autoantigen without activating an immune response and/or inflammation. In embodiments, the contacting comprises administering the erythroid cell to a subject that comprises the target polypeptide.
- The present disclosure also provides, in certain aspects, a method of making an inhibitor, e.g., a competitive inhibitor, comprising, e.g., contacting a precursor of the inhibitor (a target) with an erythroid cell described herein. In embodiments, the second exogenous polypeptide interacts with the target, e.g., cleaves the target. In embodiments, the inhibitor is an antibody fragment (e.g., a Fab fragment). In embodiments, the target is an antibody which is cleaved to produce an inhibitor which is an antibody fragment, e.g., Fab fragment. In embodiments, the inhibitor binds an autoantigen without activating an immune response and/or inflammation. In embodiments, the precursor of the inhibitor is an antibody, e.g., an autoantibody. In embodiments, the contacting comprises administering the erythroid cell to a subject that comprises the precursor of the inhibitor.
- The present disclosure also provides, in some aspects, a method of converting or activating a target, e.g., a polypeptide, e.g., converting a prodrug to a drug, comprising contacting the polypeptide with an erythroid cell described herein. In embodiments, the second exogenous polypeptide interacts with the target (e.g., prodrug), e.g., cleaves the target. In embodiments, the prodrug is an antibody, e.g., an autoantibody. In embodiments, the drug is an antibody fragment, e.g., a Fab fragment. In embodiments, the drug binds an autoantigen without activating an immune response and/or inflammation. In embodiments, the contacting comprises administering the erythroid cell to a subject that comprises the polypeptide, e.g., prodrug.
- The present disclosure also provides, in some aspects, a method of converting an endogenous polypeptide from a first activity state to a second activity state (e.g., from an inactive state to an active state or an active state to an inactive state), comprising contacting the endogenous polypeptide with an erythroid cell described herein. In embodiments, the second exogenous polypeptide interacts with the target, e.g., covalently modifies, e.g., cleaves the target, or alters its ability to interact with, e.g., bind, another molecule. In embodiments, the endogenous polypeptide is an antibody, e.g., an autoantibody. In embodiments, the contacting comprises administering the erythroid cell to a subject that comprises the endogenous polypeptide.
- The disclosure provides, in some aspects, a method of reducing a level of a target (e.g., an antibody, e.g., an autoantibody) in a subject, comprising administering to the subject an erythroid cell described herein. In embodiments, the second exogenous polypeptide interacts with the target, e.g., covalently modifies, e.g., cleaves the target, or alters its ability to interact with, e.g., bind, another molecule. The disclosure also provides, in certain aspects, a method of generating an inhibitory fragment of an antibody (e.g., a Fab fragment) in a subject, comprising administering to the subject an erythrocyte cell described herein. The disclosure provides, in addition, a method of treating an autoimmune disease in a subject, comprising administering to the subject an erythroid cell described herein.
- In embodiments, e.g., embodiments of any of the methods described above, the erythroid cell comprises:
- a first exogenous polypeptide that interacts with a target, and
- a second exogenous polypeptide that modifies the target;
- wherein one or more of:
- (a) the second exogenous polypeptide comprises a moiety that cleaves an antibody, e.g., that cleaves at a hinge region, a CH2 region, or between a hinge and CH2 region, e.g., an IdeS polypeptide;
- (b) the second exogenous polypeptide comprises an enzyme (e.g., a protease) that modifies, e.g., is specific, e.g., binds to a site on target, binds (e.g., specifically) and modifies, e.g., covalently modifies, e.g., cleaves, or removes or attaches a moiety to, the target, wherein the target is optionally an antibody or a complement factor;
- (c) the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme, e.g., a protease, that modifies the secondary, tertiary, or quaternary structure of the target, and, in embodiments, alters, e.g., decreases or increases, the ability of the target to interact with another molecule, e.g., the first exogenous polypeptide or a molecule other than the first exogenous polypeptide, wherein optionally the target comprises an antibody, or complement factor;
- (d) the second exogenous polypeptide comprises a polypeptide, e.g., an enzyme (e.g., a protease) that cleaves the target, e.g., a polypeptide, between a first target domain and a second target domain, e.g., a first target domain that binds a first substrate and a second target domain that binds a second substrate;
- (e) the target is a polypeptide (e.g., an autoantibody or a complement factor); a carbohydrate (e.g., a glycan), a lipid (e.g., a phospholipid), or a nucleic acid (e.g., DNA, or RNA);
- (f) the first exogenous polypeptide binds a target, e.g., an antibody, but does not cleave, and the second exogenous polypeptide cleaves a bond e.g., a covalent bond, e.g., a covalent bond in the antibody;
- (g) the target comprises an antibody and the first exogenous polypeptide binds the variable region of the antibody target;
- (h) the target comprises an antibody and first exogenous polypeptide binds the constant region of the antibody target;
- (i) the first exogenous polypeptide has an affinity for the target that is about 1-2 pM, 2-5 pM, 5-10 pM, 10-20 pM, 20-50 pM, 50-100 pM, 100-200 pM, 200-500 pM, 500-1000 pM, 1-2 nM, 2-5 nM, 5-10 nM, 10-20 nM, 20-50 nM, 50-100 nM, 100-200 nM, 200-500 nM, 500-1000 nM, 1-2 μM, 2-5 μM, 5-10 μM, 10-20 μM, 20-50 μM, or 50-100 μM;
- (j) the second exogenous polypeptide has a KM for the target of about 10−1-10−7M, 10−1-10−2M, 10−2-10−3M, 10−3-10−4M, 10−4-10−5M, 10−5-10−6M, or 10−6-10−7M;
- (k) a ratio of the Kd of the first exogenous polypeptide for the target (measured in M) divided by the KM of the second exogenous polypeptide for the target (measured in M) is about 1×10−9-2×10−9, 2×10−9-5×10−9, 5×10−9-1×10−8, 1×10−8-2×10−8, 2×10−8-5×10−8, 5×10−8-1×10−7, 1×10−7-2×10−7, 2×10−7-5×10−7, 5×10−7-1×10−6, 1×10−6-2×10−6, 2×10−6-5×10−6, 5×10−6-1×10−5, 1×10−5-2×10−5, 2×10−5-5×10−5, 5×10−5-1×10−4, 1×10−4-2×10−4, 2×10−4-5×10−4, 5×10−4-1×10−3, 1×10−3-2×10−3, 2×103-5×10−3, 5×10−3-1×10−2, 1×10−2-2×10−2, 2×10−2-5×10−2, 5×10−2-1×10−1, 1×10−1-2×10−1, 2×10−1-5×10−1, or 5×10−1-1;
- (l) the observed reaction rate of the second exogenous polypeptide modifying the target is greater than the reaction rate of an enucleated cell which is similar but which lacks the first exogenous polypeptide under otherwise similar reaction conditions;
- (m) a ratio of the average number of the first exogenous polypeptide on the erythroid cell to the average number of the second exogenous polypeptide on the erythroid cell is about 50:1, 20:1, 10:1, 8:1, 6:1, 4:1, 2:1, 1:1, 1:2, 1:4, 1:6, 1:8, 1:10, 1:20, or 1:50;
- (n) affinity of the first exogenous polypeptide for the target is greater than the affinity of the first exogenous polypeptide for the modified (e.g., cleaved) target;
- (o) a therapeutically effective dose of the enucleated erythroid cell is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) stoichiometry to the amount of target in a subject's peripheral blood at the time of administration;
- (p) the number of enucleated erythroid cells in an effective dose, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) the number of targets, e.g., target molecules, in the subject's peripheral blood at the time of administration;
- (q) the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (r) the number of first exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose of enucleated erythroid cells, is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (s) the number of first exogenous polypeptides and the number of second exogenous polypeptides comprised by a preselected amount of enucleated erythroid cells, e.g., an effective dose, enucleated erythroid cells, is each less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) a reference value for targets, e.g., less than the number of targets in the peripheral blood of the subject at the time of administration;
- (t) the second exogenous polypeptide modifies (e.g. cleaves) the target with a KM of at least 10−1 M, 10−2 M, 10−3 M, 10−4 M, 10−5 M, 10−6 M, or 10−7 M;
- (u) the second exogenous polypeptide comprises a chaperone;
- (v) the first exogenous polypeptide comprises a surface-exposed portion and the second exogenous polypeptide comprises a surface exposed portion; or
- (w) an effective amount of the enucleated erythroid cells is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) an effective amount of otherwise similar enucleated erythroid cells that lack the second exogenous polypeptide.
- In some embodiments of any of the compositions and methods described herein involving an exogenous polypeptide, e.g., a fusion protein:
-
- i) at least 50, 60, 70, 80, 90, 95, or 99% of the fusion proteins on the surface of the erythroid cell have an identical sequence,
- ii) at least 50, 60, 70, 80, 90, 95, or 99% of the fusion protein have the same transmembrane region,
- iii) the fusion protein does not include a full length endogenous membrane protein, e.g., comprises a segment of a full length endogenous membrane protein, which segment lacks at least 1, 2, 3, 4, 5, 10, 20, 50, 100, 200, or 500 amino acids of the full length endogenous membrane protein;
- iv) at least 50, 60, 70, 80, 90, 95, or 99% of the fusion proteins do not differ from one another by more than 1, 2, 3, 4, 5, 10, 20, or 50 amino acids,
- v) the exogenous polypeptide lacks a sortase transfer signature,
- vi) the exogenous polypeptide comprises a moiety that is present on less than 1, 2, 3, 4, or 5 sequence distinct fusion polypeptides;
- vii) the exogenous polypeptide is present as a single fusion polypeptide;
- viii) the fusion protein does not contain Gly-Gly at the junction of an endogenous transmembrane protein and the moiety;
- ix) the fusion protein does not contain Gly-Gly, or the fusion protein does not contain Gly-Gly, or does not contain Gly-Gly in an extracellular region, does not contain Gly-Gly in an extracellular region that is within 1, 2, 3, 4, 5, 10, 20, 50, or 100 amino acids of a transmembrane segment; or a combination thereof.
- The cell systems described herein may be used in combination with another (one or more) autoimmune therapies or anti-inflammatory agents. Such therapies and agents include a steroid, e.g., a corticosteroid (e.g., methylprednisolone, prednisolone, hydrocortisone, cortisone, dexamethasone, betamethasone, triamcinolone), or an interferon, e.g., interferon beta-1.
- The disclosure contemplates all combinations of any one or more of the foregoing aspects and/or embodiments, as well as combinations with any one or more of the embodiments set forth in the detailed description and examples.
- Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references (e.g., sequence database reference numbers) mentioned herein are incorporated by reference in their entirety. For example, all GenBank, Unigene, and Entrez sequences referred to herein, e.g., in any Table herein, are incorporated by reference. Unless otherwise specified, the sequence accession numbers specified herein, including in any Table herein, refer to the database entries current as of Jan. 11, 2016. When one gene or protein references a plurality of sequence accession numbers, all of the sequence variants are encompassed.
-
FIG. 1 is a set of graphs showing results of a Raji apoptosis assay measured through flow cytometry. Raji cells are CFSE labeled and co-cultured with erythroid differentiated cells that are untransduced (control) and transduced with single or multiple TRAIL variants or co-cultured with two different singly transduced cells. Percent apoptosis determined by percent of cells that are Raji (CFSE+) and annexin V+. (Top) Flow cytometry plots of CFSE and annexin V staining of various conditions. (Bottom) Graph of percent apoptosis of the various conditions. -
FIG. 2 is a bar graph showing the mean fluorescent intensity from control erythroid cells (UNT) or IdeS-expressing erythroid cells (IDES) labelled with an anti-Rabbit Fc fluorophore labeled antibody, before or after a 5 hour incubation. -
FIG. 3 is a Western blot showing intact heavy chain of target antibodies or fragments of the heavy chain in supernatant from control cells (UNT) or Ide-S expressing cells (IdeS-RCT). Arrows indicate the heavy chain (Hc), heavy chain fragment (Hc-fragment), and light chain (Lc). -
FIG. 4 is a diagram of an erythroid cell comprising a first exogenous polypeptide (white), a second exogenous polypeptide (hatching), and a third exogenous polypeptide (close hatching) wherein each exogenous polypeptide comprises a capture agent capable of trapping a target, e.g., an unwanted target. The erythroid cell can engage in dual trapping, where it uses more than one exogenous polypeptide to bind a single or multiple soluble factors. -
FIG. 5 is a diagram of an erythroid cell comprising a first exogenous polypeptide and a second exogenous polypeptide wherein each exogenous polypeptide is capable of trapping an antibody, e.g., unwanted antibody. -
FIG. 6 is a diagram of an erythroid cell comprising a first exogenous polypeptide that binds a target, e.g., an antibody, e.g., an unwanted antibody, and a second exogenous polypeptide that modifies the target, e.g., cleaves the target. The second exogenous polypeptide may comprise a protease such as IdeS. -
FIG. 7 is a diagram of an erythroid cell comprising a first exogenous polypeptide that binds a target, e.g., an unwanted anti-drug antibody produced by a subject in reaction to treatment with a drug, a second exogenous polypeptide that cleaves the target, and an optional third exogenous polypeptide comprising a therapeutic protein, e.g., an alternative to the drug against which the subject produced anti-drug antibodies. -
FIG. 8 is a diagram of an erythroid cell comprising a first exogenous polypeptide with therapeutic activity, a second exogenous polypeptide that inhibits the first exogenous polypeptide, and optionally a third exogenous polypeptide that comprises a targeting agent, e.g., an anti-CD20 antibody molecule. -
FIG. 9 is a diagram of an erythroid cell comprising a first exogenous polypeptide with a first targeting agent (e.g., an anti-VCAM antibody molecule) and a second exogenous polypeptide with a second targeting agent (e.g., an anti-E-selectin antibody molecule). One or both of the first or second exogenous polypeptides can be used to target the erythroid cell to an inflamed tissue. -
FIG. 10 is a diagram of an erythroid cell comprising an antagonist and/or agonist. -
FIG. 11 is a diagram or an erythroid cell comprising a targeting agent (e.g., an anti-CD4 antibody molecule) and an internal payload (e.g., IDO). -
FIG. 12 is a diagram of an erythroid cell comprising a first exogenous polypeptide comprising a targeting agent (e.g., an anti-MAdCAM-1 antibody molecule) and a second exogenous polypeptide comprising an agonist of a target (e.g., wherein the agonist comprises IL10 and the target comprises IL10 Receptor). -
FIG. 13 is a diagram of an erythroid cell comprising a first exogenous polypeptide comprising a targeting agent (e.g., an anti-BCMA antibody molecule) and a second exogenous polypeptide comprising a capture agent. -
FIG. 14 is a diagram of an erythroid cell comprising a first exogenous polypeptide comprising a targeting agent (e.g., an AQP4 epitope) and a second exogenous polypeptide (e.g., TRAIL) that promotes a given activity, e.g., apoptosis. - As used herein, the term “antibody molecule” refers to a protein, e.g., an immunoglobulin chain or fragment thereof, comprising at least one immunoglobulin variable domain sequence. The term “antibody molecule” encompasses antibodies and antibody fragments. In an embodiment, an antibody molecule is a multispecific antibody molecule, e.g., a bispecific antibody molecule. Examples of antibody molecules include, but are not limited to, Fab, Fab′, F(ab′)2, Fv fragments, scFv antibody fragments, disulfide-linked Fvs (sdFv), a Fd fragment consisting of the VH and CH1 domains, linear antibodies, single domain antibodies such as sdAb (either VL or VH), camelid VHH domains, multi-specific antibodies formed from antibody fragments such as a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region, an isolated epitope binding fragment of an antibody, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv.
- As used herein, a “combination therapy” or “administered in combination” means that two (or more) different agents or treatments are administered to a subject as part of a treatment regimen for a particular disease or condition. The treatment regimen includes the doses and periodicity of administration of each agent such that the effects of the separate agents on the subject overlap. In some embodiments, the delivery of the two or more agents is simultaneous or concurrent and the agents may be co-formulated. In other embodiments, the two or more agents are not co-formulated and are administered in a sequential manner as part of a prescribed regimen. In some embodiments, administration of two or more agents or treatments in combination is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one agent or treatment delivered alone or in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive (e.g., synergistic). Sequential or substantially simultaneous administration of each therapeutic agent can be effected by any appropriate route including, but not limited to, oral routes, intravenous routes, intramuscular routes, and direct absorption through mucous membrane tissues. The therapeutic agents can be administered by the same route or by different routes. For example, a first therapeutic agent of the combination may be administered by intravenous injection while a second therapeutic agent of the combination may be administered orally.
- The term “coordinated” or “coordinated manner” means that a plurality of agents work together to provide a therapeutic benefit. Types of coordinated activity include agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, and compensatory activity. In an embodiment the level of therapeutic benefit conferred by a plurality of exogenous polypeptides delivered in the same enucleated RBC is greater than would be seen if each of the plurality of polypeptides were delivered from different enucleated RBCs.
- As used herein, “enucleated” refers to a cell that lacks a nucleus, e.g., a cell that lost its nucleus through differentiation into a mature red blood cell.
- As used herein, the term “exogenous polypeptide” refers to a polypeptide that is not produced by a wild-type cell of that type or is present at a lower level in a wild-type cell than in a cell containing the exogenous polypeptide. In some embodiments, an exogenous polypeptide is a polypeptide encoded by a nucleic acid that was introduced into the cell, which nucleic acid is optionally not retained by the cell.
- As used herein, the term “multimodal therapy” refers to a therapy, e.g., an enucleated red blood cell therapy, that provides a plurality (e.g., 2, 3, 4, or 5 or more) of exogenous agents (e.g., polypeptides) that have a coordinated function (e.g., agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity).
- As used herein, the term “pathway” or “biological pathway” refers to a plurality of biological molecules, e.g., polypeptides, that act together in a sequential manner. Examples of pathways include signal transduction cascades and complement cascades. In some embodiments, a pathway begins with detection of an extracellular signal and ends with a change in transcription of a target gene. In some embodiments, a pathway begins with detection of a cytoplasmic signal and ends with a change in transcription of a target gene. A pathway can be linear or branched. If branched, it can have a plurality of inputs (converging), or a plurality of outputs (diverging).
- As used herein, a “proximity-dependent” molecule refers to a first molecule that has a different, e.g., greater, activity when in proximity with a second molecule than when alone. In some embodiments, a pair of proximity-dependent ligands activates a downstream factor more strongly when the ligands are in proximity than when they are distant from each other.
- As used herein, “receptor component” refers to a polypeptide that functions as a receptor, by itself or as part of a complex. Thus a receptor component encompasses a polypeptide receptor and a polypeptide that functions as part of a receptor complex.
- The term “synergy” or “synergistic” means a more than additive effect of a combination of two or more agents (e.g., polypeptides that are part of an enucleated red blood cell) compared to their individual effects. In certain embodiments, synergistic activity is a more-than-additive effect of an enucleated red blood cell comprising a first polypeptide and a second polypeptide, compared to the effect of an enucleated red blood cell comprising the first polypeptide and an enucleated red blood cell comprising the second polypeptide. In some embodiments, synergistic activity is present when a first agent produces a detectable level of an output X, a second agent produces a detectable level of the output X, and the first and second agents together produce a more-than-additive level of the output X.
- As used herein, the term “variant” of a polypeptide refers to a polypeptide having at least one sequence difference compared to that polypeptide, e.g., one or more substitutions, insertions, or deletions. In some embodiments, the variant has at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to that polypeptide. A variant includes a fragment. In some embodiments, a fragment lacks up to 1, 2, 3, 4, 5, 10, 20, or 100 amino acids on the N-terminus, C-terminus, or both (each independently), compared to the full-length polypeptide.
- In embodiments, the red blood cell therapeutics described herein comprise one or more (e.g., 2, 3, 4, 5, 6, 10 or more) different exogenous agents, e.g., exogenous polypeptides, lipids, or small molecules. In some embodiments, a red blood cell therapeutic comprises an exogenous fusion polypeptide comprising two or more different proteins described herein. In some embodiments, an enucleated red blood cell, e.g., a reticulocyte, comprises two or more different exogenous polypeptides described herein. In some embodiments, one or more (e.g., all) of the exogenous polypeptides are human polypeptides or fragments or variants thereof.
- In some embodiments, the two or more polypeptides act on the same target, and in other embodiments, they act on two or more different targets. In some embodiments, the single target or plurality of targets is chosen from an endogenous human protein or a soluble factor (e.g., a polypeptide, small molecule, or cell-free nucleic acid).
- One or more of the exogenous proteins may have post-translational modifications characteristic of eukaryotic cells, e.g., mammalian cells, e.g., human cells. In some embodiments, one or more (e.g., 2, 3, 4, 5, or more) of the exogenous proteins are glycosylated, phosphorylated, or both. In vitro detection of glycoproteins is routinely accomplished on SDS-PAGE gels and Western Blots using a modification of Periodic acid-Schiff (PAS) methods. Cellular localization of glycoproteins may be accomplished utilizing lectin fluorescent conjugates known in the art. Phosphorylation may be assessed by Western blot using phospho-specific antibodies.
- Post-translation modifications also include conjugation to a hydrophobic group (e.g., myristoylation, palmitoylation, isoprenylation, prenylation, or glypiation), conjugation to a cofactor (e.g., lipoylation, flavin moiety (e.g., FMN or FAD), heme C attachment, phosphopantetheinylation, or retinylidene Schiff base formation), diphthamide formation, ethanolamine phosphoglycerol attachment, hypusine formation, acylation (e.g. O-acylation, N-acylation, or S-acylation), formylation, acetylation, alkylation (e.g., methylation or ethylation), amidation, butyrylation, gamma-carboxylation, malonylation, hydroxylation, iodination, nucleotide addition such as ADP-ribosylation, oxidation, phosphate ester (O-linked) or phosphoramidate (N-linked) formation, (e.g., phosphorylation or adenylylation), propionylation, pyroglutamate formation, S-glutathionylation, S-nitrosylation, succinylation, sulfation, ISGylation, SUMOylation, ubiquitination, Neddylation, or a chemical modification of an amino acid (e.g., citrullination, deamidation, eliminylation, or carbamylation), formation of a disulfide bridge, racemization (e.g., of proline, serine, alanine, or methionine). In embodiments, glycosylation includes the addition of a glycosyl group to arginine, asparagine, cysteine, hydroxylysine, serine, threonine, tyrosine, or tryptophan, resulting in a glycoprotein. In embodiments, the glycosylation comprises, e.g., O-linked glycosylation or N-linked glycosylation.
- In some embodiments, one or more of the exogenous polypeptides is a fusion protein, e.g., is a fusion with an endogenous red blood cell protein or fragment thereof, e.g., a transmembrane protein, e.g., GPA or a transmembrane fragment thereof. In some embodiments, one or more of the exogenous polypeptides is fused with a domain that promotes dimerization or multimerization, e.g., with a second fusion exogenous polypeptide, which optionally comprises a dimerization domain. In some embodiments, the dimerization domain comprises a portion of an antibody molecule, e.g., an Fc domain or CH3 domain. In some embodiments, the first and second dimerization domains comprise knob-in-hole mutations (e.g., a T366Y knob and a Y407T hole) to promote heterodimerization.
- An exemplary human polypeptide, e.g., a human polypeptide selected from any of Tables 1-6, includes:
- a) a naturally occurring form of the human polypeptide, e.g., a naturally occurring form of the human polypeptide that is not associated with a disease state;
- b) the human polypeptide having a sequence appearing in a database, e.g., GenBank database, on Jan. 11, 2017, for example a naturally occurring form of the human polypeptide that is not associated with a disease state having a sequence appearing in a database, e.g., GenBank database, on Jan. 11, 2017;
- c) a human polypeptide having a sequence that differs by no more than 1, 2, 3, 4, 5 or 10 amino acid residues from a sequence of a) or b);
- d) a human polypeptide having a sequence that differs at no more than 1, 2, 3, 4, 5 or 10% its amino acids residues from a sequence of a) or b);
- e) a human polypeptide having a sequence that does not differ substantially from a sequence of a) or b); or
- f) a human polypeptide having a sequence of c), d), or e) that does not differ substantially in a biological activity, e.g., an enzymatic activity (e.g., specificity or turnover) or binding activity (e.g., binding specificity or affinity) from a human polypeptide having the sequence of a) or b). Candidate peptides under f) can be made and screened for similar activity as described herein and would be equivalent hereunder if expressed in enucleated RBCs as described herein).
- In embodiments, an exogenous polypeptide comprises a human polypeptide or fragment thereof, e.g., all or a fragment of a human polypeptide of a), b), c), d), e), or f) of the preceding paragraph. In an embodiment, the exogenous polypeptide comprises a fusion polypeptide comprising all or a fragment of a human polypeptide of a), b), c), d), e), or f) of the preceding paragraph and additional amino acid sequence. In an embodiment the additional amino acid sequence comprises all or a fragment of human polypeptide of a), b), c), d), e), or f) of the preceding paragraph for a different human polypeptide.
- The invention contemplates that functional fragments or variants thereof (e.g., a ligand-binding fragment or variant thereof of the receptors listed in Table 1, 2 or 3 or the antigens listed in Table 4) can be made and screened for similar activity as described herein and would be equivalent hereunder if expressed in enucleated RBCs as described herein).
- In embodiments, the two or more exogenous agents (e.g., polypeptides) have related functions that are agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory, as described herein. In some embodiments, more than one of these descriptors applies to a given RBC.
- Agent-Additive Configurations
- When two or more agents (e.g., polypeptides) are agent-additive, the effect of the agents acting together is greater than the effect of either agent acting alone. In an embodiment, two agents have different (e.g., complementary) functions in the RBC (e.g., on the RBC surface) and act together to have a stronger effect (compared to either of the agents acting alone), e.g., a higher binding affinity for the target, or a greater degree of modulation of signal transduction by the target, e.g., a single target. In some embodiments, two or more agents each bind to the same target, e.g., to different epitopes within the same target protein.
- In an embodiment the agents associate with one another, e.g., are members of a heterodimeric complex. In an embodiment, the agents have greater avidity for a target when acting together than when acting alone.
- In some embodiments, the two or more agents enable tighter binding to a target than either agent alone. In some embodiments, a heterodimer of receptor components, e.g., cytokine receptor components, e.g., interleukin receptor components, e.g., IL-1 receptor components, bind to a target, e.g., IL-1, with higher affinity than either receptor component alone. Many signaling molecules form heterodimers or heteromultimers on the cell surface to bind to their ligand. Cytokine receptors, for example, can be heterodimers or heteromultimers. For instance, IL-2 receptor comprises three different molecules: IL2Ra, IL2Rb, and IL2Rg. The IL-13 receptor is a heterodimer of IL13Ra and IL4R. The IL-23 receptor is a heterodimer of IL23R and IL12Rb1. The TNFa receptor is, in embodiments, a heterodimer of TNFR1 and TNFR2. Without wishing to be bound by theory, in some instances of disease, for example in inflammatory diseases or sepsis, it may be desirous to bind and clear a cytokine from circulation. In embodiments, this is achieved by administering a red blood cell (e.g., a reticulocyte) that expresses one or more (e.g., 2 or 3) of the receptors for the target molecule simultaneously. For example, for the treatment of psoriasis, a red blood cell (e.g., a reticulocyte) engineered to express IL23R and IL12Rb1 binds and sequesters IL-23, an inflammatory mediator of the disease. A table of cytokines and their receptors is provided herein as Table 1. In some embodiments the agents are antibody molecules that bind cytokines, e.g., one or more cytokines of Table 1. In some embodiments, an enucleated RBC comprises one or more (e.g., 2, 3, 4, 5, or more) cytokine receptor subunits from Table 1 or cytokine-binding variants or fragments thereof. In some embodiments, an enucleated RBC comprises two or three (e.g., all) cytokine receptor subunits from a single row of Table 1 or cytokine-binding variants or functional fragments thereof. The cytokine receptors can be present on the surface of the RBC. The expressed receptors typically have the wild type human receptor sequence or a variant or fragment thereof that is able to bind and sequester its target ligand. In embodiments, two or more cytokine receptor subunits are linked to each other, e.g., as a fusion protein.
- In some embodiments the first polypeptide comprises a cytokine or fragment or variant thereof, e.g., a cytokine of Table 1 or a fragment or variant thereof. In embodiments, the second polypeptide comprises a second cytokine or fragment or variant thereof, e.g., a cytokine of Table 1 or a fragment or variant thereof. In embodiments, one or more (e.g., 2 or all) of the cytokines are fused to transmembrane domains (e.g., a GPA transmembrane domain or other transmembrane domain described herein), e.g., such that the cytokine is on the surface of the erythroid cell. In embodiments, the erythroid cell further comprises a targeting moiety, e.g., a targeting moiety described in
FIG. 12 herein or the section herein entitled “Localization Configurations.” In some embodiments, an erythroid cell comprising a plurality of cytokines is used to treat an autoimmune disease, e.g., SLE. -
TABLE 1 Cytokines and Receptors Name Cytokine Receptor(s)(Da) and Form Interleukins IL-1-like IL-1α CD121a, CDw121b IL-1β CD121a, CDw121b IL-1RA CD121a IL-18 IL-18Rα, β Common g chain (CD132) IL-2 CD25, 122, 132 IL-4 CD124, 213a13, 132 IL-7 CD127, 132 IL-9 IL-9R, CD132 IL-13 CD213a1, 213a2, IL-15 IL-15Ra, CD122, 132 Common b chain (CD131) IL-3 CD123, CDw131 IL-5 CDw125, 131 Also related GM-CSF CD116, CDw131 IL-6-like IL-6 CD126, 130 IL-11 IL-11Ra, CD130 Also related G-CSF CD114 IL-12 CD212 LIF LIFR, CD130 OSM OSMR, CD130 IL-10-like IL-10 CDw210 IL-20 IL-20Rα, β Others IL-14 IL-14R IL-16 CD4 IL-17 CDw217 Interferons IFN-α CD118 IFN-β CD118 IFN-γ CDw119 TNF CD154 CD40 LT-β LTβR TNF-α CD120a, b TNF-β (LT-α) CD120a, b 4-1BBL CD137 (4-1BB) APRIL BCMA, TACI CD70 CD27 CD153 CD30 CD178 CD95 (Fas) GITRL GITR LIGHT LTbR, HVEM OX40L OX40 TALL-1 BCMA, TACI TRAIL TRAILR1-4 TWEAK Apo3 TRANCE RANK, OPG TGF-β TGF-β1 TGF-βR1 TGF-β2 TGF-βR2 TGF-β3 TGF-βR3 Miscellaneous hematopoietins Epo EpoR Tpo TpoR Flt-3L Flt-3 SCF CD 117 M-CSF CD115 MSP CDw136 - In some embodiments the agents are different antibody-binding molecules, e.g., Fc-binding molecules, for the capture of antibodies in circulation. In embodiments, the agents are non-competitive with one another to enable higher affinity binding of individual antibodies or opsonized particles. For example, in embodiments, one or more agent is chosen from protein A, Fc receptor 1 (FcR1), FcR2a, FcR2b, FcR3, FcR4, FcRn (neonatal Fc receptor) or an antibody-binding fragment or variant thereof. In embodiments, one or more agent is chosen from an autoantigen or autoantibody-binding fragments or variants thereof, or an anti-idiotypic antibody molecule that binds autoantibodies. In embodiments, the enucleated RBC is used to treat an autoimmune disease.
- An enucleated erythroid cell can comprise a first exogenous polypeptide (e.g., an autoantigen) that interacts with a target (e.g., an autoantibody) and a second exogenous polypeptide (e.g., a protease, e.g., IdeS) that modifies the target. In embodiments, the erythroid cell is administered to a subject, e.g., a subject having an autoimmune disorder of Table 4.
- In embodiments, an effective amount of the enucleated erythroid cells comprising a first exogenous polypeptide and a second exogenous polypeptide is less than (e.g., less by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, 99.5%, 99.9%, or 99.99%) an effective amount of otherwise similar enucleated erythroid cells that lack the first exogenous polypeptide or lack the second exogenous polypeptide. In embodiments, the preselected amount is an effective dose or an in vitro effective amount of enucleated erythroid cells. In embodiments, the preselected amount (e.g., in vitro effective amount) is an amount that is effective in an assay, e.g., to convert at least 10%, 20%, 30%, 405, 50%, 60%, 70%, 80%, or 90% of substrate into produce in a preselected amount of time, e.g., 1, 2, 3, 4, 5, or 6 hours. In embodiments, the preselected amount (e.g., in vitro effective amount) is effective to cleave at least 50% of a target antibody in 5 hours. The assay may measure, e.g., reduction in levels of soluble, unmodified (e.g., non-cleaved) target in a solution.
- In embodiments, the reference value for targets is the number of targets in the peripheral blood of the subject at the time of administration. In embodiments (e.g., embodiments involving an in vitro effective amount of cells) the reference value for targets is the number of targets in a reaction mixture for an assay.
- First Exogenous Polypeptide (e.g., Autoantigen)
- The first exogenous polypeptide can bind a target. In embodiments, the first exogenous polypeptide comprises a binding domain that recognizes an antibody, e.g., an autoantibody. In embodiments, the first domain comprises an autoantigen, e.g., comprises a full length protein or a fragment thereof that binds an autoantibody. In embodiments, the first exogenous polypeptide comprises an autoantigen from a protein of Table 4, e.g., comprises a full length protein or a fragment thereof that binds an autoantibody.
- In embodiments, the first exogenous polypeptide comprises a binding domain (e.g., an autoantigen capable of binding an autoantibody) and a membrane anchor domain (e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain). In embodiments, the membrane anchor domain is C-terminal or N-terminal of the modifier (e.g., protease) domain. In embodiments, the transmembrane domain comprises GPA or a transmembrane portion thereof, e.g., as set out in SEQ ID NO: 9 herein or a transmembrane portion thereof, or a polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing. In embodiments, the GPA polypeptide is C-terminal of the binding domain.
- In embodiments, the first exogenous polypeptide comprises an address moiety or targeting moiety described in WO2007030708, e.g., in pages 34-45 therein, which application is herein incorporated by reference in its entirety.
- Other examples of proteins that can be suitably adapted for use as the first exogenous polypeptide include ligand binding domains of receptors, such as where the target is the receptor ligand. Conversely, the first exogenous polypeptide can comprise a receptor ligand where the target is the receptor. A target ligand can be a polypeptide or a small molecule ligand.
- In a further embodiment, a first exogenous polypeptide may comprise a domain derived from a polypeptide that has an immunoglobulin-like fold, such as the 10th type III domain of human fibronectin (“Fn3”). See U.S. Pat. Nos. 6,673,901; 6,462,189. Fn3 is small (about 95 residues), monomeric, soluble and stable. It does not have disulfide bonds which permit improved stability in reducing environments. The structure may be described as a beta-sandwich similar to that of Ab VH domain except that Fn3 has seven beta-strands instead of nine. There are three loops on each end of Fn3; and the positions of three of these loops correspond to those of CDR1, 2 and 3 of the VH domain. The 94 amino acid Fn3 sequence is:
-
(SEQ ID NO: 18) VSDVPRDLEWAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVP GSKSTATISGLKPGVDYTITGYAVTGRGDSPASSKPISINYRT - The amino acid positions of the CDR-like loops will be defined as residues 23-30 (BC Loop), 52-56 (DE Loop) and 77-87 (FG Loop). Accordingly, one or more of the CDR-like loops may be modified or randomized, to generate a library of Fn3 binding domains which may then be screened for binding to a desired address binding site. See also PCT Publication WO0232925. Fn3 is an example of a large subfamily of the immunoglobulin superfamily (IgSF). The Fn3 family includes cell adhesion molecules, cell surface hormone and cytokine receptors, chaperonin, and carbohydrate-binding domains, all of which may also be adapted for use as binding agents. Additionally, the structure of the DNA binding domains of the transcription factor NF-kB is also closely related to the Fn3 fold and may also be adapted for use as a binding agent. Similarly, serum albumin, such as human serum albumin contains an immunoglobulin-like fold that can be adapted for use as a targeting moiety.
- In still other embodiments, the first exogenous polypeptide can comprise an engineered polypeptide sequence that was selected, e.g., synthetically evolved, based on its kinetics and selectivity for binding to the address site. In embodiments, the sequence of the first exogenous polypeptide is designed using a screen or selection method, e.g., by phage display or yeast two-hybrid screen.
- In some embodiments, the first exogenous polypeptide comprises a peptide ligand for a soluble receptor (and optionally the target comprises a soluble receptor), a synthetic peptide that binds a target, a complement regulatory domain (and optionally the target comprises a complement factor), or a ligand for a cell surface receptor (and optionally the target comprises the cell surface receptor).
- Second Exogenous Polypeptide (e.g., Protease)
- In embodiments, the second exogenous polypeptide (which modifies the target) is a factor set out in Table 5. In some embodiments, the protease is a protease set out in Table 5. In embodiments, the protease is a bacterial protease, a human protease, or a plant protease, or a fragment or variant thereof.
- In embodiments, the second exogenous polypeptide (which modifies the target) is a protease. Exemplary proteases include those classified as Aminopeptidases; Dipeptidases; Dipeptidyl-peptidases and tripeptidyl peptidases; Peptidyl-dipeptidases; Serine-type carboxypeptidases; Metallocarboxypeptidases; Cysteine-type carboxypeptidases; Omegapeptidases; Serine proteinases; Cysteine proteinases; Aspartic proteinases; Metalloproteinases; or Proteinases of unknown mechanism.
- Aminopeptidases include cytosol aminopeptidase (leucyl aminopeptidase), membrane alanyl aminopeptidase, cystinyl aminopeptidase, tripeptide aminopeptidase, prolyl aminopeptidase, arginyl aminopeptidase, glutamyl aminopeptidase, x-pro aminopeptidase, bacterial leucyl aminopeptidase, thermophilic aminopeptidase, clostridial aminopeptidase, cytosol alanyl aminopeptidase, lysyl aminopeptidase, x-trp aminopeptidase, tryptophanyl aminopeptidase, methionyl aminopeptidase, d-stereospecific aminopeptidase, and aminopeptidase. Dipeptidases include x-his dipeptidase, x-arg dipeptidase, x-methyl-his dipeptidase, cys-gly dipeptidase, glu-glu dipeptidase, pro-x dipeptidase, x-pro dipeptidase, met-x dipeptidase, non-stereospecific dipeptidase, cytosol non-specific dipeptidase, membrane dipeptidase, and beta-ala-his dipeptidase. Dipeptidyl-peptidases and tripeptidyl peptidases include dipeptidyl-peptidase I, dipeptidyl-peptidase II, dipeptidyl peptidase III, dipeptidyl-peptidase IV, dipeptidyl-dipeptidase, tripeptidyl-peptidase I, and tripeptidyl-peptidase II. Peptidyl-dipeptidases include peptidyl-dipeptidase A and peptidyl-dipeptidase B. Serine-type carboxypeptidases include lysosomal pro-x carboxypeptidase, serine-type D-ala-D-ala carboxypeptidase, carboxypeptidase C, and carboxypeptidase D. Metallocarboxypeptidases include carboxypeptidase A, carboxypeptidase B, lysine(arginine) carboxypeptidase, gly-X carboxypeptidase, alanine carboxypeptidase, muramoylpentapeptide carboxypeptidase, carboxypeptidase H, glutamate carboxypeptidase, carboxypeptidase M, muramoyltetrapeptide carboxypeptidase, zinc D-ala-D-ala carboxypeptidase, carboxypeptidase A2, membrane pro-x carboxypeptidase, tubulinyl-tyr carboxypeptidase, and carboxypeptidase T. Omegapeptidases include acylaminoacyl-peptidase, peptidyl-glycinamidase, pyroglutamyl-peptidase I, beta-aspartyl-peptidase, pyroglutamyl-peptidase II, n-formylmethionyl-peptidase, pteroylpoly-[gamma]-glutamate carboxypeptidase, gamma-glu-X carboxypeptidase, and acylmuramoyl-ala peptidase. Serine proteinases include chymotrypsin, chymotrypsin C, metridin, trypsin, thrombin, coagulation factor Xa, plasmin, enteropeptidase, acrosin, alpha-lytic protease, glutamyl, endopeptidase, cathepsin G, coagulation factor VIIa, coagulation factor IXa, cucumisi, prolyl oligopeptidase, coagulation factor XIa, brachyurin, plasma kallikrein, tissue kallikrein, pancreatic elastase, leukocyte elastase, coagulation factor XIIa, chymase, complement component c1r55, complement component c1s55, classical-complement pathway c3/c5 convertase, complement factor I, complement factor D, alternative-complement pathway c3/c5 convertase, cerevisin, hypodermin C, lysyl endopeptidase, endopeptidase la, gamma-reni, venombin AB, leucyl endopeptidase, tryptase, scutelarin, kexin, subtilisin, oryzin, endopeptidase K, thermomycolin, thermitase, endopeptidase SO, T-plasminogen activator, protein C, pancreatic endopeptidase E, pancreatic elastase II, IGA-specific serine endopeptidase, U-plasminogen, activator, venombin A, furin, myeloblastin, semenogelase, granzyme A or cytotoxic T-
lymphocyte proteinase 1, granzyme B or cytotoxic T-lymphocyte proteinase 2, streptogrisin A, treptogrisin B, glutamyl endopeptidase II, oligopeptidase B, limulus clotting factor C, limulus clotting factor, limulus clotting enzyme, omptin, repressor lexa, bacterial leader peptidase I, and togavirin, flavirin. Cysteine proteinases include cathepsin B, papain, ficin, chymopapain, asclepain, clostripain, streptopain, actinide,cathepsin 1, cathepsin H, calpain, cathepsin T, glycyl, endopeptidase, cancer procoagulant, cathepsin S, picornain 3C, picornain 2A, caricain, ananain, stem bromelain, fruit bromelain, legumain, histolysain, and interleukin 1-beta converting enzyme. Aspartic proteinases include pepsin A, pepsin B, gastricsin, chymosin, cathepsin D, neopenthesin, renin, retropepsin, pro-opiomelanocortin converting enzyme, aspergillopepsin I, aspergillopepsin II, penicillopepsin, rhizopuspepsin, endothiapepsin, mucoropepsin, candidapepsin, saccharopepsin, rhodotorulapepsin, physaropepsin, acrocylindropepsin, polyporopepsin, pycnoporopepsin, scytalidopepsin A, scytalidopepsin B, xanthomonapepsin, cathepsin E, barrierpepsin, bacterial leader peptidase I, pseudomonapepsin, and plasmepsin. Metalloproteinases include atrolysin A, microbial collagenase, leucolysin, interstitial collagenase, neprilysin, envelysin, IgA-specific metalloendopeptidase, procollagen N-endopeptidase, thimet oligopeptidase, neurolysin,stromelysin 1, meprin A, procollagen C-endopeptidase, peptidyl-lys metalloendopeptidase, astacin, stromelysin 2, matrilysin gelatinase, aeromonolysin, pseudolysin, thermolysin, bacillolysin, aureolysin, coccolysin, mycolysin, beta-lytic metalloendopeptidase, peptidyl-asp metalloendopeptidase, neutrophil collagenase, gelatinase B, leishmanolysin, saccharolysin, autolysin, deuterolysin, serralysin, atrolysin B, atrolysin C, atroxase, atrolysin E, atrolysin F, adamalysin, horrilysin, ruberlysin, bothropasin, bothrolysin, ophiolysin, trimerelysin I, trimerelysin II, mucrolysin, pitrilysin, insulysin, O-syaloglycoprotein endopeptidase, russellysin, mitochondrial, intermediate, peptidase, dactylysin, nardilysin, magnolysin, meprin B, mitochondrial processing peptidase, macrophage elastase, choriolysin, and toxilysin. Proteinases of unknown mechanism include thermopsin and multicatalytic endopeptidase complex. In embodiments, the second exogenous polypeptide comprises a fragment or variant of any of the foregoing. - In embodiments, the second exogenous polypeptide comprises an IdeS polypeptide. In some embodiments, the IdeS polypeptide comprises the sequence set out below as SEQ ID NO: 8 or a proteolytically active fragment of the sequence of SEQ ID NO: 8 (e.g., a fragment of at least 100, 150, 200, 250, or 300 amino acids) or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing. In some embodiments involving nucleic acids, the nucleic acid encodes an IdeS polypeptide having the sequence set out below as SEQ ID NO: 8, or a proteolytically active fragment thereof, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing.
- IdeS Polypeptide:
-
(SEQ ID NO: 8) DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGW YDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMF GDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDM FINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDF KEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNL KAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFT LSTGQDSWNQTN - In embodiments, the second exogenous polypeptide comprises a modifier domain (e.g., a protease domain, e.g., an IdeS polypeptide) and a membrane anchor domain (e.g., a transmembrane domain, e.g., type I or type II red blood cell transmembrane domain). In embodiments, the membrane anchor domain is C-terminal or N-terminal of the modifier (e.g., protease) domain. In embodiments, the transmembrane domain comprises GPA or a transmembrane portion thereof. In embodiments, the GPA polypeptide has a sequence of:
-
(SEQ ID NO: 9) LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRT VYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIK KSPSDVKPLPSPDTDVPLSSVEIENPETSDQ - or a transmembrane portion thereof, or a polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity to any of the foregoing. In embodiments, the GPA polypeptide is C-terminal of the modifier (e.g., protease) domain.
- In some embodiments, a linker is disposed between the IdeS polypeptide and the transmembrane polypeptide, e.g., a glycine-serine linker, e.g., a linker comprising a sequence of GGSGGSGG (SEQ ID NO: 10) and/or GGGSGGGS (SEQ ID NO: 11).
- In some embodiments, the exogenous polypeptide, e.g., the second exogenous polypeptide, e.g., a protease, e.g., IdeS polypeptide, comprises a leader sequence, e.g., a GPA leader sequence, e.g., MYGKIIFVLLLSEIVSISA (SEQ ID NO: 12).
- In some embodiments, the exogenous polypeptide, e.g., the second exogenous polypeptide further comprises a tag, e.g., an HA tag or a FLAG tag.
- In some embodiments, the protease (e.g., immunoglobulin degrading enzyme, e.g., immunoglobulin-G degrading enzyme, e.g., IdeS) cleaves an immunoglobulin at a hinge region, a CH2 region, or between a hinge and CH2 region. In embodiments, the protease cleaves an immunoglobulin at one of the sequences below, e.g., between the two italicized glycines or the italicized alanine and glycine in the sequences below.
-
(SEQ ID NO: 13) Human IgG1 Hinge/CH2 Sequence CPPCPAPELLGGPSVF (SEQ ID NO: 14) Human IgG2 Hinge/CH2 Sequence CPPCPAPPVAGPSVF (SEQ ID NO: 15) Human IgG3 Hinge/CH2 Sequence CPRCPAPELLGGPSVF (SEQ ID NO: 16) Human IgG4 Hinge/CH2 Sequence AHHAQAPEFLGGPSVF - In embodiments, the protease (e.g., a bacterial protease) cleaves IgG, e.g., IdeS or IgA protease.
- In embodiments, the protease (e.g., a papain family protease, e.g., papain) cleaves an immunoglobulin between the Fc and Fab regions, e.g., a histidine-threonine bond between positions 224 and 225 of the heavy chain and/or a glutamic acid-leucine bond between positions 233 and 234 of the heavy chain.
- In embodiments, the protease or other modifier acts on a target listed in Table 5 or Table 6.
- In embodiments, the protease or other modifier acts on (e.g., inactivates or inhibits) a TNF molecule (such as TNF-alpha), e.g., in a subject having sepsis, e.g. bacterial sepsis. For instance, the first exogenous polypeptide can comprise a TNF-alpha binding moiety such as an anti-TNF-alpha antibody, and the second exogenous polypeptide can comprise a protease that cleaves TNF-alpha, e.g., MT1-MMP, MMP12, tryptase, MT2-MMP, elastase, MMPI, chymotrypsin, or trypsin, or active variants or fragments thereof.
- In embodiments, the second exogenous polypeptide comprises a catalytic moiety described in WO2007030708, e.g., in pages 45-46 therein, which application is herein incorporated by reference in its entirety.
- The second exogenous polypeptide can comprise a moiety capable of acting on a target to induce a chemical change, thereby modulate its activity, e.g., a moiety capable of catalyzing a reaction within a target. The second exogenous polypeptide can comprise a naturally occurring enzyme, an active (e.g., catalytically active) fragment thereof, or an engineered enzyme, e.g., a protein engineered to have an enzymatic activity, such as a protein designed to contain a serine protease active motif. A catalytic domain of a second exogenous polypeptide may comprise the arrangement of amino acids that are effective to induce the desired chemical change in the target. They may be N- terminal or C-terminal truncated versions of natural enzymes, mutated versions, zymogens, or complete globular domains.
- The second exogenous polypeptide can comprise an enzymatically active site that alone is promiscuous, binding with a cleavage site it recognizes on many different biomolecules, and may have relatively poor reaction kinetics. In embodiments, the first exogenous polypeptide supplies or improves specificity by increasing the local concentration of target near the second exogenous polypeptide.
- The second exogenous polypeptide can, in embodiments, modify the target so that it is recognized and acted upon by another enzyme (e.g., an enzyme that is already present in a subject). In an embodiment, the second exogenous polypeptide comprises a moiety that alters the structure of the target so that its activity is inhibited or upregulated. Many naturally occurring enzymes activate other enzymes, and these can be exploited in accordance with the compositions and methods described herein.
- The second exogenous polypeptide can comprise a protease, a glycosidase, a lipase, or other hydrolases, an amidase (e.g., N-acetylmuramoyl-L-alanine amidase, PGRP-L amidase), or other enzymatic activity, including isomerases, transferases (including kinases), lyases, oxidoreductases, oxidases, aldolases, ketolases, glycosidases, transferases and the like. In embodiments, the second exogenous polypeptide comprises human lysozyme, a functional portion of a human lysozyme, a human PGRP-L, a functional portion of a human PGRP-L, a phospholipase A2, a functional portion of a phospholipase A2, or a matrix metalloproteinase (MMP) extracellular enzyme such as MMP-2 (gelatinase A) or MMP-9 (gelatinase B).
- In embodiments, the second exogenous polypeptide is a serine proteinase, e.g., of the chymotrypsin family which includes the mammalian enzymes such as chymotrypsin, trypsin or elastase or kallikrein, or the substilisin family which includes the bacterial enzymes such as subtilisin. The general three-dimensional structure is different in the two families but they have the same active site geometry and catalysis proceeds via the same mechanism. The serine proteinases exhibit different substrate specificities which are related to amino acid substitutions in the various enzyme subsites interacting with the substrate residues. Three residues which form the catalytic triad are important in the catalytic process: His-57, Asp-102 and Ser-195 (chymotrypsinogen numbering).
- In embodiments, the second exogenous polypeptide is a cysteine proteinase which includes the plant proteases such as papain, actinidin or bromelain, several mammalian lysosomal cathepsins, the cytosolic calpains (calcium-activated), and several parasitic proteases (e.g., Trypanosoma, Schistosoma). Papain is the archetype and the best studied member of the family. Like the serine proteinases, catalysis proceeds through the formation of a covalent intermediate and involves a cysteine and a histidine residue. The essential Cys-25 and His-159 (papain numbering) play the same role as Ser-195 and His-57 respectively. The nucleophile is a thiolate ion rather than a hydroxyl group. The thiolate ion is stabilized through the formation of an ion pair with neighboring imidazolium group of His-159. The attacking nucleophile is the thiolate-imidazolium ion pair in both steps and then a water molecule is not required.
- In embodiments, the second exogenous polypeptide is an aspartic proteinase, most of which belong to the pepsin family. The pepsin family includes digestive enzymes such as pepsin and chymosin as well as lysosomal cathepsins D, processing enzymes such as renin, and certain fungal proteases (penicillopepsin, rhizopuspepsin, endothiapepsin). A second family comprises viral proteinases such as the protease from the AIDS vims (HIV) also called retropepsin. In contrast to serine and cysteine proteinases, catalysis by aspartic proteinases does not involve a covalent intermediate, though a tetrahedral intermediate exists. The nucleophilic attack is achieved by two simultaneous proton transfers: one from a water molecule to the dyad of the two carboxyl groups and a second one from the dyad to the carbonyl oxygen of the substrate with the concurrent CO—NH bond cleavage. This general acid-base catalysis, which may be called a “push-pull” mechanism leads to the formation of a non-covalent neutral tetrahedral intermediate.
- In embodiments, the second exogenous polypeptide is a metalloproteinase, which can be found in bacteria, fungi as well as in higher organisms. They differ widely in their sequences and their structures but the great majority of enzymes contain a zinc (Zn) atom which is catalytically active. In some cases, zinc may be replaced by another metal such as cobalt or nickel without loss of the activity. Bacterial thermolysin has been well characterized and its crystallographic structure indicates that zinc is bound by two histidines and one glutamic acid. Many enzymes contain the sequence HEXXH, which provides two histidine ligands for the zinc whereas the third ligand is either a glutamic acid (thermolysin, neprilysin, alanyl aminopeptidase) or a histidine (astacin). Other families exhibit a distinct mode of binding of the Zn atom. The catalytic mechanism leads to the formation of a non-covalent tetrahedral intermediate after the attack of a zinc-bound water molecule on the carbonyl group of the scissile bond. This intermediate is further decomposed by transfer of the glutamic acid proton to the leaving group.
- In embodiments, the second exogenous polypeptide comprises an isomerase (e.g., an isomerase that breaks and forms chemical bonds or catalyzes a conformational change). In embodiments, the isomerase is a racemase (e.g., amino acid racemase), epimerase, cis-trans isomerase, intramolecular oxidoreductase, intramolecular transferase, or intramolecular lyase.
- In embodiments, the second exogenous protease comprises a chaperone, or an active variant or fragment thereof. For instance, the chaperone can be a general chaperone (e.g., GRP78/BiP, GRP94, GRP170), a lectin chaperone (e.g., calnexin or calreticulin), a non-classical molecular chaperone (e.g., HSP47 or ERp29), a folding chaperone (e.g., PDI, PPI, or ERp57), a bacterial or archaeal chaperone (e.g., Hsp60, GroEL/GroES complex, Hsp70, DnaK, Hsp90, HtpG, Hsp100, C1p family (e.g., C1pA and C1pX), Hsp104). In embodiments, the enucleated erythrocyte comprises a co-chaperone, or an active variant or fragment thereof, e.g., immunophilin, Stil, p50 (Cdc37), or Ahal. In embodiments, the molecular chaperone is a chaperonin.
- Candidates for the second exogenous protein (which modifies a target) can be screened based on their activity. Depending on the specific activity of each molecule being tested, an assay appropriate for that molecule can be used. For example, if the second exogenous protein is a protease, the assay used to screen the protease can be an assay to detect cleavage products generated by the protease, e.g., a chromatography or gel electrophoresis based assay.
- In an example, the second exogenous polypeptide may have kinase activity. An assay for kinase activity could measure the amount of phosphate that is covalently incorporated into the target of interest. For example, the phosphate incorporated into the target of interest could be a radioisotope of phosphate that can be quantitated by measuring the emission of radiation using a scintillation counter.
- Targets (e.g., Antibodies or Complement Pathway Factors) and Indications
- In embodiments, the target is a target listed in Table 5 or Table 6.
- In embodiments, the target is an immune checkpoint molecule selected from PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 or TGF beta. In embodiments, the target is an inhibitory ligand listed in Table 3, and the first exogenous polypeptide optionally comprises a binding domain from a corresponding target receptor of Table 3. In some embodiments, the target is a target receptor of Table 3, and the first exogenous polypeptide optionally comprises a binding domain from a corresponding inhibitory ligand of Table 3. In some embodiments, the second exogenous polypeptide comprises a protease that cleaves an immune checkpoint molecule, e.g., trypsin. In embodiments, e.g., for treating an autoimmune disease, a T cell is inhibited, e.g., by contacting its receptor (e.g., a receptor of Table 3) with an inhibitory ligand of Table 3.
- In embodiments, the target is an antibody e.g., a human antibody. The antibody can be, e.g., an autoantibody. The antibody can be, e.g., IgA, IgD, IgE, IgG (e.g., IgG1, IgG2, IgG3, or IgG4), or IgM. In embodiments, the target is an autoantibody that binds an autoantigen of Table 4. In embodiments, the target is an anti-AQP4 autoantibody, wherein the first exogenous polypeptide binds an anti-AQP4 autoantibody and the second polypeptide cleaves the autoantibody (e.g., comprises an IdeS polypeptide), e.g., for treating Neuromyelitis optica. In embodiments, the target is an anti-PLA2R autoantibody, wherein the first exogenous polypeptide binds an anti-PLA2R autoantibody and the second polypeptide cleaves the autoantibody (e.g., comprises an IdeS polypeptide), e.g., for treating membranous nephropathy.
- In embodiments, the target is a complement factor, e.g., a factor that acts in the classical complement pathway or the alternative complement pathway. In embodiments, the complement factor is a pro-protein or an activated (e.g., cleaved) protein. In embodiments, the complement factor comprises C1, C2a, C4b, C3, C3a, C3b, C5, C5a, C5b, C6, C7, C8, or C9. In embodiments, the second exogenous polypeptide cleaves the complement factor. In embodiments, the second exogenous polypeptide activates the complement factor, e.g., to promote an immune response. For instance, the second exogenous polypeptide may comprise a complement control protein and/or complement activation family protein such as Factor H or Factor I (which promote C3b cleavage), or a fragment or variant thereof. In embodiments, the second exogenous polypeptide inactivates the complement factor, e.g., by cleaving it to yield one or more inactive fragments, e.g., to reduce an unwanted immune response, e.g., to treat an autoimmune or inflammatory disease. In embodiments, the first exogenous polypeptide binds a complement factor (e.g., binds complement factor C3b) and the second exogenous polypeptide cleaves the complement factor, e.g., to iC3b. For instance, the first exogenous polypeptide could comprise Factor H or CR1 or a fragment or variant thereof and the second exogenous polypeptide could comprise Factor I or a fragment or variant thereof.
- Engineered erythroid cells described herein can also be used to treat a subject that has antibodies against a drug (e.g., see
FIG. 7 ). The erythroid cell can reduce levels of anti-drug antibodies in a subject, and can optionally further comprise a therapeutic protein that treats the disease. For instance, the erythroid cell comprises a first exogenous polypeptide that binds a target, e.g., wherein the target is an anti-drug antibody. The erythroid cell can further comprise a second exogenous polypeptide (e.g., IdeS, or a fragment or variant thereof) that inactivates, e.g., cleaves the target. The erythroid cell may optionally further comprise a third exogenous polypeptide, e.g., a therapeutic protein that treats the same disease as the prior therapeutic to which the subject developed anti-drug antibodies, e.g., a therapeutic protein which is the same as or different from the prior therapeutic to which the subject developed anti-drug antibodies. In embodiments, the subject comprises anti-drug antibodies against erythropoietin, an anti-TNF antibody molecule (adalimumab or infliximab), an anti-EGFR antibody (e.g., cetuximab), an anti-CD20 antibody molecule, insulin, an anti-alpha4 integrin antibody molecule (e.g., natalizumab), or an interferon e.g. IFNβ1a or IFNβ1b. In embodiments, the first polypeptide comprises an anti-MAdCAM-1 antibody molecule and the second polypeptide comprises LysC or LysN (which can cleave MAdCAM-1 at 1 or more (e.g., 2, 3, or 4 sites), or a fragment or variant thereof having protease activity, e.g., wherein the target tissue is inflamed gut or liver tissue. In such methods of treatment, the patient may be tested for the presence of anti-drug antibodies, e.g., for the presence of neutralizing anti-drug antibodies, before, during and/or after administration of the engineered erythroid cells described herein. - Agent-Synergistic Configurations
- When two or more agents (e.g., polypeptides) are agent-synergistic, the agents act on two or more different targets within a single pathway. In an embodiment, the action of the two or more agents together is greater than the action of any of the individual agents. For example, the first and second polypeptides are ligands for cellular receptors that signal to the same downstream target. For example, the first exogenous polypeptide comprises a ligand for a first target cellular receptor, and the second exogenous polypeptide comprises a ligand for a second target cellular receptor, e.g., which first and second target cellular receptors signal to the same downstream target. In embodiments, the first exogenous polypeptide acts on the first target and the second exogenous polypeptide acts on the second target simultaneously, e.g., there is some temporal overlap in binding of the first exogenous polypeptide to the first target and binding of the second exogenous polypeptide to the second target. In some embodiments the simultaneous action generates a synergistic response of greater magnitude than would be expected when either target is acted on alone or in isolation.
- In an embodiment, the first and second polypeptides are ligands for a first cellular receptor and a second cellular receptor that mediates apoptosis. In an embodiment the agents comprise two or more TRAIL receptor ligands, e.g., wild-type or mutant TRAIL polypeptides, or antibody molecules that bind TRAIL receptors, and induce apoptosis in a target cell, e.g., an autoreactive T cell. In some embodiments, a RBC comprising TRAIL receptor ligands further comprises a targeting moiety, e.g., a targeting moiety described herein. In an embodiment the first target and the second target interacts with the same substrate, e.g., a substrate protein. In an embodiment the first target and the second target interact with different substrates.
- TRAIL (TNF-related apoptosis inducing ligand) is a member of the TNF family that induces apoptosis. TRAIL has at least two receptors, TRAIL R1 and TRAIL R2. TRAIL receptor agonists, e.g., mutants of TRAIL that bind one or more of the receptors, or antibody molecules that bind one or both of TRAIL R1 or TRAIL R2 (see, e.g. Gasparian et al., Apoptosis 2009 Jun. 14(6), Buchsbaum et al. Future Oncol 2007 Aug. 3(4)), have been developed as a clinical therapy for a wide range of cancers. Clinical trials of TRAIL receptor agonists have failed for, among other reasons, the fact that many primary cancers are not sensitive to signaling through a single receptor but rather require engagement of both receptors to induce cytotoxicity (Marconi et al., Cell Death and Disease (2013) 4, e863). In one embodiment the agents expressed on the engineered blood cell are single receptor-specific TRAIL agonists that, in combination, enable the cell to engage and agonize both TRAIL receptors simultaneously, thus leading to a synergistic induction of apoptosis of a target cell. Thus, in some embodiments, the enucleated red blood cell (e.g., reticulocyte) comprises on its surface a first polypeptide that binds TRAIL R1 and a second polypeptide that binds TRAIL R2. In embodiments, each polypeptide has a Kd for TRAIL R1 or TRAIL R2 that is 2, 3, 4, 5, 10, 20, 50, 100, 200, or 500-fold stronger than the Kd for the other receptor. While not wishing to be bound by theory, in some embodiments an enucleated red blood cell comprising a TRAIL R1-specific ligand and a TRAIL R2-specific ligand promote better heterodimerization of TRAIL R1 and TRAIL R2 than an enucleated red blood cell comprising a ligand that binds to TRAIL R1 and TRAIL R2 with about the same affinity.
- In some embodiments, one, two, or more of the exogenous polypeptides are members of the TNF superfamily. In some embodiments, the exogenous polypeptides bind to one or both of death receptors DR4 (TRAIL-R1) and DR5 (TRAIL-R2). In some embodiments, the exogenous polypeptides bind to one or more of TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, or TNFRSF11B/OPG. In some embodiments, the exogenous polypeptides activate one or more of MAPK8/JNK, caspase 8, and caspase 3.
- In some embodiments, a TRAIL polypeptide is a TRAIL agonist having a sequence of any of SEQ ID NOS: 1-5 herein, or a sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. Sequence identity is measured, e.g., by BLAST (Basic Local Alignment Search Tool). SEQ ID Nos. 1-5 are further described in Mohr et al. BMC Cancer (2015) 15:494), which is herein incorporated by reference in its entirety.
-
Soluble TRAIL variant DR4-1 SEQ ID NO: 1 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC WQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRRRSNTLSSPNSKNEKALGRKINSW ESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCW SKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG Soluble TRAIL variant DR4-2 SEQ ID NO: 2 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC WQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSW ESSRRGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCW SKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG Soluble TRAIL variant DR4-3 SEQ ID NO: 3 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC WQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRRRSNTLSSPNSKNEKALGIKINSW ESSRRGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTDYPDPILLMKSARNSCW SKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG Soluble TRAIL variant DR5-1 SEQ ID NO: 4 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC WQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSW ESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCW SKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMHHEASFFGAFLVG Soluble TRAIL variant DR5-2 SEQ ID NO: 5 MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACELKEDDSYWDPNDEESMNSPC WQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSW ESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQERIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCW SKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMHHEASFFGAFLVG - All combinations of the TRAIL receptor ligands are envisioned. In some embodiments, the first and second agents comprise SEQ ID NO: 1 and SEQ ID NO: 2; SEQ ID NO: 1 and SEQ ID NO: 3; SEQ ID NO: 1 and SEQ ID NO: 4; SEQ ID NO: 1 and SEQ ID NO: 5; SEQ ID NO: 2 and SEQ ID NO: 3; SEQ ID NO: 2 and SEQ ID NO: 4; SEQ ID NO: 2 and SEQ ID NO: 5; SEQ ID NO: 3 and SEQ ID NO: 4; SEQ ID NO: 3 and SEQ ID NO: 5; or SEQ ID NO: 4 and SEQ ID NO: 5, or a fragment or variant of any of the foregoing.
- In some embodiments, the TRAIL receptor ligand comprises an antibody molecule. In embodiments, the antibody molecule recognizes one or both of TRAIL R1 and TRAIL R2. The antibody molecule may be, e.g., Mapatumumab (human anti-DR4 mAb), Tigatuzumab (humanized anti-DR5 mAb), Lexatumumab (human anti-DR5 mAb), Conatumumab (human anti-DR5 mAb), or Apomab (human anti-DR5 mAb), or a fragment or variant thereof, e.g., a variant having the same CDRs as any of the aforementioned antibodies, e.g., by the Chothia or Kabat definitions. In some embodiments, the enucleated red blood cell (e.g., reticulocyte) comprises two or more (e.g., three, four, five, or more) different antibody molecules that bind a TRAIL receptor. In some embodiments, the enucleated red blood cell (e.g., reticulocyte) comprises at least one antibody molecule that binds a TRAIL receptor and at least one TRAIL polypeptide.
- In some embodiments, the agents are modulators of a multi-step pathway that act agent-synergistically by targeting upstream and downstream steps of the pathway, e.g., simultaneously. In one embodiment, the target pathway is the complement cascade, which has several parallel activation paths (classical, alternative, lectin pathways) and multiple auto-catalytic enzymes to enhance its potency in responding to infection and leading to membrane-attack complex formation (see, e.g. Bu et al., Clin Dev Immunol. 2012; 2012: 370426). Inhibitors of complement cascade exist, both as synthetic antibodies and peptides, that act on different levels of the cascade, e.g. anti-C5 (eculizumab) and anti-C3 (compstatin), and as endogenous proteins and polypeptides, e.g. CFH, CFI, CD46/MCP, CD55/DAF, CD59, and CR1. Non-enzymatic complement inhibitors include include Efb (extracellular fibrinogen-binding protein, e.g., from S. aureus, which binds C3b), Ehp (binds C3d and inhibits C3 conversion), SCIN (staphylococcal complement inhibitor, which stabilize C3 convertase into a non-functional state), CHIPS (chemotaxis inhibitory protein of S. aureus, which antagonizes C5a receptor), and SSL-7 (Staphyloccal superantigen-like protein-7, which binds C5). Enzymatic complement inhibitors include LysC, LysN, PaE, PaAP, 56 kDa protease from Serratia marcescens, C5a peptidases, Plasmin, SpeB, PrtH, Staphylokinase, and MMPs (see Table 1). The exogenous polypeptide can also comprise a fragment or variant of any of the complement inhibitors described herein. To treat diseases of complement over-activation it can be beneficial to inhibit the complement cascade, and it can be especially beneficial to intervene at two or more stages of the cascade to obtain a more potent inhibition. In some embodiments the agents expressed on the engineered red blood cell (e.g., reticulocyte) are inhibitors of the complement cascade that act on different levels of the cascade, e.g. CFI and MCP, CD55 and CD59, or anti-C3 and anti-C5.
- In some embodiments, the enucleated RBC comprises two or more agents that are anti-inflammatory. For instance, the agents can comprise an anti-TNFa antibody molecule (e.g., humira), an anti-IgE antibody molecule (e.g., Xolair), or a molecule that inhibits T cells (e.g., IL-10 or PD-L1; also see Table 1 and Table 3), or any combination thereof. In embodiments, one or more agents capture a factor such as a cytokine. In embodiments, one or more agents modulate immune cells.
- Multiplicative Configurations
- When two or more agents (e.g., polypeptides) are multiplicative, a first agent acts on a first molecule that is part of a first pathway and a second agent acts on a second molecule that is part of a second pathway, which pathways act in concert toward a desired response.
- In some embodiments, the desired response is inactivation (e.g., anergy) of an inappropriately activated immune cell, e.g., T cell. In some embodiments, the agents inhibit multiple T cell activation pathways. In embodiments, one or more (e.g., 2, 3, 4, or 5 or more) T cell inhibition ligands comprise an inhibiting variant (e.g., fragment) of a ligand of Table 2. In embodiments, one or more (e.g., 2, 3, 4, or 5 or more) T cell inhibition ligands comprise an inhibitory antibody molecule that binds a target receptor of Table 2 or a T-cell inhibiting variant (e.g., fragment) thereof. In embodiments, these proteins signal through complementary activation pathways. In some embodiments the ligands are inhibitory cytokines, interferons, or TNF family members. In some embodiments the agents are combinations of the above classes of molecules. The agents can be derived from endogenous ligands or antibody molecules to the target receptors.
-
TABLE 2 T cell activation Activating Ligand Target Receptor on T cell B7-H2 (e.g., Accession Number ICOS, CD28 (e.g., Accession NP_056074.1) Number NP_006130.1) B7-1 (e.g., Accession Number CD28 (e.g., Accession Number NP_005182.1) NP_006130.1) B7-2 (e.g., Accession Number CD28 (e.g., Accession Number AAA86473) NP_006130.1) CD70 (e.g., Accession Number CD27 (e.g., Accession Number NP_001243.1) NP_001233.1) LIGHT (e.g., Accession Number HVEM (e.g., Accession Number NP_003798.2) AAQ89238.1) HVEM (e.g., Accession Number LIGHT (e.g., Accession Number AAQ89238.1) NP_003798.2) CD40L (e.g., Accession Number CD40 (e.g., Accession Number BAA06599.1) NP_001241.1) 4-1BBL (e.g., Accession Number 4-1BB (e.g., Accession NP_003802.1) NP_001552.2) OX40L (e.g., Accession Number OX40 (e.g., Accession Number NP_003317.1) NP_003318.1) TL1A (e.g., Accession Number DR3 (e.g., Accession Number NP_005109.2) NP_683866.1) GITRL (e.g., Accession Number GITR (e.g., Accession Number NP_005083.2) NP_004186.1) CD30L (e.g., Accession Number CD30 (e.g., Accession Number NP_001235.1), NP_001234.3) TIM4 (e.g., Accession Number TIM1 (e.g., Accession Number NP_612388.2) NP_036338.2) SLAM (e.g., Accession Number SLAM (e.g., Accession Number AAK77968.1) AAK77968.1) CD48 (e.g., Accession Number CD2 (e.g., Accession Number CAG33293.1) NP_001315538.1) CD58 (e.g., Accession Number CD2 (e.g., Accession Number CAG33220.1) NP_001315538.1) CD155 (e.g., Accession Number CD226 (e.g., Accession Number NP_001129240.1) NP_006557.2) CD112 (e.g., Accession Number CD226 (e.g., Accession Number NP_001036189.1) NP_006557.2) CD137L (e.g., Accession Number CD137 (e.g., Accession NP_003802.1) NP_001552.2) - In some embodiments, an anti-IL6 or TNFa antibody molecule comprises a sequence of either of SEQ ID NO: 6 or 7 herein, or a sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
-
Anti-IL6 scFv SEQ ID NO: 6 EVQLVESGGGLVQPGGSLRLSCAASGFNFNDYFMNWVRQAPGKGLEWVAQ MRNKNYQYGTYYAESLEGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR ESYYGFTSYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASV GDRVTITCQASQDIGISLSWYQQKPGKAPKLLIYNANNLADGVPSRFSGS GSGTDFTLTISSLQPEDFATYYCLQHNSAPYTFGQGTKLEIKR Anti-TNFα scFv- SEQ ID NO: 7 EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSA ITWNSGHIDYADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVS YLSTASSLDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS VGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSG SGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIK - In some embodiments, a T cell (e.g., autoreactive T cell) is inhibited using a ligand or receptor of Table 3, or a fragment or variant thereof. For instance, the first and second exogenous polypeptide can comprise a T cell inhibiting ligand (e.g., an inhibitory ligand of Table 3 or a fragment or variant thereof) and an agent that inhibits activation of a T cell (e.g., through a receptor of Table 2). In some embodiments, the agent that inhibits a T cell is an inhibitory ligand of Table 3, or a fragment or variant thereof. In some embodiments, the agent is an antibody molecule that binds a target receptor of Table 3, or a fragment or variant thereof.
-
TABLE 3 T cell inhibition Inhibitory Ligand Target Receptor on T cell B7-1 CTLA4, B7H1 B7-2 CTLA4 B7DC PD1 B7H1 PD1, B7-1 HVEM CD160, BTLA COLLAGEN LAIR1 GALECTIN9 TIM3 CD48, TIM4 TIM4R CD48 2B4 CD155, CD112, CD113 TIGIT PDL1 PD1 - Without wishing to be bound by theory, in some embodiments the objective is to dampen an immune response by inhibiting T cell activation. Thus, in embodiments, an engineered red blood cell (e.g., reticulocyte) targets multiple T cell inhibitory pathways in combination (e.g., as described in Table 3), e.g., using ligands or antibody molecules, or both, co-expressed on an engineered red blood cell. In some embodiments, the agents comprise a receptor or antibody molecule that captures inflammatory cytokines, e.g., to prevent additional activation of the target T cell. For example, the agents may comprise an agonist antibody molecule to the receptor CTLA-4 and an antibody molecule against TNFalpha.
- In some embodiments the objective is to activate or to inhibit T cells. To ensure that T cells are preferentially targeted over other immune cells that may also express either activating or inhibitory receptors as described herein, one of the agents on the red blood cell (e.g., reticulocyte) may comprise a targeting moiety, e.g., an antibody molecule that binds the T cell receptor (TCR) or another T cell marker. Targeting moieties are described in more detail in the section entitled “Localization configurations” herein. In some embodiments, a specific T cell subtype or clone may be enhanced (a T cell with anti-tumor specificity) or inhibited (a T cell with autoimmune reactivity). In some embodiments, one or more of the agents on the red blood cell (e.g., reticulocyte) is a peptide-MHC molecule that will selectively bind to a T cell receptor in an antigen-specific manner.
- In the context of inducing a tolerogenic response, the first and second exogenous polypeptides comprise, in some embodiments, an antigen and an inhibitory ligand so that antigen presentation by APCs induces tolerance instead of immunity. In embodiments, the antigen is an autoimmune antigen, e.g., an autoantigen of Table 4, or an allergen, e.g., an allergen from plants such as pollen, an allergen from food, or an allergen from an animal. In embodiments, the inhibitory ligand comprises FasL, B7, PD1, PD-L1, CTLA4, TIM3, CEACAM (e.g., CEACAM-1, CEACAM-3 and/or CEACAM-5), LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 and TGF beta, or a functional variant (e.g., fragment) thereof. In some embodiments, the agent that inhibits a T cell is an inhibitory ligand of Table 3, or an inhibitory fragment or variant thereof. In some embodiments, the agent that inhibits a T cell is an antibody molecule that binds a target receptor of Table 3, or an inhibitory fragment or variant thereof. In some embodiments, the red blood cell (e.g., reticulocyte) further comprises an antibody molecule that binds a dendritic cell receptor, e.g. CD205 or CD206. In embodiments this agent promotes uptake by antigen presenting cells. In some embodiments, CD205 induces tolerogenic antigen presentation in the absence of additional co-stimulatory signals.
- In some embodiments, the first and second exogenous polypeptides comprise, in some embodiments, an antigen and a costimulatory molecule, e.g., wherein the erythroid cell can act as an APC.
-
TABLE 4 Autoimmune diseases and antigens Disease Antigen Acute rheumatic fever cross reactive antibodies to cardiac muscle alopecia areata Trychohyalin, keratin 16 ANCA-associated vasculitis Neutrophil cytoplasmic antigen, proteinase 3, myeloperodixase, bacterial permiability increasing factor autoimmune gastritis H, K adenosine triphosphatase autoimmune hemolytic anemia Rh blood group antigens, I antigen autoimmune hepatitis nuclear protein, liver-kidney microsome type 1, liver cytosol type 1 autoimmune myocarditis cardiac myosin Autoimmune thyroiditis Thyroid peroxidase, thyroglobulin, thyroid-stimulating hormone receptor Autoimmune uveitis Retinal arrestin (S-antigen) dermatomyositis Mi2 ATPase diabetes (type 1) Pancreatic beta cell antigen, insulin goodpasture's syndrome Noncollagenous domain of basement membrane collagen type IV Graves' disease Thyroid stimulating hormone receptor, thyrotropin receptor Guillain-Barré syndrome Neurofascin-186, gliomedin, nodal adhesion molecueles Hypoglycemia Insulin receptor idiopathic thrombocytopenic Platelet integrin GpIIb, GpIIIa purpura Insulin resistant diabetes Insulin receptor Membranous nephritis Phospholipase A2 mixed essential rheumatoid factor IgG complexes cryoglobulinemia multiple sclerosis Myelin basic protein, proteolipid protein, myelin oligodendrocyte glycoprotein (MOG) myasthenia gravis Acetylcholine receptor Myasthenia gravis—MUSC Muscarinic receptor pemphigus/pemphigoid Epidermal cadherin Pemphigus vulgaris Desmoglein 1,3 pernicious anemia intrinsic factor (Gastric) polymyositis nuclear and nucleolar antigen primary biliary cirrhosis neutrophil nuclear antigen, mitochondrial multienzyme complex psoriasis PSO p27 rheumatoid arthritis rheumatoid factor IgG complexes, synovial joint antigen, citrullinated protein, carbamylated protein scleroderma/systemic sclerosis Sc1-86, nucleolar scleroderma antigen Sjögren's syndrome SS-B, Lupus La protein systemic lupus erythematosus DNA, histones, ribosomes, snRNP, scRNP vitiligo VIT-90, VIT-75, VIT-40 Wegener's granulomatosis neutrophil nuclear antigen Antiphospholipid syndrome Beta-2 glycoprotein 1 (APS) & catastrophic APS Chemotherapy induced Neuronal antigens peripheral neuropathy Thrombotic thrombocytopenic ADAMTS13 purpura Atypical hemolytic uremic Complement factor H syndrome EAE, MS myelin oligodendrocyte glycoprotein (MOG) Neuromyelitis optica (NMO) Aquaporin 4 (AQP4) Membranous PLA2R glomerulonephritis - In some embodiments, an enucleated red blood cell (e.g., reticulocyte) comprising a first exogenous polypeptide and a second exogenous polypeptide is administered to a subject having a first target and a second target. In embodiments, the first exogenous polypeptide acts on (e.g., binds) the first target and the second exogenous polypeptide acts on the second target. Optionally, the enucleated red blood cell comprises a third exogenous polypeptide and the patient comprises a third target. In embodiments, the third exogenous polypeptide acts on the third target.
- In some embodiments an erythroid cell comprises a first exogenous polypeptide which is an agonist or antagonist of a first target in a first pathway, and further comprises a second exogenous polypeptide which is an agonist or antagonist of a second target in a second pathway, wherein the first and second pathways act in concert toward a desired response. The first and second exogenous polypeptides can both be agonists; can both be antagonists; or one can be an agonist and the other can be an antagonist. In some embodiments (e.g., see
FIG. 10 ), the first exogenous polypeptide comprises a surface-exposed anti-CD28 antibody molecule and the second exogenous polypeptide comprises a surface-exposed anti-CTLA4 antibody molecule, e.g., for treating systemic lupus erythematosus or rheumatoid arthritis. In some embodiments, the first exogenous polypeptide comprises a surface-exposed anti-ICOSL antagonist and the second exogenous polypeptide comprises a surface-exposed anti-CD40 antagonist, e.g., wherein the target is an antigen presenting cell, e.g., for treating systemic lupus erythematosus. In some embodiments, the target cell or tissue comprises immune cells or diseased tissue. In some embodiments, one or more of the exogenous polypeptides are immune checkpoint agonists or antagonists. In some embodiments, the erythroid cell further comprises a targeting agent. - Independent Function Configurations
- When two or more agents (e.g., polypeptides) have an independent function relationship, the agents have two distinct (e.g., complementary) functions. For example, a first agent binds a first target and the second agent binds a second target. The patient may lack the first or second target. Optionally, the first and second agents are in different pathways.
- In sepsis, tumor lysis syndrome, and other conditions marked by a cytokine storm, the damage is driven by a diverse mix of inflammatory cytokines. Existing monotherapies against one cytokine are often insufficient to treat these acute conditions. Furthermore it can sometimes be impossible to measure the driver of the cytokine storm in time to prevent clinical damage. In an embodiment, the first and second peptides are molecules (e.g., antibody molecules) that bind two different cytokines. In some embodiments the agents bind and neutralize different cytokines and thus the engineered red cell product provides multifaceted protection from cytokine storm.
- In embodiments the cytokines comprise interleukins, e.g., IL-1, IL02, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IL-35, or IL-36. In some embodiments, the cytokine is a cytokine of Table 1 or a fragment or variant thereof. In some embodiments, the first cytokine is TNFa and the second is an interleukin, e.g., IL-6, or a fragment or variant of any of the foregoing. In some embodiments, the agents comprise anti-TNFa, anti-IL-6, or anti-IFNg antibody molecules, or any combination thereof, or a fragment or variant of any of the foregoing.
- In some embodiments the agents comprise a plurality of antibody molecules, which plurality of antibody molecules binds a plurality of common bacterial, fungal, or viral pathogens. In embodiments, the antibodies are generated from human B cells, e.g., a combinatorial library of pooled human B cells. In embodiments, the poly-antibody engineered red blood cells serve as an alternative, replacement, or supplement to intravenous immunoglobulin (IVIG). IVIG is in embodiments administered to immunodeficient patients, e.g., patients who lack the capacity to produce endogenous antibodies. The red blood cell (e.g., reticulocyte) would provide long-lasting protection and be free from the risks associated with plasma donation.
- In some embodiments, an enucleated red blood cell (e.g., reticulocyte) comprising a first exogenous polypeptide and a second exogenous polypeptide is administered to a subject having a first target but not a second target, or wherein the patient is not known to have a first target or second target. In embodiments, the first exogenous polypeptide acts on (e.g., binds) the first target and the second exogenous polypeptide remains substantially unbound. Optionally, the enucleated red blood cell comprises a third exogenous polypeptide and the patient lacks a third target, or is not known to have the third target. In some embodiments, the enucleated red blood cell comprises a plurality of exogenous polypeptides, and the patient does not have, or is not known to have, targets for one or a subset of the plurality of exogenous polypeptides.
- An example of an independent function configuration is shown in
FIG. 4 . The erythroid cell ofFIG. 4 comprises a first exogenous polypeptide (white), a second exogenous polypeptide (hatching), and an optional third exogenous polypeptide (close hatching). The first exogenous polypeptide can bind a first target, e.g., cytokine A, and the second exogenous polypeptide can independently bind a second target, e.g., cytokine B. This engineered erythroid cell trap and clear both cytokines if both are present in the subject. If only one of the cytokines is present in the subject, the engineered erythroid cell can clear that cytokine. In embodiments, one or more (e.g., two or all) of the exogenous polypeptides comprise antibody molecules, e.g., scFvs, and optionally further comprise a transmembrane domain. In embodiments, the targets comprise a plurality of cytokines, chemokines, or a combination thereof. As examples, the first exogenous polypeptide could bind TNF-alpha and the second exogenous polypeptide could bind IL6, e.g., to treat rheumatoid arthritis; the first exogenous polypeptide could bind IL4 and the second exogenous polypeptide could bind IL13, e.g., to treat asthma and/or ectopic dermatitis; the first exogenous polypeptide could bind IL33 and the second exogenous polypeptide could bind IL15, e.g., to treat celiac disease or inflammatory bowel disease; or the first exogenous polypeptide could bind IL35 and the second exogenous polypeptide could bind IL25, e.g., to treat allergy. In embodiments, the first target and second target are unwanted antibodies, e.g., endogenous antibodies, e.g., autoimmune antibodies or anti-drug antibodies (e.g., as illustrated inFIG. 5 ). For instance, the first exogenous polypeptide could bind MOG and the second exogenous polypeptide could bind MBP, e.g., to treat multiple sclerosis. - Localization Configurations
- When two or more agents (e.g., polypeptides) have a localization relationship, a first agent localizes the RBC to a site of action that enhances the activity of the second or other agent or agents compared to their activity when not localized to the site of action (e.g., by binding of the first agent to its target, there is an increase in the local concentration of the second agent in the area of its target). In some embodiments one agent serves to target the red blood cell (e.g., reticulocyte) to a site of action and one or more agents have a therapeutic effect. In an embodiment, binding of the first agent increases the activity of an entity, e.g., polypeptide, bound by the second agent. In an embodiment, the first agent binds to a substrate or product of the entity, e.g., polypeptide, bound by the second agent. The agent that localizes the RBC may be, e.g., a ligand for a receptor on a target cell, or an antibody that binds a cell surface molecule on a target cell.
- As another example, a RBC comprises a targeting agent that binds to inflamed vasculature and also comprises an anti-inflammatory molecule. In some embodiments, the targeting agent binds an inflammatory integrin, e.g., a avB3 integrin or an addres sin such as MADCAM1. In some embodiments, the targeting agent comprises a lymphocyte homing receptor (e.g., CD34 or GLYCAM-1) or integrin-binding portion or variant thereof. In some embodiments, the anti-inflammatory molecule comprises an anti-inflammatory cytokine (e.g., IL-1 receptor antagonist, IL-4, IL-6, IL-10, IL-11, and IL-13), an inhibitor of TNF (e.g., an antibody molecule such as Enbrel), an inhibitor of a pro-inflammatory cytokine, an inhibitor against alpha4beta7 integrin (e.g., an antibody molecule), a colony-stimulating factor, a peptide growth factor, Monocyte Locomotion Inhibitory Factor (MLIF), Cortistatin, or an inhibitor of immune cell activation (e.g. PDL1 or another molecule described in Table 3 or antibody molecule thereto), or an anti-inflammatory variant (e.g., fragment) thereof.
- In some embodiments, the erythroid cell targets an endothelial cell, e.g., in an inflamed tissue. As shown in
FIG. 9 , the cell can comprise one or more targeting agents, e.g., exogenous polypeptides that bind surface markers of inflamed tissue. The targeting agent can be an exogenous polypeptide comprising, e.g., an anti-VCAM antibody molecule or an anti-E-selectin antibody molecule. In embodiments, an erythroid cell comprises two targeting agents, which may increase the specificity and/or affinity and/or avidity of the erythroid cell binding to its target, compared to an otherwise similar erythroid cell comprising only one of the targeting agents. In embodiments, the targeting moieties comprise: a surface exposed anti-VCAM antibody molecule and a surface exposed anti-E-selectin antibody molecule; a surface exposed alpha4Beta1 integrin or fragment or variant thereof and a surface exposed anti-E-selectin antibody molecule; or a surface exposed alphavbeta2 integrin or fragment or variant thereof and a surface exposed anti-E-selectin antibody molecule. The erythroid cell optionally further comprises an exogenous polypeptide with therapeutic activity, e.g., anti-inflammatory activity. The exogenous polypeptide with therapeutic activity can comprise an enzyme, capture reagent, agonist, or antagonist. - The erythroid cell can also target, in embodiments, immune cells or diseased tissue. In embodiments, the targeting moiety comprises a receptor or a fragment or variant thereof. In embodiments, the targeting moiety comprises an antibody molecule such as an scFv.
- In some embodiments, e.g., for killing autoreactive cells, the first exogenous polypeptide comprises a targeting moiety, e.g., a surface-exposed anti-CD20 antibody molecule that can target the erythroid cell to a B cell or a targeting moiety specific to autoreactive cells, and the second exogenous polypeptide comprises a moiety that can kill or anergize the T cell, e.g., a TRAIL ligand. The erythroid cell can further comprise an inhibitor of the second exogenous polypeptide, e.g., as illustrated in
FIG. 8 . - The first exogenous polypeptide can comprise a targeting agent and the second exogenous polypeptide can comprise an enzyme (e.g.,
FIG. 11 ). For example, in some embodiments, e.g., for treating an autoimmune disease, the erythroid cell comprises a first polypeptide comprising a targeting agent that binds an immune cell and a second polypeptide that inhibits (e.g., kills, induces anergy in, inhibits growth of) the immune cell. For instance, the targeting agent can comprise an anti-CD4 antibody which binds CD4 on the surface of a T cell, e.g., an autoreactive T cell. The second polypeptide can comprise an enzyme which can be surface-exposed or intracellular, e.g., intracellular and not membrane associated. The enzyme may be IDO or a fragment or variant thereof, which depletes tryptophan and can induce anergy in the autoreactive T cell, or ADA or a fragment or variant thereof. The enzyme may be a protease. In embodiments, the first polypeptide comprises an anti-MAdCAM-1 antibody molecule and the second polypeptide comprises LysC or LysN (which can cleave MAdCAM-1 at 1 or more (e.g., 2, 3, or 4 sites), e.g., wherein the target tissue is inflamed gut or liver tissue. In some embodiments, the targeting agent comprises an anti-IL13R antibody molecule or IL13 or a fragment or variant thereof, and the payload comprises IDO or ADA, e.g., for treating an allergy or asthma. In some embodiments, the targeting agent comprises an anti-IL23R antibody molecule or IL23 or a fragment or variant thereof, and the payload comprises IDO or ADA, e.g., for treating psoriasis. - In embodiments, the target cell is an immune cell, e.g., a T cell, e.g., a helper T cell, and/or a disease cell. The targeting agent may comprise an antibody molecule, e.g., an scFv.
- The first exogenous polypeptide can comprise a targeting agent and the second exogenous polypeptide can comprise an agonist of a target (see, e.g.,
FIG. 12 ). For instance, in some embodiments, the first exogenous polypeptide comprises an anti-MAdCAM-1 antibody molecule, e.g., which can bind MAdCAM-1, e.g., on inflamed tissue. The second exogenous polypeptide may comprise an anti-inflammatory molecule, e.g., IL10 or a fragment or variant thereof. In some embodiments, the target cell is a pathogenic immune cell. In embodiments, the targeting agent comprises a receptor or fragment or variant thereof, an antibody molecule, a ligand or fragment or variant thereof, a cytokine or fragment or variant thereof. In embodiments, the second exogenous polypeptide comprises an attenuator, an activator, a cell-killing agent, or a cytotoxic molecule (e.g., a small molecule, protein, RNA e.g., antisense RNA, or TLR ligand). In embodiments, the second exogenous polypeptide is intracellular, e.g., not membrane associated, and in some embodiments, the second exogenous polypeptide is surface-exposed. In embodiments, the targeting moiety binds a hepatocyte and the second exogenous polypeptide comprises TGF beta or a fragment or variant thereof, e.g., for treating non-alcoholic fatty liver disease (NAFLD) or non-alcoholic steatohepatitis (NASH). - The erythroid cell can comprise a targeting agent and a capture agent (e.g.,
FIG. 13 ). For example, the first exogenous polypeptide can comprise a targeting agent that binds a plasma cell, e.g., an anti-BCMA antibody molecule. The second exogenous polypeptide may capture cytokines, e.g., may comprise TACI or a fragment or variant thereof which can capture BLyS (also called BAFF) and/or APRIL. In embodiments, the second exogenous polypeptide binds its target in a way that prevents the target from interacting with an endogenous receptor, e.g., binds the target at a moiety that overlaps with the receptor binding site. In embodiments, the targeting moiety binds a receptor at the site of disease, e.g., binds an integrin. In embodiments, the target cell is a pathogenic immune cell or diseased tissue. In embodiments, the targeting agent comprises a ligand or a cytokine or fragment or variant thereof, or an antibody molecule, e.g., an scFv. In embodiments, the capture agent comprises a receptor or fragment or variant thereof, or an antibody molecule, e.g., an scFv. In embodiments, the ligand is an unwanted cytokine or chemokine. - A targeting agent can direct an erythroid cell to a particular sub-type of cell, e.g., an immune cell with a particular antigen specificity, e.g., an autoreactive immune cell. The cell can further comprise a second exogenous polypeptide that promotes a given activity or pathway in the target cell, e.g., can attenuate, activate, or induce cell death. For instance,
FIG. 14 depicts an erythroid cell comprising a first exogenous polypeptide comprising an AQP4 epitope that can bind an anti-AQP4 B-cell receptor (BCR) on an autoreactive plasma cell; other exemplary first exogenous polypeptides include ACHR or insulin or fragments or variants thereof. The erythroid cell can further comprise a second exogenous polypeptide that inhibits (e.g., kills, induces anergy in, inhibits growth of) the immune cell. For instance, the second exogenous polypeptide can comprise a cell-killing agent, e.g., a pro-apoptotic agent, e.g., a TRAIL polypeptide that induces apoptosis in an autoreactive immune cell. As another example, the erythroid cell can have antigen presentation activity, e.g., can comprise MOG and/or MBP peptide on MHCII, and further comprise one or both or IL10 and TGFbeta or a fragment or variant thereof, e.g., for treating multiple sclerosis. The erythroid cell may also comprise an antigen and an attenuator or activator that is surface exposed or intracellular. For example, the cell can comprise an antigen and PDL1 or a fragment or variant thereof. As another example the cell can comprise an antigen and an enzyme such as IDO or ADA. The erythroid cell may also comprise an antigen and a cell targeting agent, e.g., an antigen specific for a type of B cell (e.g., an autoantigen specific for autoreactive B cells) and an anti-BCMA antibody molecule that targets plasma cells. - Proximity-Based Configurations
- When two or more agents (e.g., polypeptides) have a proximity-based relationship, the two agents function more strongly, e.g., exert a more pronounced effect, when they are in proximity to each other than when they are physically separate. In embodiments, the two agents are in proximity when they are directly binding to each other, when they are part of a complex (e.g., linked by a third agent), when they are present on the same cell membrane, or when they are present on the same subsection of a cell membrane (e.g., within a lipid raft, outside a lipid raft, or bound directly or indirectly to an intracellular structure such as a cytoskeleton component). In some embodiments, first polypeptide binds a first target molecule and the second polypeptide binds a second target molecule, and this binding causes the first target molecule and the second target molecule to move into closer proximity with each other, e.g., to bind each other. In some embodiments, the first and second target molecules are cell surface receptors on a target cells.
- An example of a proximity-based configuration is shown in
FIG. 4 . The erythroid cell ofFIG. 4 comprises an optional first exogenous polypeptide (white), a second exogenous polypeptide (hatching), and a third exogenous polypeptide (close hatching). The second and third exogenous polypeptides bind to different epitopes within the same polypeptide chain of a target, e.g., cytokine B. The second and third exogenous polypeptides, which are mounted on the erythrocyte, bind to the target with higher avidity than if the second and third exogenous polypeptides were free polypeptides. As examples, two or more exogenous polypeptides could bind different sites on the same target, wherein the target is a cytokine, a complement factor (e.g., C5), an enzyme, an antibody, or an immune complex. As an example, the first exogenous polypeptide comprises an antigen (e.g., an autoantigen, e.g., an autoantigen of Table 6) that binds a specific antibody (e.g., an autoantibody) and the second exogenous polypeptide binds antibody Fc (e.g., could comprise CD16A which binds Fc) to increase avidity for the antibody that binds the first exogenous polypeptide. - Scaffold Configurations
- When two or more agents (e.g., polypeptides) have a scaffold relationship, the agents bring two or more targets together, to increase the likelihood of the targets interacting with each other. In an embodiment the first and second agent are associated with each other (forming a scaffold) at the surface of the RBC, e.g., two complexed polypeptides. In an embodiment, the red blood cell (e.g., reticulocyte) comprises a bispecific antibody molecule, e.g., an antibody molecule that recognizes one or more (e.g., 2) proteins described herein, e.g., in any of Table 1, Table 2, Table 3, and Table 4.
- The targets may comprise, e.g., proteins, cells, small molecules, or any combination thereof. In an embodiment, the first and second targets are proteins. In an embodiment, the first and second targets are cells.
- In some embodiments, the RBC brings an immune effector cell into proximity with another immune cell, e.g., to promote antigen presentation (e.g., when one cell is an antigen presenting cell and the other cell is a T cell) or anergy (e.g., when one cell is a Treg and the other cell is an immune effector cell, e.g., an autoreactive immune effector cell).
- In some embodiments, a RBC expresses an exogenous fusion polypeptide comprising a first antibody molecule domain and a second antibody molecule domain, wherein the exogenous polypeptide functions as a bispecific antibody, e.g., wherein the first antibody molecule domain binds a first target on a first cell and the second antibody molecule domain binds a second target on a second cell, e.g., a different cell type.
- Multimer Configurations
- When two or more agents (e.g., polypeptides) have a multimer configuration, the agents combine with each other, e.g., bind each other, to form a complex that has a function or activity on a target. In an embodiment, the agents are subunits of a cell surface complex, e.g., MHCI, and a function is to bind a peptide. In an embodiment, the agents are subunits of MHCII, and a function is to bind a peptide. In an embodiment, the agents are subunits of a cell surface molecule, e.g., MHCI and a peptide, e.g., a peptide loaded on the MHCI molecule, and a function is to present the peptide. In an embodiment, the agents are subunits of a MHCII and a peptide, e.g., a peptide loaded on the MHCII molecule, and a function is to present the peptide. In one embodiment, the complex is a functional MHC I, the agents are MHC I (alpha chain 1-3) and beta-2 microglobulin. In one embodiment the complex is MHC II and the agents are MHC II alpha chain and MHC II beta chain. In some embodiments, the MHC molecule comprises human MHC class I or II, e.g., MHC II alpha subunit and MHC II beta subunit or a fusion molecule comprising both subunits or antigen-presenting fragments thereof. A RBC with these two polypeptides is used, in some embodiments, for immune induction or antigen presentation. In some embodiments, the RBC comprises a single protein that is a fusion between an MHC molecule and an antigen, e.g., a single-chain peptide-MHC construct. In some embodiments, a non-membrane tethered component of the complex, e.g. the peptide, or the beta-2 microglobulin, is assembled with another agent within the cell prior to trafficking to the surface, is secreted by the cell then captured on the surface by the membrane-tethered component of the multimer, or is added in a purified form to an engineered red blood cell.
- The antigen is, in some embodiments, an autoimmune antigen, e.g., a protein or fragment or variant thereof of Table 4. In some embodiments, the antigen is about 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, or 35 amino acids in length.
- In some embodiments, a red blood cell (e.g., reticulocyte) acts on a complement cascade. Some complement regulatory proteins act in concert as co-factors for one another, e.g. CFH and CD55 are co-factors for the enzymatic activity of CFI. In some embodiments, the agents comprise an enzymatic protein or domain, e.g., CFI, and a co-factor, e.g., CFH or CD55, that accelerates and enhances the activity of CFI on the target complement molecule.
- In some embodiments the complex comprises multiple subdomains derived from different polypeptide chains, all of which must be expressed in order for the complex to be active.
- Compensatory Configurations
- When two or more agents (e.g., polypeptides) have a compensatory relationship, a first agent reduces an undesirable characteristic of a second agent. For example, in some embodiments, the second agent has a given level of immunogenicity, and the first agent reduces the immunogenicity, e.g., by negatively signaling immune cells (see Table 3), or by shielding an antigenic epitope of the second agent. In some embodiments, the second agent has a given half-life, and the first agent increases the half-life of the second agent. For example, the first agent can comprise a chaperone or fragment or variant thereof.
- An enucleated erythroid cell can co-express a therapeutic protein and its inhibitor (e.g.,
FIG. 8 ). The inhibitor can be released (e.g., cease binding the therapeutic but remain on the surface of the cell) in at the desired location in the body, to activate the therapeutic protein. - For instance, in some embodiments, the erythroid cell comprises a first exogenous polypeptide with therapeutic activity (e.g., an anti-TNFalpha antibody molecule), a second exogenous polypeptide (e.g., TNFalpha or a fragment or variant thereof) that inhibits the first exogenous polypeptide. The second polypeptide (e.g., TNFalpha) may inhibit activity of the first exogenous polypeptide (e.g., anti-TNFalpha) until the erythroid cell is at a desired location, e.g., at inflamed tissue, e.g., limiting off-target effects. The second exogenous polypeptide (e.g., TNFalpha) may comprise a variant of the target (e.g., endogenous TNFalpha) that the first exogenous polypeptide (e.g., anti-TNFalpha) binds. For instance, the variant can be a weakly-binding variant that is competed away in the presence of the target. In embodiments, the Kd of the first exogenous polypeptide for the second exogenous polypeptide is at least 2, 3, 5, 10, 20, 50, or 100-fold greater than the Kd of the first exogenous polypeptide for its target. The erythroid cell optionally comprises a third exogenous polypeptide that comprises a targeting agent.
- In some embodiments, the enucleated erythroid cell comprises a prodrug (e.g., pro-insulin) that becomes a drug (e.g., insulin) at a desired site in a subject.
- Enucleated Red Blood Cells comprising Three or more Agents (e.g., Polypeptides)
- In embodiments, a red blood cell (e.g., reticulocyte) described herein comprises three or more, e.g., at least 4, 5, 10, 20, 50, 100, 200, 500, or 1000 agents. In embodiments, a population of red blood cells described herein comprises three or more, e.g., at least 4, 5, 10, 20, 50, 100, 200, 500, 1000, 2000, or 5000 agents, e.g., wherein different RBCs in the population comprise different agents or wherein different RBCs in the population comprise different pluralities of agents. In embodiments, two or more (e.g., all) of the agents in the RBC or population or RBCs have agent-additive, agent-synergistic, multiplicative, independent function, localization-based, proximity-dependent, scaffold-based, multimer-based, or compensatory activity.
- In embodiments, the RBC is produced by contacting a RBC progenitor cell with a plurality of mRNAs encoding the agents.
- Eukaryotic display screening. In an embodiment, a combinatorial, high-diversity pool of cells is produced, e.g., for use in an in vitro or in vivo binding assay. A combinatorial, high-diversity nucleic acid library encoding cell-surface proteins can be created. Such a library could, e.g., consist of entirely variable sequences, or comprise a fixed sequence fused to a highly variable, combinatorial sequence. These can be introduced into red blood cell progenitors as a mixture or individually, using methods such as electroporation, transfection or viral transduction. In one embodiment, the cells are subsequently grown in differentiation media until the desired level of maturity. In one embodiment, the cells are used for a highly multiplexed in-vitro assay. Cells are incubated with a biological sample in a microtiter plate. Wells are washed using a cell-compatible buffer, with a desired level of stringency. The remaining cells are isolated and analyzed for the enrichment of specific sequences. In one embodiment, the analysis is performed at the protein level, e.g., using mass spectrometry, to identify the amino acid motifs that are enriched in the bound population. In an embodiment, the analysis is performed at the nucleic acid level (RNA or DNA) to identify the nucleic acid sequences identifying the corresponding amino-acid motif enriched in the bound population. In an embodiment, the high-diversity cell population is injected into an animal model (either healthy or diseased). In one embodiment the cells are fluorescently labeled to visualize their in vivo distribution or localization. Various tissues of the animal could then be collected and analyzed for the relative enrichment of specific amino-acid motifs or nucleic acid sequences identifying the corresponding amino-acid motif.
- Expression optimization. A large number of variants can be simultaneously transfected into individual cells to assess their relative transcription or translation ability. In embodiments, a library of protein coding sequences are designed and synthesized with a diversity of 5′ untranslated regions, 3′ untranslated regions, codon representations, amino acid changes, and other sequence differences. This library would be introduced into red blood cell progenitors as a mixture or individually, using methods such as electroporation, transfection or viral transduction. In one embodiment, the cells are subsequently grown in differentiation media until the desired level of maturity.
- In some embodiments, the RBCs (e.g., reticulocytes) described herein have one or more (e.g., 2, 3, 4, or more) physical characteristics described herein, e.g., osmotic fragility, cell size, hemoglobin concentration, or phosphatidylserine content. While not wishing to be bound by theory, in some embodiments an enucleated RBC that expresses an exogenous protein has physical characteristics that resemble a wild-type, untreated RBC. In contrast, a hypotonically loaded RBC sometimes displays aberrant physical characteristics such as increased osmotic fragility, altered cell size, reduced hemoglobin concentration, or increased phosphatidylserine levels on the outer leaflet of the cell membrane.
- In some embodiments, the enucleated RBC comprises an exogenous protein that was encoded by an exogenous nucleic acid that was not retained by the cell, has not been purified, or has not existed fully outside an RBC. In some embodiments, the RBC is in a composition that lacks a stabilizer.
- Osmotic Fragility
- In some embodiments, the enucleated red blood cell exhibits substantially the same osmotic membrane fragility as an isolated, uncultured erythroid cell that does not comprise an exogenous polypeptide. In some embodiments, the population of enucleated red blood cells has an osmotic fragility of less than 50% cell lysis at 0.3%, 0.35%, 0.4%, 0.45%, or 0.5% NaCl. Osmotic fragility can be assayed using the method of Example 59 of WO2015/073587.
- Cell Size
- In some embodiments, the enucleated RBC has approximately the diameter or volume as a wild-type, untreated RBC.
- In some embodiments, the population of RBC has an average diameter of about 4, 5, 6, 7, or 8 microns, and optionally the standard deviation of the population is less than 1, 2, or 3 microns. In some embodiments, the one or more RBC has a diameter of about 4-8, 5-7, or about 6 microns. In some embodiments, the diameter of the RBC is less than about 1 micron, larger than about 20 microns, between about 1 micron and about 20 microns, between about 2 microns and about 20 microns, between about 3 microns and about 20 microns, between about 4 microns and about 20 microns, between about 5 microns and about 20 microns, between about 6 microns and about 20 microns, between about 5 microns and about 15 microns or between about 10 microns and about 30 microns. Cell diameter is measured, in some embodiments, using an Advia 120 hematology system.
- In some embodiment the volume of the mean corpuscular volume of the RBCs is greater than 10 fL, 20 fL, 30 fL, 40 fL, 50 fL, 60 fL, 70 fL, 80 fL, 90 fL, 100 fL, 110 fL, 120 fL, 130 fL, 140 fL, 150 fL, or greater than 150 fL. In one embodiment the mean corpuscular volume of the RBCs is less than 30 fL, 40 fL, 50 fL, 60 fL, 70 fL, 80 fL, 90 fL, 100 fL, 110 fL, 120 fL, 130 fL, 140 fL, 150 fL, 160 fL, 170 fL, 180 fL, 190 fL, 200 fL, or less than 200 fL. In one embodiment the mean corpuscular volume of the RBCs is between 80-100, 100-200, 200-300, 300-400, or 400-500 femtoliters (fL). In some embodiments, a population of RBCs has a mean corpuscular volume set out in this paragraph and the standard deviation of the population is less than 50, 40, 30, 20, 10, 5, or 2 fL. The mean corpuscular volume is measured, in some embodiments, using a hematological analysis instrument, e.g., a Coulter counter.
- Hemoglobin Concentration
- In some embodiments, the enucleated RBC has a hemoglobin content similar to a wild-type, untreated RBC. In some embodiments, the RBCs comprise greater than 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9% or greater than 10% fetal hemoglobin. In some embodiments, the RBCs comprise at least about 20, 22, 24, 26, 28, or 30 pg, and optionally up to about 30 pg, of total hemoglobin. Hemoglobin levels are determined, in some embodiments, using the Drabkin's reagent method of Example 33 of WO2015/073587.
- Phosphatidylserine Content
- In some embodiments, the enucleated RBC has approximately the same phosphatidylserine content on the outer leaflet of its cell membrane as a wild-type, untreated RBC. Phosphatidylserine is predominantly on the inner leaflet of the cell membrane of wild-type, untreated RBCs, and hypotonic loading can cause the phosphatidylserine to distribute to the outer leaflet where it can trigger an immune response. In some embodiments, the population of RBC comprises less than about 30, 25, 20, 15, 10, 9, 8, 6, 5, 4, 3, 2, or 1% of cells that are positive for Annexin V staining. Phosphatidylserine exposure is assessed, in some embodiments, by staining for Annexin-V-FITC, which binds preferentially to PS, and measuring FITC fluorescence by flow cytometry, e.g., using the method of Example 54 of WO2015/073587.
- Other Characteristics
- In some embodiments, the population of RBC comprises at least about 50%, 60%, 70%, 80%, 90%, or 95% (and optionally up to 90 or 100%) of cells that are positive for GPA. The presence of GPA is detected, in some embodiments, using FACS.
- In some embodiments, the RBCs have a half-life of at least 30, 45, or 90 days in a subject.
- In some embodiments, a population of cells comprising RBCs comprises less than about 10, 5, 4, 3, 2, or 1% echinocytes.
- In some embodiments, an RBC is enucleated, e.g., a population of cells comprising RBCs used as a therapeutic preparation described herein is greater than 50%, 60%, 70%, 80%, 90% enucleated. In some embodiments, a cell, e.g., an RBC, contains a nucleus that is non-functional, e.g., has been inactivated.
- Methods of Manufacturing Enucleated Red Blood Cells
- Methods of manufacturing enucleated red blood cells (e.g., reticulocytes) comprising (e.g., expressing) exogenous agent (e.g., polypeptides) are described, e.g., in WO2015/073587 and WO2015/153102, each of which is incorporated by reference in its entirety.
- In some embodiments, hematopoietic progenitor cells, e.g., CD34+ hematopoietic progenitor cells, are contacted with a nucleic acid or nucleic acids encoding one or more exogenous polypeptides, and the cells are allowed to expand and differentiate in culture.
- In some embodiments, the two or more polypeptides are encoded in a single nucleic acid, e.g. a single vector. In embodiments, the single vector has a separate promoter for each gene, has two proteins that are initially transcribed into a single polypeptide having a protease cleavage site in the middle, so that subsequent proteolytic processing yields two proteins, or any other suitable configuration. In some embodiments, the two or more polypeptides are encoded in two or more nucleic acids, e.g., each vector encodes one of the polypeptides.
- The nucleic acid may be, e.g., DNA or RNA. A number of viruses may be used as gene transfer vehicles including retroviruses, Moloney murine leukemia virus (MMLV), adenovirus, adeno-associated virus (AAV), herpes simplex virus (HSV), lentiviruses such as human immunodeficiency virus 1 (HIV 1), and spumaviruses such as foamy viruses, for example.
- In some embodiments, the cells are produced using sortagging, e.g., as described in WO2014/183071 or WO2014/183066, each of which is incorporated by reference in its entirety.
- In some embodiments, the RBCs are expanded at least 1000, 2000, 5000, 10,000, 20,000, 50,000, or 100,000 fold (and optionally up to 100,000, 200,000, or 500,000 fold). Number of cells is measured, in some embodiments, using an automated cell counter.
- In some embodiments, the population of RBC comprises at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 98% (and optionally up to about 80, 90, or 100%) enucleated RBC. In some embodiments, the population of RBC contains less than 1% live enucleated cells, e.g., contains no detectable live enucleated cells. Enucleation is measured, in some embodiments, by FACS using a nuclear stain. In some embodiments, at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80% (and optionally up to about 70, 80, 90, or 100%) of RBC in the population comprise one or more (e.g., 2, 3, 4 or more) of the exogenous polypeptides. Expression of the polypeptides is measured, in some embodiments, by FACS using labeled antibodies against the polypeptides. In some embodiments, at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, or 80% (and optionally up to about 70, 80, 90, or 100%) of RBC in the population are enucleated and comprise one or more (e.g., 2, 3, 4, or more) of the exogenous polypeptides. In some embodiments, the population of RBC comprises about 1×109-2×109, 2×109-5×109, 5×109-1×1010, 1×1010-2×1010, 2×1010-5×1010, 5×1010-1×1011, 1×1011-2×1011, 2×1011-5×1011, 5×1011-1×1012, 1×1012-2×1012, 2×1012-5×1012, or 5×1012-1×1013 cells.
- In some aspects, the present disclosure provides a composition comprising a first agent and a second agent in physical proximity to each other. In some embodiments, agents act synergistically when they are in physical proximity to each other but not when they are separate. In some embodiments, the first and second agent are covalently linked, e.g., are part of a fusion protein or are chemically conjugated together. In some embodiments, the first and second agent are non-covalently linked, e.g., are bound directly to each other or to a scaffold. In some embodiments, the first and second agents are part of (e.g., linked to) a nanoparticle (e.g., 1-100, 100-2,500, or 2,500-10,000 nm in diameter) liposome, vesicle, bead, polymer, implant, or polypeptide complex.
- In some embodiments, the composition comprises at least 3, 4, 5, 6, 7, 8, 9, or 10 different agents that are in physical proximity to each other (e.g., covalently or noncovalently linked).
- In some embodiments, the composition comprises one or more (e.g., 2, 3, 4, 5, or more) agents described herein, e.g., exogenous polypeptides described herein, e.g., polypeptides of any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an antibody molecule thereto. In some embodiments, one or more (e.g., 2, 3, or more) of the exogenous polypeptides comprise cytokines, interleukins, cytokine receptors, Fc-binding molecules, T-cell activating ligands, T cell receptors, immune inhibitory molecules, costimulatory molecule, MHC molecules, APC-binding molecule, autoantigen, allergen, toxin, targeting agent, or TRAIL receptor ligands.
- In some embodiments, one or more (e.g., 2, 3, or more) of the exogenous polypeptides comprise TRAIL receptor ligands, e.g., a sequence of any of SEQ ID NOS: 1-5 herein, or a sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, or an antibody molecule that binds a TRAIL receptor. In some embodiments, the first agent binds to a first TRAIL receptor, e.g., TRAIL-RI, and the second agent binds to a second TRAIL receptor, e.g., TRAIL-RII. In embodiments, the two TRAIL receptor ligands in proximity provide a synergistic degree of apoptosis in a target cell, compared to either TRAIL receptor ligand alone. Example 1 herein demonstrates a synergistic activity when target cells are treated with a composition comprising two TRAIL receptor ligands in close proximity (e.g., on the surface of an enucleated red blood cell).
- Engineered Red Blood Cells comprising One or more Agents
- In some aspects, the present disclosure provides an engineered red blood cell (e.g., reticulocyte) comprising an exogenous agent. More specifically, in some aspects, the present disclosure provides an enucleated red blood cell (e.g., reticulocyte) comprising an exogenous polypeptide. The red blood cell optionally further comprises a second, different, exogenous polypeptide.
- In some embodiments, the exogenous polypeptide (e.g., an exogenous polypeptide comprised by a red blood cell that optionally further comprises a second exogenous polypeptide) is an exogenous polypeptide described herein. In embodiments, the polypeptide is selected from any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an antibody molecule thereto.
- In some embodiments, the exogenous polypeptide (e.g., an exogenous polypeptide comprised by a red blood cell that optionally further comprises a second exogenous polypeptide) comprises a stimulatory ligand, e.g., CD80, CD86, 41BBL, or any combination thereof. In some embodiments, the exogenous polypeptide comprises a T cell inhibitor such as IL-10 and PD-L1 or a combination thereof, e.g., for the treatment of an inflammatory disease.
- While in many embodiments herein, the one or more (e.g., two or more) exogenous polypeptides are situated on or in a red blood cell, it is understood that any exogenous polypeptide or combination of exogenous polypeptides described herein can also be situated on or in another vehicle. The vehicle can comprise, e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome. For instance, in some aspects, the present disclosure provides a vehicle (e.g., a cell, an erythroid cell, a corpuscle, a nanoparticle, a micelle, a liposome, or an exosome) comprising, e.g., on its surface, one or more agents described herein. In some embodiments, the one or more agent comprises a polypeptide that binds PD-1 (e.g., an antibody molecule that binds PD-1 or an agonist of PD-1 such as PD-L1), a polypeptide that binds PD-Ll (e.g., an antibody molecule that binds PD-L1), a polypeptide that binds CD20 (e.g., an antibody molecule that binds CD20), or a polypeptide that binds a TRAIL receptor (e.g., an agonist of a TRAIL receptor). In some embodiments, the one or more agents comprise an agent selected a polypeptide of any of Table 1, Table 2, Table 3, or Table 4, or a fragment or variant thereof, or an agonist or antagonist thereof, or an antibody molecule thereto. In some embodiments, the vehicle comprises two or more agents described herein, e.g., any pair of agents described herein.
- In some embodiments, the vehicle comprises an erythroid cell. In embodiments, the erythroid cell is a nucleated red blood cell, red blood cell precursor, or enucleated red blood cell. In embodiments, the erythroid cell is a cord blood stem cell, a CD34+ cell, a hematopoietic stem cell (HSC), a spleen colony forming (CFU-S) cell, a common myeloid progenitor (CMP) cell, a blastocyte colony-forming cell, a burst forming unit-erythroid (BFU-E), a megakaryocyte-erythroid progenitor (MEP) cell, an erythroid colony-forming unit (CFU-E), a reticulocyte, an erythrocyte, an induced pluripotent stem cell (iPSC), a mesenchymal stem cell (MSC), a polychromatic normoblast, an orthochromatic normoblast, or a combination thereof. In some embodiments, the erythroid cells are immortal or immortalized cells.
- In some embodiments, enucleated erythroid cells or other vehicles described herein are encapsulated in a membrane, e.g., semi-permeable membrane. In embodiments, the membrane comprises a polysaccharide, e.g., an anionic polysaccharide alginate. In embodiments, the semipermeable membrane does not allow cells to pass through, but allows passage of small molecules or macromolecules, e.g., metabolites, proteins, or DNA. In embodiments, the membrane is one described in Lienert et al., “Synthetic biology in mammalian cells: next generation research tools and therapeutics” Nature Reviews Molecular Cell Biology 15, 95-107 (2014), incorporated herein by reference in its entirety. While not wishing to be bound by theory, in some embodiments, the membrane shields the cells from the immune system and/or keeps a plurality of cells in proximity, facilitating interaction with each other or each other's products.
- Methods of Treatment with Compositions herein, e.g., Enucleated Red Blood Cells
- Methods of administering enucleated red blood cells (e.g., reticulocytes) comprising (e.g., expressing) exogenous agent (e.g., polypeptides) are described, e.g., in WO2015/073587 and WO2015/153102, each of which is incorporated by reference in its entirety.
- In embodiments, the enucleated red blood cells described herein are administered to a subject, e.g., a mammal, e.g., a human. Exemplary mammals that can be treated include without limitation, humans, domestic animals (e.g., dogs, cats and the like), farm animals (e.g., cows, sheep, pigs, horses and the like) and laboratory animals (e.g., monkey, rats, mice, rabbits, guinea pigs and the like). The methods described herein are applicable to both human therapy and veterinary applications.
- In some embodiments, the RBCs are administered to a patient every 1, 2, 3, 4, 5, or 6 months.
- In some embodiments, a dose of RBC comprises about 1×109-2×109, 2×109-5×109, 5×109-1×1010, 1×1010-2×1010, 2×1010-5×1010, 5×1010-1×1011, 1×1011-2×1011, 2×1011-5×1011, 5×1011-1×1012, 1×1012-2×1012, 2×1012-5×1012, or 5×1012-1×1013 cells.
- In some embodiments, the RBCs are administered to a patient in a dosing regimen (dose and periodicity of administration) sufficient to maintain function of the administered RBCs in the bloodstream of the patient over a period of 2 weeks to a year, e.g., one month to one year or longer, e.g., at least 2 weeks, 4 weeks, 6 weeks, 8 weeks, 3 months, 6 months, a year, 2 years.
- In some aspects, the present disclosure provides a method of treating a disease or condition described herein, comprising administering to a subject in need thereof a composition described herein, e.g., an enucleated red blood cell (e.g., reticulocyte) described herein. In some embodiments, the disease or condition is an inflammatory disease or an autoimmune disease. In some aspects, the disclosure provides a use of a RBC described herein for treating a disease or condition described herein, e.g., an immune condition, e.g., an inflammatory disease or an autoimmune disease, e.g., an autoimmune disease of Table 4. In some aspects, the disclosure provides a use of a RBC described herein for manufacture of a medicament for treating a disease or condition described herein, e.g., an immune condition, e.g., an inflammatory disease or an autoimmune disease, e.g., an autoimmune disease of Table 4.
- Inflammatory disease include sepsis e.g., bacterial sepsis, rheumatoid arthritis, age related macular degeneration (AMD), systemic lupus erythematosus (an inflammatory disorder of connective tissue), glomerulonephritis (inflammation of the capillaries of the kidney), Crohn's disease, ulcerative colitis, celiac disease, or other idiopathic inflammatory bowel diseases, and allergic asthma.
- Autoimmune diseases include systemic lupus erythematosus, glomerulonephritis, rheumatoid arthritis, multiple sclerosis,
type 1 diabetes, or a disease of Table 4. Immunodeficiencies include primary immunodeficiencies, e.g., Adenosine Deaminase Deficiency-Severe Combined Immunodeficiency (ADA-SCID), and e.g., secondary immunodeficiencies, e.g., secondary to an immunosuppressive therapy. -
-
TABLE 5 Exemplary modifiers, e.g., proteases Modifier Exemplary target Proteases IdeS IgG IdeZ (an immunoglobulin-degrading enzyme from IgG Streptococcus equi subspecies zooepidemicus) IgA protease IgG Papain IgG ADAM17/TACE TNF-alpha mesotrypsin Peptides comprising linkages involving the carboxyl group of lysine or arginine Lysozyme peptidoglycan Endolysin peptidoglycan Endoproteinase, e.g., LysC (can cleave proteins Protein having a Lys-Xaa motif on C-terminal side of lysine residues) Metalloendopeptidase, e.g., LysN (can cleave Protein having an Xaa-Lys motif proteins on amino side of lysine residues) Elastase, e.g., Pseudomonas elastase (PaE) C3 alkaline protease (PaAP) C3 56 kDa protease from Serratia marcescens C5a, C1-INH, alpha 2-antiplasmin, antithrombin III C5a peptidase, e.g., Streptocoocal C5a peptidase, C5a ScpA, ScpB, SCPA Plasmin IgG, C3b, iC3b cysteine protease, e.g., Streptococcal pyrogenic IgG, cytokines, extracellular matrix exotoxin B (SpeB) proteins PrtH (e.g., from Porphyromonas) IgG or C3 Staphylokinase plasminogen, IgG, C3b Matrix metalloproteinases (e.g., MMP1, MMP2, ECM proteins, e.g., collagen, gelatin, MMP3, MMP7, MMP8, MMP9, MMP10, fibronectin, laminin, aggrecan, elastin, MMP11, MMP12, MMP13, MMP14, MMP15, fibrin MMP16, MMP17, MMP19, MMP20, MMP21, MMP23A, MMP23B, MMP24, MMP25, MMP26, MMP27, MMP28) Other modifiers Protein disulfide isomerases Proteins comprising two cysteine residues Glycosyltransferases, e.g., a-glucan-branching Protein comprising tyrosine, serine, glycosyltransferase, enzymatic branching factor, threonine, or asparagine glycosylation site branching glycosyltransferase, enzyme Q, glucosan transglycosylase, glycogen branching enzyme, amylose isomerase, plant branching enzyme, α-1,4-glucan: α-1,4-glucan-6-, glycosyltransferase, starch branching enzyme, UDP-N-acetyl-D-galactosamine, polypeptide, N-acetylgalactosaminyl- transferase, GDP-fucose protein O- fucosyltransferase 2, O-GlcNAc transferase Acetyltransferases or deacetylases, e.g., histone nucleosome-histone acetyltransferase, histone acetokinase, histone acetylase, histone transacetylase, histone deacetylase Acyltransferases Protein comprising an acyl group Phosphatases, e.g., protein-tyrosine-phosphatase, phosphoprotein phosphotyrosine phosphatase, phosphoprotein phosphatase (phosphotyrosine), phosphotyrosine histone phosphatase, protein phosphotyrosine phosphatase, tyrosylprotein phosphatase, phosphotyrosine protein phosphatase, phosphotyrosylprotein phosphatase, tyrosine O- phosphate phosphatase, PPT-phosphatase, PTPase, [phosphotyrosine]protein phosphatase, PTP-phosphatase Kinases, e.g., non-specific serine/threonine protein Protein comprising a serine or threonine kinase, Fas-activated serine/threonine kinase, Goodpasture antigen-binding protein kinase, IκB phosphorylation site kinase, cAMP-dependent protein kinase, cGMP- dependent protein kinase, protein kinase C, polo kinase, cyclin-dependent kinase, mitogen-activated protein kinase, mitogen-activated protein kinase kinase kinase, receptor protein serine/threonine kinase, dual-specificity kinase Gamma-carboxylases Protein comprising glutamic acid Methyltransferases Protein comprising a lysine methylation site; DNA; RNA Complement-factor inactivating moiety, e.g., Complement factor, e.g., C1, C2a, C4b, complement control protein, Factor H or Factor I C3, C3a, C3b, C5, C5a, C5b, C6, C7, C8, or C9 -
TABLE 6 Exemplary first exogenous polypeptides that interact with a target Polypeptide Exemplary target(s) CD16A IgG Fc CD14 LPS TLR4 LPS scFv Complement (e.g., C3 or C5) or cytokine (e.g., TNF-alpha or IL-6 or another cytokine of Table 1) Aquaporin 4 (AQP4) and variants Anti-AQP4 autoantibodies Phospholipase A2 receptor (PLA2R) and Anti-PLA2R variants (shortened domains & peptides) autoantibodies Acetylcholine receptor (AChR) and Anti-AChR variants (shortened domains & peptides) autoantibodies Insulin and variants (proinsulin, Anti-insulin preproinsulin, etc.) autoantibodies B2-glycoprotein 1 (b2GP1) and variants Anti-b2GP1 (shortened domains & peptides) autoantibodies ADAMTS13 and variants (shortened Anti-ADAMTS13 domains & peptides) autoantibodies GAD65 and variants (shortened Anti-GAD65 domains & peptides) autoantibodies Desmogleins, e.g., Desmoglein-3 or Anti-Desmoglein Desmoglein-1 and variants (shortened autoantibodies domains & peptides) Complement-factor binding moiety, Complement factor, e.g., C1, e.g., CD55 or CD46 C2a, C4b, C3, C3a, C3b, C5, C5a, C5b, C6, C7, C8, or C9 - The genes for TRAIL receptor agonists DR4.2 (SEQ ID 2) and DR5.2 (SEQ ID 5) were synthesized. The genes were cloned into a lentivirus vector (SBI) upstream of the gene for human glycophorin A and separated by a sequence encoding a 12-amino acid Gly-Ser (GGGSGGGSGGGS (SEQ ID NO: 19)) flexible linker and an HA epitope tag (YPYDVPDY (SEQ ID NO: 20)).
- Human CD34+ cells derived from mobilized peripheral blood cells from normal human donors were purchased frozen from AllCells Inc. Cells were thawed in PBS with 1% FBS. Cells were then cultured in StemSpan SFEM media with StemSpan CC100 Cytokine Mix at a density of 1E5 cells/mL. Media was swapped to differentiation media on day 5.
- Virus production protocol was conducted as follows. Briefly, HEK293T cells were seeded 24 hours before transfection. Cells were transfected with lentivector containing the construct along with packaging plasmids. A media swap was performed 24 hours after transfection and viruses were harvested 72 hours after transfection. On day 6 after thaw, cells were transduced with equal volumes of each virus in a 1:1 cell volume to virus volume ratio, and spinoculated at 845×g for 1.5 hours with 5-10 μg/ml of polybrene.
- Transduced cells were differentiated in defined media to erythroid lineage cells and to mature enucleated reticulocytes following the method of Hu et al., Blood 18 Apr. 2013 Vol 121, 16. In brief, the cell culture procedure was comprised of 3 phases. Composition of the base culture medium was Iscove's Modified Dulbecco's Medium, 2% human peripheral blood plasma, 3% human AB serum, 200 mg/mL Holohuman transferrin, 3 IU/mL heparin, and 10 mg/mL insulin. In the first phase (
day 0 to day 6), CD341 cells at a concentration of 10̂5/mL were cultured in the presence of 10 ng/mL stem cell factor, 1 ng/mL IL-3, and 3 IU/mL erythropoietin. In the second phase (day 7 to day 11), IL-3 was omitted from the culture medium. In the third phase that lasted until day 21, the cell concentration was adjusted to 10̂6/mL on day 11 and to 5×10̂6/mL on day 15, respectively. The medium for this phase was the base medium plus 3 IU/mL erythropoietin, and the concentration of transferrin was adjusted to 1 mg/mL. - Expression of the transgenes was monitored by labeling with soluble TRAIL R1 and TRAIL R2 (purchased from Sigma-Aldrich Inc.) that had been chemically conjugated to complementary fluorescent dyes Fluorescein and DyLight 650 and staining by flow cytometry. Expression levels of both ligands DR4.2 and DR5.2 were verified through flow cytometry.
- An apoptosis assay was conducted according to a modified version of Marconi et al., Cell Death and Disease 2013. In short, fully mature enucleated reticulocytes expressing DR4.2 and DR5.2 were incubated with CFSE-labeled Raji Cells for 24 hours at a 1:1 ratio. Afterwards cells were stained with annexin V and analyzed by flow cytometry. Apoptosis percentages were determined from CFSE positive Raji cells that also stained positive for annexin V.
- As shown in
FIG. 1 , when CFSE-labeled Raji cells were incubated with untransduced, DR4.2 transduced, DR5.2 transduced, or a mixture of DR4.2 transduced and DR5.2 transduced cultured reticulocytes, minimal cell death was observed over background. However, when CFSE-labeled Raji cells were incubated with cultured reticulocytes that had been simultaneously transduced with both DR4.2 and DR5.2 and thus express both proteins simultaneously, a significant amount of cell death was observed (equivalent to the maximal amount of TRAIL-induced apoptosis achievable in this assay with Raji cells—see, e.g. Marconi et al., Cell Death and Disease 2013). This data indicates that the coordinated action of TRAIL receptor agonists on the surface of a single engineered red blood cell is able to induce cell killing in a synergistic manner, relative to cells expressing single TRAIL receptor agonists and even a mixture of cells that each express a different TRAIL receptor agonist. - A cell population comprising TRAIL receptor agonists, and optionally further comprising a moiety that targets autoreactive immune cells, may be formulated in AS-3 additive solution and administered intravenously to a patient, e.g., a patient suffering from an autoimmune disease.
- The genes for anti-TNFa (SEQ ID 7), anti-IL6 (SEQ ID 6), CD14 (Uniprot #P08571), IFNGR1 (Uniprot #P15260), and IL12R1 (Uniprot #P42701) are synthesized by a commercial vendor. The genes are cloned into a lentivirus vector (SBI) upstream of the gene for human glycophorin A and separated by a sequence encoding a 12-amino acid Gly-Ser (GGGSGGGSGGGS (SEQ ID NO: 19)) flexible linker and an HA epitope tag (YPYDVPDY (SEQ ID NO: 20)).
- Human CD34+ cells can be cultured, and virus can be produced, as described in Example 1. Transduced cells are differentiated as described herein.
- To assess the expression of the transgenes, cells are labeled simultaneously with the ligands TNFa, IL-6, IFNg, and IL-12 (purchased from Life Technologies), as well as lipopolysaccharide (ThermoFisher), that are chemically conjugated to complementary fluorescent dyes. The cells are analyzed by flow cytometry to verify that (a) the agents are all expressed on the surface of the cell and (b) the agents are capable of binding to their target ligands.
- The cell population is formulated in AS-3 additive solution and administered intravenously to a patient who is developing sepsis. It is anticipated that the patient then exhibits an improvement in his symptoms as measured by a reduction in circulating cytokine levels, a reduction or prevention of vascular leak syndrome, and improved survival.
- In this Example, transgenic enucleated erythroid cells were used to capture and modify a target protein. The control cells and the experimental cells each comprise endogenous glycophorin A (GPA) in their membranes, which was used to bind the target protein. The experimental cells expressed an exogenous protein comprising surface-exposed IdeS fused to GPA as a membrane anchor. IdeS is capable of cleaving antibodies to produce a F(ab′)2 fragment and a Fc fragment. The target protein is an anti-GPA antibody that is fluorescently labelled with FITC. Both the constant and variable regions of the target antibody were FITC-labelled, so that if the antibody was cleaved, both fragments could be detected.
- First, the control cells and IdeS-expressing cells were tested by FACS for the ability to bind the anti-GPA antibody. Both control and IdeS-expressing cells bound the antibody as measured by association of FITC with the cells (data not shown). In addition, both control and IdeS-expressing cells bound the antibody as measured by or using a second detection method with a fluorescently labeled anti-rabbit Fc antibody (data not shown). These measurements were taken at an early timepoint, before cells were incubated to allow IdeS-mediated cleavage of the target antibody.
- In contrast, only the IdeS-expressing cells were able to cleave the target antibody. This was shown by incubating the control or IdeS-expressing cells with the target antibody to allow antibody cleavage to occur. Fluorescently labeled anti-rabbit Fc antibody was added to the reaction in order to detect intact antibodies on the surface of the erythroid cells. The IdeS-expressing cells showed a decrease in anti-rabbit Fc association with the cells (
FIG. 2 ), indicating lower levels of Fc on the surface of the IdeS-expressing cells compared to the control cells. There was no decrease in the amount of the directly FITC-labeled target antibody associated with control cells or IdeS-expressing cells, indicating that at least the FITC-labeled variable region of the target antibody still bound the IdeS-expressing and control cells. This result was confirmed by Western blot, where anti rabbit heavy chain and anti rabbit light chain antibodies were used to detect intact and cleaved antibody in the supernatant of control or IdeS-expressing cells. The experiment showed that IdeS-expressing erythroid cells but not control erythroid cells cleaved the anti-GPA-antibody, resulting in appearance of the heavy chain fragment (FIG. 3 ). - Thus, the control cells were able to bind the target antibody, but only the IdeS-expressing cells were able to bind and cleave the target antibody.
- When erythroid cells were engineered to simultaneously express anti-CD20 as well as Trail ligand (an apoptosis inducing agent), co-culture of Ramos cells with RCT-antiCD20, RCT-Trail, and RCT-antiCD20+Trail (co-expressed) exert 32%, 47% and 76% apoptosis respectively after 48 hours, suggesting a synergistic cell-killing effect of the co-expressing RCTs.
- A cell population comprising TRAIL ligand, anti-CD20 moeity, and optionally further comprising a moiety that specifically targets autoreactive immune cells, may be formulated in AS-3 additive solution and administered intravenously to a patient, e.g., a patient suffering from an autoimmune disease.
Claims (24)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/905,445 US20180187155A1 (en) | 2016-01-11 | 2018-02-26 | Compositions and methods related to multimodal therapeutic cell systems for autoimmune indications |
US17/528,422 US20220072048A1 (en) | 2016-01-11 | 2021-11-17 | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Autoimmune Indications |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662277130P | 2016-01-11 | 2016-01-11 | |
US201662359448P | 2016-07-07 | 2016-07-07 | |
US201662370915P | 2016-08-04 | 2016-08-04 | |
US201662420973P | 2016-11-11 | 2016-11-11 | |
PCT/US2017/013033 WO2017123644A1 (en) | 2016-01-11 | 2017-01-11 | Compositions and methods related to multimodal therapeutic cell systems for immune indications |
US15/905,445 US20180187155A1 (en) | 2016-01-11 | 2018-02-26 | Compositions and methods related to multimodal therapeutic cell systems for autoimmune indications |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2017/013033 Continuation WO2017123644A1 (en) | 2016-01-11 | 2017-01-11 | Compositions and methods related to multimodal therapeutic cell systems for immune indications |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/528,422 Continuation US20220072048A1 (en) | 2016-01-11 | 2021-11-17 | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Autoimmune Indications |
Publications (1)
Publication Number | Publication Date |
---|---|
US20180187155A1 true US20180187155A1 (en) | 2018-07-05 |
Family
ID=57907000
Family Applications (8)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/716,141 Expired - Fee Related US10456421B2 (en) | 2016-01-11 | 2017-09-26 | Compositions and methods related to engineered erythoid cells comprising 4-1BBL |
US15/905,445 Abandoned US20180187155A1 (en) | 2016-01-11 | 2018-02-26 | Compositions and methods related to multimodal therapeutic cell systems for autoimmune indications |
US15/906,873 Expired - Fee Related US10568910B2 (en) | 2016-01-11 | 2018-02-27 | Compositions and methods related to engineered erythroid cells comprising IL-15 |
US16/207,568 Active 2037-01-15 US10716811B2 (en) | 2016-01-11 | 2018-12-03 | Compositions and methods related to multimodal therapeutic cancer indications |
US16/574,830 Expired - Fee Related US10517897B1 (en) | 2016-01-11 | 2019-09-18 | Methods related to engineered erythoid cells comprising 4-1BBL |
US16/737,661 Abandoned US20200129556A1 (en) | 2016-01-11 | 2020-01-08 | Compositions and methods related to engineered erythroid cells comprising il-15 |
US17/528,422 Pending US20220072048A1 (en) | 2016-01-11 | 2021-11-17 | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Autoimmune Indications |
US18/159,229 Abandoned US20230293588A1 (en) | 2016-01-11 | 2023-01-25 | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Cancer Indications |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/716,141 Expired - Fee Related US10456421B2 (en) | 2016-01-11 | 2017-09-26 | Compositions and methods related to engineered erythoid cells comprising 4-1BBL |
Family Applications After (6)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/906,873 Expired - Fee Related US10568910B2 (en) | 2016-01-11 | 2018-02-27 | Compositions and methods related to engineered erythroid cells comprising IL-15 |
US16/207,568 Active 2037-01-15 US10716811B2 (en) | 2016-01-11 | 2018-12-03 | Compositions and methods related to multimodal therapeutic cancer indications |
US16/574,830 Expired - Fee Related US10517897B1 (en) | 2016-01-11 | 2019-09-18 | Methods related to engineered erythoid cells comprising 4-1BBL |
US16/737,661 Abandoned US20200129556A1 (en) | 2016-01-11 | 2020-01-08 | Compositions and methods related to engineered erythroid cells comprising il-15 |
US17/528,422 Pending US20220072048A1 (en) | 2016-01-11 | 2021-11-17 | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Autoimmune Indications |
US18/159,229 Abandoned US20230293588A1 (en) | 2016-01-11 | 2023-01-25 | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Cancer Indications |
Country Status (22)
Country | Link |
---|---|
US (8) | US10456421B2 (en) |
EP (3) | EP3402491B1 (en) |
JP (5) | JP7093302B2 (en) |
KR (2) | KR20180095713A (en) |
CN (3) | CN115969987A (en) |
AU (2) | AU2017207736A1 (en) |
BR (2) | BR112018013728A2 (en) |
CA (2) | CA3009063A1 (en) |
DK (1) | DK3402491T3 (en) |
ES (1) | ES2907695T3 (en) |
HK (1) | HK1259079A1 (en) |
HR (1) | HRP20220147T1 (en) |
HU (1) | HUE057660T2 (en) |
IL (2) | IL259991A (en) |
LT (1) | LT3402491T (en) |
MX (2) | MX2018008515A (en) |
PL (1) | PL3402491T3 (en) |
PT (1) | PT3402491T (en) |
RS (1) | RS62939B1 (en) |
SG (4) | SG11201805253SA (en) |
SI (1) | SI3402491T1 (en) |
WO (2) | WO2017123644A1 (en) |
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10301593B2 (en) | 2013-11-18 | 2019-05-28 | Rubius Therapeutics, Inc. | Synthetic membrane-receiver complexes |
US10456421B2 (en) | 2016-01-11 | 2019-10-29 | Rubius Therapeutics, Inc. | Compositions and methods related to engineered erythoid cells comprising 4-1BBL |
US10869898B2 (en) | 2014-04-01 | 2020-12-22 | Rubius Therapeutics, Inc. | Methods and compositions for immunomodulation |
US11020435B2 (en) | 2017-02-17 | 2021-06-01 | Rubius Therapeutics, Inc. | Functionalized erythroid cells |
Families Citing this family (68)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2764105T3 (en) | 2011-10-17 | 2020-06-02 | Massachusetts Inst Technology | Intracellular administration |
AU2014306423B2 (en) | 2013-08-16 | 2019-04-18 | Massachusetts Institute Of Technology | Selective delivery of material to cells |
SG11201703044PA (en) | 2014-10-31 | 2017-05-30 | Massachusetts Inst Technology | Delivery of biomolecules to immune cells |
CN107002089B (en) | 2014-11-14 | 2021-09-07 | 麻省理工学院 | Disruption and field-effected delivery of compounds and compositions into cells |
WO2016115179A1 (en) | 2015-01-12 | 2016-07-21 | Massachusetts Institute Of Technology | Gene editing through microfluidic delivery |
EP3320082B1 (en) | 2015-07-09 | 2023-05-24 | Massachusetts Institute of Technology | Delivery of materials to anucleate cells |
US11613759B2 (en) | 2015-09-04 | 2023-03-28 | Sqz Biotechnologies Company | Intracellular delivery of biomolecules to cells comprising a cell wall |
US20210228738A1 (en) * | 2017-07-17 | 2021-07-29 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Compositions and methods for increasing or enhancing transduction of gene therapy vectors and for removing or reducing immunoglobulins |
US10960071B2 (en) | 2017-08-07 | 2021-03-30 | The Regents Of The University Of California | Platform for generating safe cell therapeutics |
EP3664830A4 (en) | 2017-08-07 | 2020-07-01 | The Regents of the University of California | Platform for generating safe cell therapeutics |
CA3071881A1 (en) * | 2017-09-07 | 2019-03-14 | Cue Biopharma, Inc. | Antigen-presenting polypeptides and methods of use thereof |
CN111655292A (en) * | 2017-12-07 | 2020-09-11 | 旗舰先锋创新V股份有限公司 | Cellular biologicals and therapeutic uses thereof |
US20190290686A1 (en) * | 2017-12-23 | 2019-09-26 | Rubius Therapeutics, Inc. | Artificial antigen presenting cells and methods of use |
AU2019232012A1 (en) * | 2018-03-08 | 2020-09-24 | Rubius Therapeutics, Inc. | Therapeutic cell systems and methods for treating cancer and infectious diseases |
WO2019226922A1 (en) * | 2018-05-24 | 2019-11-28 | Rush University Medical Center | Icosl for use as a renal therapeutic |
US11166996B2 (en) | 2018-12-12 | 2021-11-09 | Flagship Pioneering Innovations V, Inc. | Anellovirus compositions and methods of use |
US20220112489A1 (en) | 2019-01-18 | 2022-04-14 | Flagship Pioneering, Inc. | Trem compositions and uses thereof |
WO2020172472A1 (en) * | 2019-02-20 | 2020-08-27 | Rubius Therapeutics, Inc. | Engineered erythroid cells including loadable antigen-presenting polypeptides and methods of use |
KR20210135265A (en) | 2019-03-04 | 2021-11-12 | 플래그쉽 파이어니어링 이노베이션스 브이아이, 엘엘씨 | Circular polyribonucleotides and pharmaceutical compositions thereof |
US20200299369A1 (en) * | 2019-03-18 | 2020-09-24 | Bio-Rad Abd Serotec Gmbh | Antigen binding fragments conjugated to a plurality of fc isotypes and subclasses |
EP3946466A2 (en) | 2019-03-25 | 2022-02-09 | Flagship Pioneering Innovations VI, LLC | Compositions comprising modified circular polyribonucleotides and uses thereof |
EP3963092A1 (en) * | 2019-05-02 | 2022-03-09 | Predictive Technology Group, Inc. | Somatic cancer driver mutations in endometriosis lesions contribute to secondary cancer risk |
CN114269921A (en) | 2019-05-31 | 2022-04-01 | 旗舰创业股份有限公司 | Use of TREM compositions to modulate tRNA cells |
WO2020252436A1 (en) | 2019-06-14 | 2020-12-17 | Flagship Pioneering Innovations Vi, Llc | Circular rnas for cellular therapy |
US20220305128A1 (en) | 2019-06-19 | 2022-09-29 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising circular polyribonucleotides for protein modulation and uses thereof |
CN112195154B (en) * | 2019-07-08 | 2024-03-29 | 江苏汇智生物科技有限公司 | Cell for genetically modifying and expressing modified PLA2R receptor and application thereof |
WO2021046424A2 (en) | 2019-09-05 | 2021-03-11 | Hemanext Inc. | Methods for the preservation of reagent red blood cells using carbon monoxide |
CN114746545A (en) * | 2019-10-18 | 2022-07-12 | 西湖生物医药科技(杭州)有限公司 | Engineered erythrocytes using artificial MHC to present specific cancer neoantigens |
AU2020379762A1 (en) | 2019-11-04 | 2022-05-26 | Flagship Pioneering, Inc. | TREM compositions for con-rare codons and related uses |
US20220364075A1 (en) | 2019-11-04 | 2022-11-17 | Flagship Pioneering, Inc. | Methods of modifying a nucleic acid sequence |
EP4096681A1 (en) | 2020-01-29 | 2022-12-07 | Flagship Pioneering Innovations VI, LLC | Delivery of compositions comprising circular polyribonucleotides |
TW202142689A (en) | 2020-01-29 | 2021-11-16 | 美商旗艦先鋒創新有限責任公司 | Compositions for translation and methods of use thereof |
WO2021155177A1 (en) | 2020-01-29 | 2021-08-05 | Flagship Pioneering Innovations Vi, Llc | Compositions comprising linear polyribonucleotides for protein modulation and uses thereof |
WO2021158991A1 (en) * | 2020-02-07 | 2021-08-12 | The Regents Of The University Of California | Methods and use for bioengineering enucleated cells |
EP4153152A1 (en) | 2020-05-20 | 2023-03-29 | Flagship Pioneering Innovations VI, LLC | Compositions and methods for producing human polyclonal antibodies |
CA3179420A1 (en) | 2020-05-20 | 2021-11-25 | Avak Kahvejian | Coronavirus antigen compositions and their uses |
JP2023526423A (en) | 2020-05-20 | 2023-06-21 | フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー | Immunogenic compositions and uses thereof |
WO2021243301A2 (en) | 2020-05-29 | 2021-12-02 | Flagship Pioneering Innovations Vi, Llc. | Trem compositions and methods relating thereto |
JP2023527413A (en) | 2020-05-29 | 2023-06-28 | フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー | TREM compositions and related methods |
US20230233514A1 (en) | 2020-06-23 | 2023-07-27 | Flagship Pioneering, Inc. | Antiviral compounds and methods of using the same |
WO2022051629A1 (en) | 2020-09-03 | 2022-03-10 | Flagship Pioneering Innovations Vi, Llc | Immunogenic compositions and uses thereof |
JP2024501288A (en) | 2020-12-23 | 2024-01-11 | フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー | Compositions of modified TREM and uses thereof |
TW202241471A (en) | 2021-01-08 | 2022-11-01 | 美商盧比亞斯治療公司 | Methods of increasing nkp30-positive lymphocytes in a subject and uses thereof |
AU2022227018A1 (en) * | 2021-02-26 | 2023-10-05 | Cytonus Therapeutics, Inc. | Compositions and methods for therapeutic delivery |
WO2022197548A1 (en) | 2021-03-14 | 2022-09-22 | Rubius Therapeutics, Inc. | Methods of increasing nkg2d-positive lymphocytes in a subject and uses thereof |
US20220325287A1 (en) | 2021-03-31 | 2022-10-13 | Flagship Pioneering Innovations V, Inc. | Thanotransmission polypeptides and their use in treating cancer |
EP4377457A1 (en) | 2021-07-26 | 2024-06-05 | Flagship Pioneering Innovations VI, LLC | Trem compositions and uses thereof |
TW202330916A (en) | 2021-09-17 | 2023-08-01 | 美商旗艦先鋒創新有限責任公司 | Compositions and methods for producing circular polyribonucleotides |
WO2023064383A1 (en) * | 2021-10-12 | 2023-04-20 | Cytonus Therapeutics, Inc. | Systems and methods for manufacturing of therapeutic cells |
AU2022370530A1 (en) | 2021-10-18 | 2024-05-02 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for purifying polyribonucleotides |
CA3239266A1 (en) | 2021-11-24 | 2023-06-01 | Flagship Pioneering Innovations Vi, Llc | Coronavirus immunogen compositions and their uses |
AU2022397292A1 (en) | 2021-11-24 | 2024-05-30 | Flagship Pioneering Innovations Vi, Llc | Varicella-zoster virus immunogen compositions and their uses |
CA3238735A1 (en) | 2021-11-24 | 2023-06-01 | Jennifer A. Nelson | Immunogenic compositions and their uses |
WO2023122745A1 (en) | 2021-12-22 | 2023-06-29 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for purifying polyribonucleotides |
WO2023122789A1 (en) | 2021-12-23 | 2023-06-29 | Flagship Pioneering Innovations Vi, Llc | Circular polyribonucleotides encoding antifusogenic polypeptides |
WO2023220083A1 (en) | 2022-05-09 | 2023-11-16 | Flagship Pioneering Innovations Vi, Llc | Trem compositions and methods of use for treating proliferative disorders |
WO2023220729A2 (en) | 2022-05-13 | 2023-11-16 | Flagship Pioneering Innovations Vii, Llc | Double stranded dna compositions and related methods |
WO2023230549A2 (en) | 2022-05-25 | 2023-11-30 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for modulation of tumor suppressors and oncogenes |
WO2023230566A2 (en) | 2022-05-25 | 2023-11-30 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for modulating cytokines |
WO2023230573A2 (en) | 2022-05-25 | 2023-11-30 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for modulation of immune responses |
WO2023230570A2 (en) | 2022-05-25 | 2023-11-30 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for modulating genetic drivers |
WO2023230578A2 (en) | 2022-05-25 | 2023-11-30 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for modulating circulating factors |
WO2023250112A1 (en) | 2022-06-22 | 2023-12-28 | Flagship Pioneering Innovations Vi, Llc | Compositions of modified trems and uses thereof |
WO2024059740A1 (en) * | 2022-09-14 | 2024-03-21 | Synthego Corporation | Genetically modified polynucleotides and cells expressing modified mhc proteins and uses thereof |
US20240174732A1 (en) | 2022-10-05 | 2024-05-30 | Flagship Pioneering Innovations V, Inc. | Nucleic acid molecules encoding trif and additional polypeptides and their use in treating cancer |
WO2024097664A1 (en) | 2022-10-31 | 2024-05-10 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for purifying polyribonucleotides |
WO2024102799A1 (en) | 2022-11-08 | 2024-05-16 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for producing circular polyribonucleotides |
WO2024129988A1 (en) | 2022-12-14 | 2024-06-20 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for delivery of therapeutic agents to bone |
Family Cites Families (39)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU6827094A (en) * | 1993-05-07 | 1994-12-12 | Immunex Corporation | Cytokine designated 4-1bb ligand and human receptor that binds thereto |
JP3614866B2 (en) | 1997-06-12 | 2005-01-26 | リサーチ コーポレイション テクノロジーズ,インコーポレイティド | Artificial antibody polypeptide |
US20020151004A1 (en) * | 2000-07-24 | 2002-10-17 | Roger Craig | Delivery vehicles and methods for using the same |
EP2141243A3 (en) | 2000-10-16 | 2010-01-27 | Brystol-Myers Squibb Company | Protein scaffolds for antibody mimics and other binding proteins |
WO2004087876A2 (en) * | 2003-03-25 | 2004-10-14 | Valeocyte Therapies Llc | Use of red blood cells to facilitate cell activation |
DE10335833A1 (en) * | 2003-08-05 | 2005-03-03 | Curevac Gmbh | Transfection of blood cells with mRNA for immune stimulation and gene therapy |
FR2873925B1 (en) | 2004-08-05 | 2006-10-13 | Erytech Pharma Soc Par Actions | METHOD AND DEVICE FOR LYSE-RESCALING FOR THE INCORPORATION OF ACTIVE PRINCIPLE, IN PARTICULAR ASPARAGINASE OR INOSITOL HEXAPHOSPHATE, IN ERYTHROCYTES |
FR2884717B1 (en) | 2005-04-25 | 2009-07-03 | Erytech Pharma Soc Par Actions | ERYTHROCYTES CONTAINING ARGININE DEIMINASE |
MX2007014474A (en) | 2005-05-17 | 2008-02-07 | Univ Connecticut | Compositions and methods for immunomodulation in an organism. |
WO2007030708A2 (en) | 2005-09-08 | 2007-03-15 | Adnexus Therapeutics, Inc. | Antimicrobial adzymes and uses thereof |
US7462485B2 (en) | 2005-10-07 | 2008-12-09 | Glaser Lawrence F | Modified erythrocytes and uses thereof |
FR2919804B1 (en) | 2007-08-08 | 2010-08-27 | Erytech Pharma | COMPOSITION AND ANTI-TUMOR THERAPEUTIC VACCINE |
FR2925339B1 (en) | 2007-12-24 | 2010-03-05 | Erytech Pharma | DRUG FOR THE TREATMENT OF PANCREATIC CANCER |
EP2242507B1 (en) | 2008-02-13 | 2013-02-20 | Erytech Pharma | Formulation and method for the prevention and treatment of skeletal manifestation of gaucher's disease |
FR2928270B1 (en) | 2008-03-10 | 2011-01-21 | Erytech Pharma | FORMULATION METHOD FOR THE PREVENTION OR TREATMENT OF BONE METASTASES AND OTHER BONE DISEASES |
US8211656B2 (en) * | 2008-08-13 | 2012-07-03 | The Invention Science Fund I, Llc | Biological targeting compositions and methods of using the same |
FR2938332B1 (en) | 2008-11-07 | 2011-11-25 | Erytech Pharma | PREDICTIVE TEST FOR NEUTRALIZATION OF ASPARAGINASE ACTIVITY |
FR2944106B1 (en) | 2009-04-03 | 2012-09-28 | Erytech Pharma | METHOD OF DETERMINING INOSITOL HEXAPHOSPHATE (IHP). |
CA2778669C (en) | 2009-10-27 | 2019-04-16 | Erytech Pharma | Composition to induce specific immune tolerance |
JP6017422B2 (en) * | 2010-08-10 | 2016-11-02 | エコール・ポリテクニーク・フェデラル・ドゥ・ローザンヌ(ウペエフエル)Ecole Polytechnique Federale de Lausanne (EPFL) | Erythrocyte binding therapy |
AU2013203832B2 (en) | 2012-03-13 | 2016-09-15 | Celularity Inc. | Modified erythrocyte precursor cells and uses thereof |
CN104394884A (en) | 2012-03-21 | 2015-03-04 | 爱瑞泰克药物公司 | Medicament for the treatment of acute myeloid leukemia (AML) |
CN103224957B (en) | 2013-04-16 | 2017-08-04 | 福建三一造血技术有限公司 | The method of external evoked generation ASPase containing L II red blood cell medicine |
FR3005420B1 (en) | 2013-05-07 | 2015-09-18 | Erytech Pharma | METHOD OF STABILIZING SUSPENSIONS OF ERYTHROCYTES ENCAPSULATING AN ACTIVE INGREDIENT, SUSPENSIONS OBTAINED |
ES2901383T3 (en) | 2013-05-10 | 2022-03-22 | Whitehead Inst Biomedical Res | In vitro production of red blood cells with sortase-markable proteins |
US10260038B2 (en) | 2013-05-10 | 2019-04-16 | Whitehead Institute For Biomedical Research | Protein modification of living cells using sortase |
EP2813234A1 (en) | 2013-06-11 | 2014-12-17 | Erytech Pharma | Composition of erythrocytes encapsulating phenylalanine hydroxylase and therapeutic use thereof |
CA2930665A1 (en) | 2013-11-18 | 2015-05-21 | Rubius Therapeutics, Inc. | Synthetic membrane-receiver complexes |
FR3017299B1 (en) | 2014-02-12 | 2018-05-18 | Erytech Pharma | PHARMACEUTICAL COMPOSITION COMPRISING ERYTHROCYTES ENCAPSULATING A PLP ENZYME AND ITS COFACTOR |
CA2944492A1 (en) | 2014-04-01 | 2015-10-08 | Rubius Therapeutics, Inc. | Methods and compositions for immunomodulation |
WO2016183482A1 (en) * | 2015-05-13 | 2016-11-17 | Rubius Therapeutics, Inc. | Membrane-receiver complex therapeutics |
EP3187190A1 (en) | 2015-12-31 | 2017-07-05 | Erytech Pharma | Method of treating a mammal, including human, against cancer using methionine and asparagine depletion |
SG11201805253SA (en) | 2016-01-11 | 2018-07-30 | Rubius Therapeutics Inc | Compositions and methods related to multimodal therapeutic cell systems for cancer indications |
US20190161730A1 (en) | 2016-07-07 | 2019-05-30 | Rubius Therapeutics, Inc. | Compositions and methods related to therapeutic cell systems expressing exogenous rna |
US20180153989A1 (en) * | 2016-12-02 | 2018-06-07 | Rubius Therapeutics, Inc. | Compositions and methods related to cell systems for penetrating solid tumors |
EP3583202A1 (en) | 2017-02-17 | 2019-12-25 | Rubius Therapeutics, Inc. | Functionalized erythroid cells |
US20190062788A1 (en) | 2017-08-22 | 2019-02-28 | Rubius Therapeutics, Inc. | Lipid nanoparticle methods and compositions for producing engineered erythroid cells |
US20190160102A1 (en) | 2017-11-03 | 2019-05-30 | Rubius Therapeutics, Inc. | Compositions and methods related to therapeutic cell systems for tumor growth inhibition |
WO2019133881A1 (en) | 2017-12-29 | 2019-07-04 | Rubius Therapeutics, Inc. | Gene editing and targeted transcriptional modulation for enginerering erythroid cells |
-
2017
- 2017-01-11 SG SG11201805253SA patent/SG11201805253SA/en unknown
- 2017-01-11 HU HUE17701776A patent/HUE057660T2/en unknown
- 2017-01-11 KR KR1020187022906A patent/KR20180095713A/en unknown
- 2017-01-11 AU AU2017207736A patent/AU2017207736A1/en active Pending
- 2017-01-11 MX MX2018008515A patent/MX2018008515A/en unknown
- 2017-01-11 CN CN202211081626.0A patent/CN115969987A/en not_active Withdrawn
- 2017-01-11 BR BR112018013728A patent/BR112018013728A2/en not_active Application Discontinuation
- 2017-01-11 PL PL17701776T patent/PL3402491T3/en unknown
- 2017-01-11 CN CN201780006113.4A patent/CN108697733A/en active Pending
- 2017-01-11 AU AU2017207738A patent/AU2017207738A1/en active Pending
- 2017-01-11 MX MX2018008514A patent/MX2018008514A/en unknown
- 2017-01-11 CA CA3009063A patent/CA3009063A1/en active Pending
- 2017-01-11 ES ES17701776T patent/ES2907695T3/en active Active
- 2017-01-11 PT PT177017761T patent/PT3402491T/en unknown
- 2017-01-11 SG SG10201913837TA patent/SG10201913837TA/en unknown
- 2017-01-11 EP EP17701776.1A patent/EP3402491B1/en active Active
- 2017-01-11 RS RS20220172A patent/RS62939B1/en unknown
- 2017-01-11 WO PCT/US2017/013033 patent/WO2017123644A1/en active Application Filing
- 2017-01-11 EP EP21216483.4A patent/EP4019026A1/en not_active Withdrawn
- 2017-01-11 KR KR1020187022922A patent/KR20180095098A/en unknown
- 2017-01-11 CA CA3010510A patent/CA3010510A1/en active Pending
- 2017-01-11 JP JP2018535844A patent/JP7093302B2/en active Active
- 2017-01-11 EP EP17703498.0A patent/EP3402492B1/en active Active
- 2017-01-11 SG SG11201805442XA patent/SG11201805442XA/en unknown
- 2017-01-11 LT LTEPPCT/US2017/013035T patent/LT3402491T/en unknown
- 2017-01-11 JP JP2018535851A patent/JP2019501655A/en active Pending
- 2017-01-11 DK DK17701776.1T patent/DK3402491T3/en active
- 2017-01-11 HR HRP20220147TT patent/HRP20220147T1/en unknown
- 2017-01-11 SG SG10202007639SA patent/SG10202007639SA/en unknown
- 2017-01-11 SI SI201731074T patent/SI3402491T1/en unknown
- 2017-01-11 BR BR112018013853A patent/BR112018013853A2/en not_active Application Discontinuation
- 2017-01-11 CN CN201780006086.0A patent/CN108778298A/en active Pending
- 2017-01-11 WO PCT/US2017/013035 patent/WO2017123646A1/en active Application Filing
- 2017-09-26 US US15/716,141 patent/US10456421B2/en not_active Expired - Fee Related
-
2018
- 2018-02-26 US US15/905,445 patent/US20180187155A1/en not_active Abandoned
- 2018-02-27 US US15/906,873 patent/US10568910B2/en not_active Expired - Fee Related
- 2018-06-13 IL IL259991A patent/IL259991A/en unknown
- 2018-06-13 IL IL260010A patent/IL260010A/en unknown
- 2018-12-03 US US16/207,568 patent/US10716811B2/en active Active
-
2019
- 2019-01-29 HK HK19101579.6A patent/HK1259079A1/en unknown
- 2019-09-18 US US16/574,830 patent/US10517897B1/en not_active Expired - Fee Related
-
2020
- 2020-01-08 US US16/737,661 patent/US20200129556A1/en not_active Abandoned
-
2021
- 2021-03-01 JP JP2021031998A patent/JP2021078519A/en active Pending
- 2021-05-13 JP JP2021081727A patent/JP2021112216A/en active Pending
- 2021-11-17 US US17/528,422 patent/US20220072048A1/en active Pending
-
2022
- 2022-09-16 JP JP2022148073A patent/JP2022171843A/en not_active Withdrawn
-
2023
- 2023-01-25 US US18/159,229 patent/US20230293588A1/en not_active Abandoned
Cited By (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10301593B2 (en) | 2013-11-18 | 2019-05-28 | Rubius Therapeutics, Inc. | Synthetic membrane-receiver complexes |
US10301594B1 (en) | 2013-11-18 | 2019-05-28 | Rubius Therapeutics, Inc | Synthetic membrane-receiver complexes |
US10344263B2 (en) | 2013-11-18 | 2019-07-09 | Rubius Therapeutics, Inc. | Synthetic membrane-receiver complexes |
US10557119B2 (en) | 2013-11-18 | 2020-02-11 | Rubius Therapeutics, Inc. | Erythroid cells comprising phenylalanine ammonia lyase |
US10869898B2 (en) | 2014-04-01 | 2020-12-22 | Rubius Therapeutics, Inc. | Methods and compositions for immunomodulation |
US11554141B2 (en) | 2014-04-01 | 2023-01-17 | Rubius Therapeutics, Inc. | Methods and compositions for immunomodulation |
US11576934B2 (en) | 2014-04-01 | 2023-02-14 | Rubius Therapeutics, Inc. | Methods and compositions for immunomodulation |
US10456421B2 (en) | 2016-01-11 | 2019-10-29 | Rubius Therapeutics, Inc. | Compositions and methods related to engineered erythoid cells comprising 4-1BBL |
US10517897B1 (en) | 2016-01-11 | 2019-12-31 | Rubius Therapeutics, Inc. | Methods related to engineered erythoid cells comprising 4-1BBL |
US10568910B2 (en) | 2016-01-11 | 2020-02-25 | Rubius Therapeutics, Inc. | Compositions and methods related to engineered erythroid cells comprising IL-15 |
US11020435B2 (en) | 2017-02-17 | 2021-06-01 | Rubius Therapeutics, Inc. | Functionalized erythroid cells |
Also Published As
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220072048A1 (en) | Compositions and Methods Related to Multimodal Therapeutic Cell Systems for Autoimmune Indications | |
JP7331075B2 (en) | synTac polypeptides and uses thereof | |
WO2019118518A2 (en) | Inducible cell receptors for cell-based therapeutics | |
US20200172868A1 (en) | Compositions and methods related to multimodal therapeutic cell systems for infectious disease | |
US20200172867A1 (en) | Compositions and methods related to multimodal therapeutic cell systems for cardiometabolic disease |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
AS | Assignment |
Owner name: FLAGSHIP PIONEERING, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KAHVEJIAN, AVAK;MATA-FINK, JORDI;ROUND, JOHN;AND OTHERS;SIGNING DATES FROM 20180208 TO 20180215;REEL/FRAME:055390/0507 Owner name: RUBIUS THERAPEUTICS, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:FLAGSHIP PIONEERING, INC.;REEL/FRAME:055390/0733 Effective date: 20180214 Owner name: RUBIUS THERAPEUTICS, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DEANS, ROBERT J.;CHEN, TIFFANY F.;NISSEN, TORBEN STRAIGHT;AND OTHERS;SIGNING DATES FROM 20171130 TO 20180208;REEL/FRAME:055391/0052 Owner name: RUBIUS THERAPEUTICS, INC., MASSACHUSETTS Free format text: CONFIRMATORY ASSIGNMENT;ASSIGNOR:FLAGSHIP PIONEERING, INC.;REEL/FRAME:055399/0403 Effective date: 20180405 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |