US20180009906A1 - METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY - Google Patents

METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY Download PDF

Info

Publication number
US20180009906A1
US20180009906A1 US15/676,641 US201715676641A US2018009906A1 US 20180009906 A1 US20180009906 A1 US 20180009906A1 US 201715676641 A US201715676641 A US 201715676641A US 2018009906 A1 US2018009906 A1 US 2018009906A1
Authority
US
United States
Prior art keywords
seq
amino acid
sequence represented
acid sequence
cdr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/676,641
Inventor
Reiko Shinkura
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cured Inc
Original Assignee
Cured Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cured Inc filed Critical Cured Inc
Priority to US15/676,641 priority Critical patent/US20180009906A1/en
Assigned to KANSAI BUNRI SOGO GAKUEN reassignment KANSAI BUNRI SOGO GAKUEN ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: SHINKURA, Reiko
Assigned to CURED INC. reassignment CURED INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: KANSAI BUNRI SOGO GAKUEN
Publication of US20180009906A1 publication Critical patent/US20180009906A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04Antibacterial agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-negative bacteria
    • C07K16/1228Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-negative bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues

Definitions

  • the present invention relates to a monoclonal IgA antibody, an orally or enterally administered composition containing the monoclonal IgA antibody, and a pharmaceutical composition containing the monoclonal IgA antibody.
  • gut microbiota For a living body, the inside of the intestinal tract is equivalent to the outside of the body and is always exposed to a very wide variety and large number of intestinal indigenous bacteria, viruses, and antigens derived from, for example, food. These intestinal indigenous bacteria form gut microbiota (hereinafter “gut microbiota” may be referred to as “intestinal bacterial flora”).
  • Non-patent Literature (NPL) 1 to 3 Non-patent Literature
  • Non-patent Literature (NPL) 4 to 7 Non-patent Literature
  • the surface of mucosal tissue in the gastrointestinal tract is a route by which antigens, such as indigenous bacteria, pathogenic microorganisms, and allergens invade a living body.
  • antigens such as indigenous bacteria, pathogenic microorganisms, and allergens invade a living body.
  • the surface of mucosal tissue is continuously attacked as the site where these many pathogenic microorganisms from the external environment invade, and is exposed to various antigens.
  • the system for recognizing and/or responding to foreign antigens, including these pathogenic microorganisms, is called the mucosal immune system.
  • Many cells that are responsible for mucosal immune system are present immediately below the surface of mucosal tissue in the gastrointestinal tract. These cells form a dynamic immune organization by which an immune response occurs against pathogenic microorganisms, food antigens, allergens, exogenous foreign antigens, and the like.
  • the mucosal immune system constructs unique immune system that is based on an IgA antibody derived from an intestine against foreign exogenous antigens taken up through the mucosal surface constructed with intestinal epithelial cells.
  • the intestine-derived IgA antibody is produced not only within specific tissues that are sites of immune response, such as Peyer's patches, mesenteric lymph nodes, and isolated lymphoid follicles, in a T-cell-dependent manner, but also produced in a large amount by antibody-producing cells disseminated among the intestinal lamina limbal, and 9).
  • One of the functions of the intestine-derived IgA antibody is to eliminate pathogens.
  • the intestine-derived IgA antibody secreted into the lumen binds to pathogens and their toxins in the intestinal lumen and neutralizes them.
  • the intestine-derived IgA antibody binds to pathogens, toxins, etc., that invade intestinal epithelial cells, lamina intestinal, and the like, and neutralizes them while eliminating them as the intestine-derived IgA antibody itself is secreted into the lumen.
  • a feature of the function of intestine-derived IgA antibody is that they do not cause inflammatory reactions, unlike reactions of the systemic immune system in which general antibodies are involved (Non-patent Literature (NPL) 10 to 12).
  • intestine-derived IgA antibody Another function of intestine-derived IgA antibody is to maintain the symbiotic relationship between intestinal indigenous bacteria and their hosts.
  • An intestine-derived IgA antibody recognizes and binds to not only pathogens but also indigenous bacteria to prevent excessive entry of indigenous bacteria into the mucous membrane.
  • indigenous bacteria are not eliminated by intestine-derived IgA, and that intestine-derived IgA antibodies binding to indigenous bacteria are localized in the mucin layer on epithelial cells and form a biological film with the indigenous bacteria, in which the biological film prevents pathogens from contacting or invading the epithelial cells (Non-patent Literature (NPL) 13 and 14).
  • somatic hypermutation and class switching of antibody are known to play an important role to construct, in particular, the humoral immune system.
  • Somatic hypermutation is a mechanism that is provided in vivo so as to diversify the immunoglobulin gene of antibody-producing B cells and produce high-affinity antibodies.
  • Antibody class switching is a phenomenon in which the structure of the H-chain constant region is changed while the variable region of the antibody is maintained.
  • antibody class switching is a phenomenon in which the class of immunoglobulin generated from a selected cell producing an IgM antibody is changed to different classes of immunoglobulins, such as IgG, IgE, and IgA, with the same variable region as the IgM.
  • AID-G23S which carries one amino acid substitution (glycine to serine) at position 23 of the AID protein
  • class switching occurs, and antibodies of each class are sufficiently produced.
  • somatic hypermutation does not occur, and antigen binding ability of the antibodies is reduced in an AID G23S mouse (Non-Patent literature (NPL) 18).
  • Inflammatory bowel disease is difficult to cure and is thus specified as an intractable disease.
  • This disease is an example of diseases caused by disruption of the balance between the host immune system and intestinal bacteria, i.e., alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota (“alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota” may be refer to as “dysbiosis”).
  • this disease is treated by systemic administration of an immunosuppressant agent, such as a steroid and an anti-TNF antibody.
  • an immunosuppressant agent such as a steroid and an anti-TNF antibody.
  • these drugs require long-term administration, and a significant problem of side effects arises from these drugs. Therefore, it is desired that a medicinal drug that has reduced side effects and that is effective in treating or preventing intestinal diseases, such as inflammatory bowel disease, is developed.
  • NPL 1 Cerf-Bensussan N and Gaboriau-Routhiau V, Nat Rev Immunol 2010; 10:735
  • NPL 2 Hooper L V and Macpherson A J, Nat Rev Immunol 2010; 10:159
  • NPL 3 Round J L and Mazmanian S K, Proc Natl Acad Sci USA 2010; 107:12204
  • NPL 4 Vijay-Kumar M et al., Science 2010; 328:228
  • NPL 5 Shulzhenko N et al., Nat Med 2011; 17:1585
  • NPL 7 Turnbaugh P J et al., Nature 2006; 444:1027
  • NPL 9 Fagarasan S et al., Annu Rev Immunol 2010; 28:243
  • NPL 13 Phalipon A et al., Immunity 2002; 17:107
  • NPL 14 Macpherson A J and Uhr T, Science 2004; 303:1662
  • NPL 15 Shinkura R et al., Nat Immunol 2004; 5:707
  • NPL 16 Ta V T et al., Nat Immunol 2003; 4:843
  • NPL 17 Chaudhuri J et al. Nature 2003; 422:726
  • NPL 18 Wei M et al., Nature Immunology 12(3), 264-270, 2011
  • the present inventor conducted extensive research to solve the above problems and found that a monoclonal IgA antibody that specifically binds to a particular region of a protein having a particular amino acid sequence has effects to suppress an excessive response in the intestinal immune system and to make recovery from reduction of crypts in the lamina intestinal in the large intestine. These effects of a monoclonal IgA antibody were confirmed by orally administering the antibody to an individual.
  • Item 1 A monoclonal IgA antibody that binds to amino acids 11 to 333 of serine hydroxymethyltransferase.
  • the embodiment of the invention described in Item 1 broadly includes the embodiments of monoclonal IgA antibody described in the following Items 1-1 to 1-17.
  • Item 1-1 The monoclonal IgA antibody according to Item 1, wherein the monoclonal IgA antibody binds to amino acids 25 to 44 of serine hydroxymethyltransferase.
  • Item 1-2 The monoclonal IgA antibody according to Item 1, wherein the monoclonal IgA antibody binds to amino acids 25 to 28 of serine hydroxymethyltransferase.
  • Item 1-3 The monoclonal IgA antibody according to Item 1, 1-1, or 1-2, wherein the monoclonal IgA antibody comprises a heavy chain variable region containing
  • Item 1-4 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-3, wherein the monoclonal IgA antibody comprises a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, 12, 22, 32, or 42, and/or a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7, 17, 27, 37, or 47.
  • Item 1-5 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-4, wherein the monoclonal IgA antibody comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31, or 41, and/or a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46.
  • Item 1-6 The monoclonal IgA antibody according to any one of items 1 and 1-1 to 1-5, wherein the monoclonal IgA antibody inhibits the growth of at least two kinds of intestinal bacteria.
  • Item 1-7 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-6, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 1-8 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-7, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 1-9 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-8, wherein the monoclonal IgA antibody is IgA 1 or IgA 2 .
  • Item 1-10 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-9, wherein the monoclonal IgA antibody contains a chain-containing polymer.
  • Item 1-11 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-10, wherein the monoclonal IgA antibody contains a secretory component.
  • Item 1-12 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-11, wherein the monoclonal IgA antibody has an amino acid sequence derived from the same species.
  • Item 1-13 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-12, wherein the monoclonal IgA antibody has an amino acid sequence derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 1-14 The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-11, wherein the monoclonal IgA antibody has amino acid sequences derived from different species.
  • Item 1-15 The monoclonal IgA antibody according to any one of Items 1, 1-1 to 1-11, and 1-14, wherein the monoclonal IgA antibody has amino acid sequences derived from at least two species selected from the group consisting of a mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, monkey, chicken, chimpanzee, and human.
  • Item 1-16 The monoclonal IgA antibody according to any one of Items 1, 1-1 to 1-11, 1-14, and 1-15, wherein the monoclonal IgA antibody is a humanized antibody.
  • Item 1-17 The monoclonal IgA antibody according to any one of Items 1, 1-1 to 1-11, 1-14, and 1-15, wherein the monoclonal IgA antibody is a chimeric antibody.
  • Item 2 A method for producing the monoclonal IgA antibody of Item 1, wherein the method comprises the following steps 1 and 2:
  • step 1 mixing and fusing B cells collected from an intestinal lamina limbal growth factor (IL1) and step 2: mixing and fusing B cells collected from an intestinal lamina limbal growth factor (IL1) and step 3: mixing and fusing B cells collected from an intestinal lamina limbal growth factor (IL1) and step 3: mixing and fusing B cells collected from an intestinal lamina limbal growth factor (IL1) and step 4: mixing and fusing B cells collected from an intestinal lamina intestinal with other types of cells to prepare hybridomas;
  • step 2 culturing the hybridomas formed in step 1, determining cells that produce a monoclonal IgA antibody that binds to at least two kinds of intestinal bacteria, and collecting the IgA antibody from the cells.
  • the embodiment of the invention described in Item 2 broadly includes the embodiments of the monoclonal IgA antibody production method described in the following Items 2-1 to 2-18.
  • Item 2-1 The production method according to Item 2, wherein the B cells are IgA antibody-producing cells.
  • Item 2-2 The production method according to Item 2 or 2-1, wherein the intestinal lamina intestinal is derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 2-3 The Production method according to Item 2, 2-1, or 2-2, wherein the other cells are myeloma cells.
  • Item 2-4 The production method according to any one of Items 2 and 2-1 to 2-3 wherein the other cells are derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 2-5 The production method according to any one of Items 2 and 2-1 to 2-4, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 2-6 The production method according to any one of Items 2 and 2-1 to 2-5, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 2-7 The production method according to any one of Items 2 and 2-1 to 2-6, wherein the monoclonal IgA antibody is IgA 1 or IgA 2 .
  • Item 2-8 The production method according to any one of Items 2 and 2-1 to 2-7, wherein the monoclonal IgA antibody contains a J chain-containing polymer.
  • Item 2-9 The production method according to any one of Items 2 and 2-1 to 2-8, wherein the monoclonal IgA antibody contains a secretory component.
  • Item 2-10 The production method according to any one of Items 2 and 2-1 to 2-9, wherein the monoclonal IgA antibody has an amino acid sequence derived from the same species.
  • Item 2-11 The production method according to any one of Items 2 and 2-1 to 2-10, wherein the monoclonal IgA antibody has an amino acid sequence derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 2-12 The production method according to any one of Items 2 and 2-1 to 2-9, wherein the monoclonal IgA antibody has amino acid sequences derived from different species.
  • Item 2-13 The production method according to any one of Items 2, 2-1 to 2-9, and 2-12, wherein the monoclonal IgA antibody has amino acid sequences derived from at least two species selected from the group consisting of mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and human.
  • Item 2-14 The production method according to any one of Items 2, 2-1 to 2-9, 2-12, and 2-13, wherein the monoclonal IgA antibody is a humanized antibody.
  • Item 2-15 The production method according to any one of Items 2, 2-1 to 2-9, 2-12, and 2-13, wherein the monoclonal IgA antibody is a chimeric antibody.
  • Item 2-16 The production method according to any one of Items 2 and 2-1 to 2-15, wherein the monoclonal IgA antibody comprises a heavy chain variable region containing
  • Item 2-17 The production method according to any one of Items 2 and 2-1 to 2-16, wherein the monoclonal IgA antibody comprises a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, 12, 22, 32, or 42, and/or a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7, 17, 27, 37, or 47.
  • Item 2-18 The production method according to any one of Items 2 and 2-1 to 2-17, wherein the monoclonal IgA antibody comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31, or 41, and/or a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46.
  • Item 3 A pharmaceutical composition containing the monoclonal IgA antibody of Item 1.
  • the embodiment of the invention described in Item 3 broadly includes the embodiments of pharmaceutical composition described in the following Items 3-1 to 3-6.
  • Item 3-1 The pharmaceutical composition according to Item 3, wherein the pharmaceutical composition is used in the treatment of an intestinal disease.
  • Item 3-2 The pharmaceutical composition according to Item 3 or 3-1, wherein the intestinal disease is caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 3-3 The pharmaceutical composition according to Item 3, 3-1, or 3-2, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 3-4 The pharmaceutical composition according to any one of Items 3 and 3-1 to 3-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 3-5 The pharmaceutical composition according to any one of Items 3 and 3-1 to 3-4, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 3-6 The pharmaceutical composition according to any one of Items 3 and 3-1 to 3-5, wherein the pharmaceutical composition is orally or enterally administered.
  • Item 4 An orally or enterally administered composition containing the monoclonal IgA antibody of Item 1.
  • the embodiment of the invention described in Item 4 broadly includes the embodiments of the orally or enterally administered composition described in the following Items 4-1 to 4-6.
  • Item 4-1 The orally or enterally administered composition according to Item 4, wherein the orally or enterally administered composition suppresses alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 4-2 The orally or enterally administered composition according to Item 4 or 4-1, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 4-3 The orally or enterally administered composition according to Item 4, 4-1, or 4-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 4-4 The orally or enterally administered composition according to any one of Items 4 and 4-1 to 4-3, wherein the orally or enterally administered composition is a composition that improves the intestinal environment, a composition that optimizes the intestinal environment, or a composition that prevents intestinal putrefaction.
  • Item 4-5 The orally or enterally administered composition according to any one of items 4 and 4-1 to 4-4, wherein the orally or enterally administered composition is a food and beverage composition.
  • Item 4-6 The orally or enterally administered composition according to any one of Items 4 and 4-1 to 4-5, wherein the orally or enterally administered composition is a feed composition.
  • Item 5 A nucleic acid encoding the monoclonal IgA antibody of Item 1.
  • Item 6 A hybridoma that produces the monoclonal IgA antibody of Item 1.
  • the embodiment of the invention described in Item 6 broadly includes the embodiments of the hybridoma described in the following Items 6-1 to 6-4.
  • Item 6-1 The hybridoma according to Item 6, wherein the hybridoma is derived from the same species.
  • Item 6-2 The hybridoma according to Item 5 or 6-1, wherein the hybridoma is derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 6-3 The hybridoma according to Item 6, wherein the hybridoma is derived from different species.
  • Item 6-4 The hybridoma according to Item 6 or 6-2, wherein the hybridoma is derived from at least two species selected from the group consisting of mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 7 A method for suppressing the growth of at least two kinds of intestinal bacteria, wherein the method comprises step of contacting the antibody of Item 1 to at least two kinds of intestinal bacteria.
  • the embodiment of the invention described in Item 7 broadly includes the embodiments of the disease treatment method described in the following Items 7 to 7-3.
  • Item 7-1 The method according to Item 7, wherein the contacting of the antibody to the intestinal bacteria is performed within the intestine.
  • Item 7-2 The treatment method according to Item 7 or 7-1, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 7-3 The treatment method according to any one of Items 7, 7-1, or 7-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 8 A method for treating an intestinal disease, wherein the method comprises the step of administering an effective amount of the antibody of Item 1 to a human suffering from an intestinal disease.
  • the embodiment of the invention described in Item 8 broadly includes the embodiments of the disease treatment method described in the following Items 8-1 to 8-5.
  • Item 8-1 The treatment method according to Item 8, wherein the intestinal disease is caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 8-2 The treatment method according to Item 8 or 8-1, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 8-3 The treatment method according to Item 8, 8-1, or 8-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 8-4 The treatment method according to any one of Items 8 and 8-1 to 8-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 8-5 The treatment method according to any one of Items 8 and 8-1 to 8-4, wherein the administration is performed orally or enterally.
  • Item 9 A monoclonal IgA antibody for use in treating an intestinal disease, wherein the monoclonal IgA antibody is defined in Item 1.
  • the embodiment of the invention described in Item 9 broadly includes the embodiments of the monoclonal IgA antibody described in the following Items 9-1 to 9-5.
  • Item 9-1 The monoclonal IgA antibody according to Item 9, wherein the monoclonal IgA antibody is used in treating an intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 9-2 The monoclonal IgA antibody according to Item 8 or 8-1, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 9-3 The monoclonal IgA antibody according to Item 9, 9-1, or 9-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 9-4 The monoclonal IgA antibody according to any one of Items 9 and 9-1 to 9-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 9-5 The monoclonal IgA antibody according to any one of Items 9 and 9-1 to 9-4, wherein the monoclonal IgA antibody is used for oral or enteral administration.
  • Item 10 Use of the monoclonal IgA antibody of Item 1, for the manufacture of a medicament for treating an intestinal disease.
  • Item 10 broadly includes the embodiments of the use of monoclonal IgA antibody described in the following Items 10-1 to 10-5.
  • Item 10-1 The use according to Item 10, wherein the intestinal disease is caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 10-2 The use according to Item 10 or 10-1, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 10-3 The use according to Item 10, 10-1 or 10-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 10-4 The use according to any one of Items 10 and 10-1 to 10-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
  • Item 10-5 The use according to any one of Items 10 and 10-1 to 10-4, wherein the use is for oral or enteral administration.
  • FIG. 1 shows experimental results to investigate the binding ability of monoclonal IgA for various intestinal bacteria.
  • the rows in the table indicate the bacteria from top to bottom: Escherichia coli (DH5 ⁇ strain), Escherichia coli (a cloned strain from mouse intestinal bacteria), Staphylococcus aureus, Enterococcus faecalis, Pseudomonas fulva, Lactobacillus murinus, Enterorhabdus mucosicola, Lactobacillus casei, Coprococcus eutactus, Blautia coccoides, Megamonas hypermegale, Eubacterium rectale, and Bifidobacterium bifidum.
  • Escherichia coli DH5 ⁇ strain
  • Escherichia coli a cloned strain from mouse intestinal bacteria
  • Staphylococcus aureus Enterococcus faecalis
  • Pseudomonas fulva Lac
  • the columns in the table indicate the names of the following clones from left to right: W1, W2, W3, W4, W6, W7, W11, W14, W24, W27, W28, W30, W32, W34, W37, W43, and W45, followed by G1, G8, G9, G10, G12, G14, G15, G16, G18, and G19. “N/A” in FIG. 1 indicates “unconfirmed.”
  • FIG. 2 shows experimental results to evaluate the concentration-dependent binding ability of monoclonal IgA for various intestinal bacteria. From left to right, the graphs illustrate results of binding to Staphylococcus aureus, Escherichia coli, and Enterococcus faecalis. In the graphs of FIG. 2 , the ordinate indicates OD (405 nm) values, and the abscissa indicates the concentration of each IgA antibody used (0.017, 0.05, 0.17, 0.5, 1.7, 5.0, 17, and 50 ⁇ g/ml).
  • FIG. 3 shows experimental results to evaluate the concentration-dependent binding ability of monoclonal IgA for various intestinal bacteria.
  • the graph in the upper left indicates results of binding to Enterococcus faecalis
  • the graph in the upper right indicates results of binding to Staphylococcus aureus
  • the graph in the lower left indicates results of binding to Escherichia coli
  • the graph in the lower right indicates results of binding to Pseudomonas fulva.
  • the ordinate indicates OD (405 nm) values
  • the abscissa indicates the concentration of each IgA antibody used (0.017, 0.05, 0.17, 0.5, 1.7, 5.0, 17, and 50 ⁇ g/ml).
  • FIG. 4A-D show results of Western blot analysis for cell extracts from various intestinal bacteria by using various monoclonal IgA antibodies.
  • FIG. 4(A) indicates experimental results using W27 monoclonal IgA antibody
  • FIG. 4(B) indicates experimental results using W30 monoclonal IgA antibody
  • FIG. 4(C) indicates experimental results using W45 monoclonal IgA antibody.
  • the lanes from left to right indicate the extracts of Escherichia coli (DH5 ⁇ strain; commercially available product), Escherichia coli (a cloned strain from mouse intestinal bacteria), Pseudomonas fulva, and Staphylococcus aureus.
  • FIG. 1 shows results of Western blot analysis for cell extracts from various intestinal bacteria by using various monoclonal IgA antibodies.
  • FIG. 4(A) indicates experimental results using W27 monoclonal IgA antibody
  • FIG. 4(B) indicates experimental results using W30 monoclonal IgA antibody
  • 4(D) indicates experimental results using W27 monoclonal IgA antibody.
  • the lanes from the left to the right indicate the extracts of Eubacterium rectale, Blautia coccoides, Coprococcus eutactus, Megamonas hypermegale, Lactobacillus casei, and Bifidobacterium bifidum.
  • FIG. 5 shows results of two-dimensional electrophoresis.
  • the top left indicates results of Western blotting, the top right indicates results of MemCode reversible protein staining, and the bottom row indicates results of silver staining.
  • Spots (arrows) were confirmed to be located at the same position in all the figures, and the gel was excised and subjected to MS analysis.
  • FIG. 6 shows HE-stained sections of the large intestine of G23S mice.
  • FIG. 7 shows experimental results to measure the number of Peyer's patch germinal center B cells when W27 monoclonal IgA antibody was orally administered to mice.
  • FIG. 8 is a graph showing experimental results to confirm the kinetics in the body when W27 monoclonal IgA antibody was orally administered to mice.
  • the ordinate in the graph indicates the antibody titer ( ⁇ g/ml) of the IgA antibody in feces.
  • FIG. 9 shows results of Western blotting using various monoclonal IgA antibodies. Most of these poly-reactive IgA antibodies recognize serine hydroxymethyltransferase (SHMT).
  • SHMT serine hydroxymethyltransferase
  • FIG. 10 shows results of an experiment to identify the epitope for various monoclonal IgA antibodies, using various mutants of serine hydroxymethyltransferase.
  • FIG. 11 shows HE-stained sections of the large intestine of G23S mice. This shows the state of the crypts when W27 monoclonal IgA antibody was administered. The atrophy in the crypts observed in the large intestine of G23S mice was normalized by administration of the W27 antibody.
  • FIG. 12 is a graph showing the effect of the monoclonal IgA antibody of the present invention on Escherichia coli growth suppression.
  • the monoclonal IgA antibody of the present invention specifically binds to amino acids 11 to 333 of the amino acid sequence of serine hydroxymethyltransferase.
  • the amino acids from either 11 or 25 to any of 28, 37, 44, 250, or 330 (11 to 250, 11 to 44, 11 to 37, 11 to 28, 25 to 333, 25 to 250, 25 to 44, 25 to 37, or 25 to 28) of the amino acid sequence are preferable, and the amino acids 23 to 44 of the amino acid sequence are more preferable, and the amino acids 25 to 28 of the amino acid sequence are most preferable.
  • Serine hydroxymethyltransferase has a molecular weight of about 45 to 50 kDa and an isoelectric point of about 4.3 to 4.7.
  • serine hydroxymethyltransferase is a protein consisting of, for example, the amino acid sequence of accession no. J01620 J01621; and version J01620.1 GI: 146216, shown on the NCBI website. More specifically, this protein has the amino acid sequence represented by SEQ ID NO 74.
  • This protein is an enzyme that functions to reversibly convert L-serine to glycine, and tetrahydrofolic acid to 5,10-methylene tetrahydrofolic acid at the same time. The conformation of this enzyme is highly conserved in Escherichia coli and also in mammals.
  • Table 1 shows the alignment between the amino acids 21 to 44 of the amino acid sequence of Escherichia coli -derived serine hydroxymethyltransferase, in which the amino acid sequence of serine hydroxymethyltransferase is represented by SEQ ID NO: 74, and the amino acid sequence of other intestinal bacteria which correspond to amino acids 21 to 44 of the amino acid sequences of Escherichia coli -derived serine hydroxymethyltransferase.
  • Amino acids 25 to 26 (RQ), 31 to 44, and, in particular, 31 to 37 (ELIASEN) of Escherichia coli -derived serine hydroxymethyltransferase are highly conserved in a large number of the species as shown in Table 1.
  • these amino acid sequences i.e., amino acids 25 to 26 (RQ) and 31 to 44 of the amino acid sequence of Escherichia coli -derived serine hydroxymethyltransferase, are the smallest units of the amino acid sequence that are considered to be included in the epitope of Escherichia coli -derived serine hydroxymethyltransferase, to which the monoclonal IgA antibody of the present invention binds. Therefore, the epitope for the monoclonal IgA antibody or the present invention is considered to contain regions corresponding to amino acids 25 to 26 and 31 to 44 of the amino acid sequence represented by SEQ ID NO: 74, in addition to amino acids 25 to 28 of the amino acid sequence.
  • examples of the origins of serine hydroxymethyltransferase which are bound with the monoclonal IgA antibody of the present invention include, but are not particularly limited to, bacteria belonging to the genus Pseudomonas, such as Pseudomonas fulva; Staphylococci, such as Staphylococcus aureus; Eubacterium rectale, Haemophilus influenzae, Klebsiella pneumoniae, Legionella pneumophila, Salmonella paratyphi A, Salmonella typhimurium, Shigella flexneri, Yersinia pestis bv. Antique, Burkholderia mallei, and the like.
  • bacteria belonging to the genus Pseudomonas such as Pseudomonas fulva
  • Staphylococci such as Staphylococcus aureus
  • Eubacterium rectale Haemophilus influenzae, Klebsiella pneumoniae, Legionella pneumophila, Salmonella paraty
  • the serine hydroxymethyltransferase that is derived from an origin other than the origins listed as examples above is not bound with monoclonal IgA antibody of the present invention or the antibody tends to dissociate immediately even if the binding between the serine hydroxymethyltransferase and the antibody occurs.
  • Such origins include, but are not particularly limited to, Lactobacillus casei, Bifidobacterium bifidum, and like lactobacillus, Blautia coccoides, Coprococcus eutactus, Megamonas hypermegale, and Bordetella parapertussis; Saccharomyces cerevisiae, Schizosaccharomyces pompe, Arabidopsis thaliana, rabbit, mouse, human, and like eukaryotes. The presence or absence of the bond and the binding tendency are confirmed by applying Western blotting using the monoclonal IgA antibody of the present invention to the lysates of various cultured cells.
  • the particular site (epitope) of serine hydroxymethyltransferase which is specifically bound with the monoclonal IgA antibody of the present invention may be confirmed, for example, as described in the Examples of the present specification: a truncated mutant of serine hydroxymethyltransferase is produced, and known immunochemistry techniques, such as Western blotting, may be used to confirm whether the monoclonal IgA of the present invention binds to the produced truncated mutant protein.
  • a mutant may be produced in which a portion of the amino acid sequence of wild-type serine hydroxymethyltransferase derived from, for example, Escherichia coli to which the monoclonal IgA antibody of the present invention binds as described above is replaced with an amino acid sequence that corresponds to the portion of the amino acid sequence above and that is a portion of the amino acid sequence of wild-type serine hydroxymethyltransferase derived from, for example, lactobacillus in which the portion is not bound with the monoclonal IgA antibody of the present invention or dissociates immediately even if the binding between the portion and the antibody occurs as described above.
  • the replaced portion of the amino acid sequence may be determined to be the amino acid sequence to which the monoclonal IgA antibody of the present invention specifically binds in the amino acid sequence of the serine hydroxymethyltransferase.
  • well-known immunochemistry techniques such as those described above, may be appropriately used.
  • the term “monoclonal” used in this specification is a modifying word, expressing characteristics of, for example, antibodies obtained from a substantially homogeneous population of antibodies.
  • the individual antibodies in the population of antibodies are identical, except for naturally occurring mutations that may possibly be present in minor amounts.
  • the monoclonal IgA antibody of the present invention is one type of immunoglobulin.
  • examples of embodiments of the antibody include antibodies having a heavy chain variable region and/or a light chain variable region. Of these, more preferable embodiments of the antibody include antibodies comprising a heavy chain further having a constant region and/or a light chain further having a constant region. Even more preferable embodiments of the antibody include antibodies comprising a heavy chain and a light chain.
  • the heavy chain and the light chain are constructed mainly from polypeptide chains, and the heavy chain and the light chain each contain a region called a variable region, which recognizes an antigen. (These regions are usually called a “heavy chain variable region” and a “light chain variable region,” respectively.)
  • the variable region sequentially contains regions called CDRs 1 to 3, which are defined as regions with more particular recognition of antigens, in this order from the amino terminus. More precisely, the CDRs 1 to 3 are also referred to as a heavy chain CDR 1, a heavy chain CDR 2, a heavy chain CDR 3, a light chain CDR 1, a light chain CDR 2, a light chain CDR 3, and the like. Regions other than CDRs 1 to 3 in the heavy chain and the light chain are referred to as heavy chain FRs 1 to 4 and light chain FRs 1 to 4, respectively, in order from the amino terminus.
  • Neither the heavy chain variable region nor the light chain variable region of the monoclonal IgA antibody of the present invention necessarily contains all of the CDRs 1 to 3, and each may contain at least one CDR, and preferably contain CDR 3.
  • amino acid sequences of polypeptides which construct the heavy chain CDRs 1 to 3 and the light chain CDRs 1 to 3 are not particularly limited. Examples are,
  • the heavy chain variable region of the monoclonal IgA antibody of the present invention is not particularly limited.
  • Examples of embodiments of the heavy chain variable region containing CDRs 1 to 3 include a heavy chain variable region which sequentially contains the following CDRs 1 to 3:
  • the light chain variable region containing CDRs 1 to 3 is also not limited. Examples of such an embodiment include a light chain variable region which sequentially contains the following CDRs 1 to 3:
  • More preferable examples of embodiments of the heavy chain variable region containing CDRs 1 to 3 include a heavy chain variable region which sequentially contains a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 4, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 5, in this order from the amino terminus;
  • An even more preferable heavy chain variable region is a heavy chain variable region which sequentially contains a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 4, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 5, in this order from the amino terminus.
  • the light chain variable region containing CDRs 1 to 3 include a light chain variable region which sequentially contains a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 9, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10, in this order from the amino terminus;
  • An even more preferable light chain variable region containing CDRs 1 to 3 is a light chain variable region which sequentially contains a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 9, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10, in this order from the amino terminus.
  • a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, 12, 22, 32, or 42 is more preferable, and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2 is most preferable.
  • a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7, 17, 27, 37, or 47 is more preferable, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7 is most preferable.
  • the monoclonal IgA antibody of the present invention may also have a construct in which the heavy chain variable region and/or the light chain variable region described above are appropriately combined.
  • the monoclonal IgA antibody of these other embodiments has a structure called, for example, F(ab′) 2 , Fab, Fv, scFv, scFv-Fc, and minibody.
  • Examples of more preferable embodiments of the monoclonal IgA antibody of the present invention include a monoclonal IgA antibody in which each of the heavy chain variable region and/or a light chain variable region described above further contains a constant region.
  • Such monoclonal IgA is not particularly limited. Examples include a monoclonal IgA antibody comprising a heavy chain which consists of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31 or 41, and/or a light chain which consists of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46.
  • a monoclonal IgA antibody comprising a heavy chain which consists of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31, or 41, and a light chain which consists of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46 is more preferable.
  • a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6;
  • the monoclonal IgA antibody of the present invention may be a monomer or a polymer, and preferably a dimer.
  • the monoclonal antibody is a polymer
  • the monoclonal antibody contains a J chain described later.
  • a J chain is a peptide consisting of an amino acid sequence with no antigen-recognition site, and is a peptide consisting of an amino acid sequence different from those of the heavy chains and light chains mentioned above.
  • this amino acid sequence include an amino acid sequence derived from mouse, such as an amino acid sequence of accession no. AAA38673; version AAA38673.1 GI: 196379, shown on the National Center of Biotechnology Information (NCBI) website (http://www.ncbi.nlm.nih.gov/); an amino acid sequence derived from human, such as an amino acid sequence of accession no. NP_653247; version NP_653247.1 GI: 21489959, also shown on the NCBI website; and the like.
  • the monoclonal IgA antibody monomers are corrected with a J chain by forming disulfide are bound between each monomer heavy chain and the J chain.
  • the airline acid sequence for the above monoclonal IgA antibody of the present invention may be appropriately mutated to an extent that the functions, effects, etc., of the monoclonal IgA antibody described in this specification are not attenuated.
  • the exact number of introduced mutations is also not particularly limited. Mutations are usually introduced such that the amino acid sequence of the resulting mutant has an identity of 85% or more, preferably 90% or more, more preferably 95% or more, and most preferably 99% or more, with the amino acid sequence before mutation.
  • identity refers to the degree of identical amino acid sequences or nucleotide sequences among two or more comparable amino acid sequences or nucleotide sequences. Accordingly, when the identity between two amino acid sequences or nucleotide sequences is high, the identity or similarity of these sequences is high.
  • the level of identity between amino acid sequences or between nucleotide sequences is determined using, for example, FASTA, which is a sequence analysis tool, based on default parameters.
  • level of identity may be determined using the BLAST algorithm by Karlin and Altschul (e.g., Karlin S, Altschul S F, Proc Natl Acad Sci USA. 87: 2264-2268 (1990); and Karlin S. Altschul S F, Natl Acad Sci USA, 90: 5873-7(1993)).
  • Programs such as BLASTN and BLASTX based on the BLAST algorithm described above have been developed (e.g., Altschul S F, Gish W. Miller W, Myers E W, Lipman D J, J Mol Biol, 215: 403-10 (1990)).
  • Detailed procedures for these analytical methods are known, and the detailed procedures may be referred to the website of NCBI.
  • mutation used above includes substitution, deletion, insertion, and the like.
  • a known method without particular limitation may be used as a specific method for introducing mutations. For example, conservative substitution may be used for substitution.
  • conservative substitution used in this specification refers to a replacement of an amino acid residue with another amino acid residue having a similar side chain.
  • a conservative substitution refers to a technique of replacement between amino acid residues with basic side chains, such as lysine, arginine, and histidine.
  • a conservative substitution also includes a replacement between amino acid residues with acid side chains, such as aspartic acid and glutamic acid; a replacement between amino acid residues with uncharged polar side chains, such as glycine, asparagine, glutamine, serine, threonine, tyrosine, and cysteine; a replacement between amino acid residues with non-polar side chains, such as alanine, valine, leucine, isoleucine, praline, phenylalanine, methionine, and tryptophan; a replacement between amino acid residues with ⁇ -branched side chains, such as threonine, valine, and isoleucine; and a replacement between amino acid residues with aromatic side chains, such as tyrosine, phenylalanine, tryptophan, and histidine.
  • the subclasses of the monoclonal IgA antibody above are not particularly limited, and may be, for example, IgA 1 and IgA 2 .
  • the monoclonal IgA antibody of the present invention may contain a secretory component.
  • a secretory component is a peptide containing an amino acid sequence with no antigen recognition site, as with the J chain described above, and is usually a sugar chain-modified peptide containing an amino acid sequence that is different from those of the heavy chains and light chains mentioned above.
  • amino acid sequence of the secretory component is derived from a mouse.
  • amino acid sequence of the secretory component include an amino acid sequence which corresponds to an extracellular domain of the amino acid sequence of polyimmunoglobulin receptor of accession no. 070570; version 070570.1 GI: 6225856, shown on the NCBI website, and the like.
  • amino acids 19 to 638 of the amino acid sequence correspond to the secretory component.
  • amino acid sequence of the secretory component derived from a human examples include an amino acid sequence which corresponds to an extracellular domain of the amino acid sequence of polyimmunoglobulin receptor of accession no. P01833; version P01833.4 GI: 150421625, shown on the NCBI website, and the like.
  • amino acid sequence shown in the accession P01833 the amino acids 19 to 645 of the amino acid sequence correspond to the secretory component.
  • the monoclonal IgA antibody containing the secretory component described above it is possible to encompass a further step of introducing a nucleic acid having the base sequence encoding the secretory component region of the polyimmunoglobulin receptor into the hybridomas obtained in step 1 above.
  • the detailed methods of the introduction are not particularly limited, and a known method may be appropriately modified.
  • the monoclonal IgA antibody above may have an amino acid sequence derived from the same species.
  • the monoclonal IgA antibodies above may have amino acid sequences derived from different species. Examples of the origins of the monoclonal IgA antibody from the same species include human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • Examples of the monoclonal IgA antibodies from different species include, but are not particularly limited to, the monoclonal IgA antibodies from at least two species selected from human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • monoclonal IgA antibodies having amino acid sequences derived from different species include the monoclonal IgA antibodies having an amino acid sequence derived from a human, together with an amino acid sequence derived from a non-human animal species.
  • this monoclonal IgA antibody the amino acid sequence of the entire heavy chain and light chain variable regions are derived from a non-human animal species while the amino acid sequences of the other regions are derived from a human.
  • This monoclonal IgA antibody is sometimes called, in particular, a chimeric antibody.
  • the monoclonal IgA antibody of the present invention inhibits the growth of at least two kinds of intestinal bacteria.
  • intestinal bacteria used in this specification is not particularly limited as long as they are indigenous bacteria in the intestine of a living body.
  • examples of the intestinal bacteria include bacteria that form gut microbiota in the living body and that are involved in maintaining homeostasis in the intestinal immune system.
  • intestinal bacteria examples include, but are not particularly limited to,
  • bacteria such as
  • the monoclonal antibody of the present invention has an effect of making recovery from the reduction of crypts or the atrophy of crypts in the large intestinal lamina propria, as described in the Examples below.
  • a reduction in the crypts in the large intestinal lamina propria is seen in histopathological findings of an intestinal disease caused by, in particular, alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, and is, in general, a chronic pathology often observed in ulcerative colitis.
  • the monoclonal IgA antibody of the present invention is expected to have effects of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, and is further expected to have effects of treating, for example, intestinal diseases that are caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, such as inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • intestinal diseases that are caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, such as inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • the alternation of intestinal bacterial growth is not particularly limited, and refers to, for example, a state of growth alternation of bacteria that reside in the intestine.
  • the pathological changes in gut microbiota are not particularly limited, and refer to a state of abnormality in maintaining the homeostasis in the symbiotic relationship with the host, the abnormality being caused by, for example, a change in the species of intestinal bacteria that form gut microbiota and a change in the proportion of each of the intestinal bacterium.
  • the alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota are not necessarily limited to a state affected by an intestinal disease, and can also be a state of having a factor for inducing an intestinal disease.
  • treatment means attainment of desired pharmacological and/or physiological effects.
  • the effects include partially or completely curing a disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease. These effects also include an effect of inhibiting or delaying the progression of a disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease; an effect of alleviating pathologies and symptoms (i.e., ameliorating a disease or symptoms, or causing reversal of the progression of a disease or symptoms); and an effect of preventing recurrence of a disease.
  • the above effects also include an effect of partially or completely preventing the onset of a disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease in individuals who can possess a predisposition to the disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease but who have not yet been diagnosed as having the predisposition.
  • treatment also means “remission,” “prevention of recurrence,” “prevention of disease,” and the like.
  • the monoclonal IgA antibody of the present invention is expected to exert excellent effects when used in the treatment of intestinal diseases. These effects are achieved when the monoclonal antibody is administered orally or enterally to an individual. This confirms that the monoclonal IgA antibody of the present invention is useful as an active ingredient of an orally or enterally administered composition or a pharmaceutical composition.
  • the nucleic acid of the present invention encodes the monoclonal IgA antibody of the present invention. More specifically, the nucleic acid of the present invention has a base sequence encoding the amino acid sequence represented by any one of SEQ ID NOs: 1 to 50.
  • the nucleic acid above may be a ribonucleotide or a deoxyribonucleotide.
  • the form of the nucleic acid is not particularly limited, and may be a single chain or a double chain.
  • a base sequence encoding one of the amino acid sequences mentioned above is not limited to one kind of nucleic acid base sequence.
  • the base sequence may be determined by appropriately selecting codons coding for the amino acids.
  • the base sequence may be used to express the monoclonal IgA antibody of the present invention in a cell to produce the monoclonal IgA antibody in the cell.
  • each codon may be selected in consideration of the codon frequency depending to the species of host cell used in the production of the monoclonal IgA antibody.
  • nucleic acid of the present invention may have a base sequence encoding the amino acid sequence represented by any one of SEQ ID NOs: 1 to 50 that has been mutated as described in detail in the “Monoclonal IgA Antibody” section.
  • base sequence include, but are not particularly limited to, the base sequences of SEQ ID NOs: 51 to 60.
  • Table 2 shows the correspondence between these base sequences and the amino acid sequences of SEQ ID NOs: 1 to 50 shown in the “Monoclonal IgA Antibody” section above.
  • the method for producing a monoclonal IgA antibody of the present invention is a method for producing the monoclonal IgA described above, and characterized in that the method comprises the following steps 1 and 2.
  • Step 1 is a step of mixing and fusing B cells collected from an intestinal lamina limbal growth factor (IL-12) with other types of cells to prepare hybridomas.
  • Step 2 is a step of culturing the hybridomas formed in step 1, determining cells that produce an IgA antibody that binds to at least two kinds of intestinal bacteria, and collecting the IgA antibody from the cells.
  • the method for producing the monoclonal IgA antibody of the present invention may optionally further comprise, after step 2, for example, a step of treatment with an IgA-specific protease or the like, a step of functional group introduction, which enables chemical bond, such as a disulfide bond, and sequentially, a step of chemical bond formation via the functional group.
  • step 1 and step 2 of the method for producing the monoclonal IgA antibody of the present invention The following describes in detail step 1 and step 2 of the method for producing the monoclonal IgA antibody of the present invention.
  • Step 1 of the method for producing the monoclonal IgA antibody of the present invention comprises mixing and fusing B cells collected from an intestinal lamina basement membrane with other types of cells to prepare hybridomas.
  • the B cells used in step 1 are located in the intestinal lamina intestinal lamina intestinal.
  • the B cells are not necessarily limited to those that contain IgA antibody-encoding DNA or mRNA and produce an IgA antibody by translation of the mRNA, as long as they function to produce an IgA antibody.
  • Examples of the B cells include cells in which an IgG antibody, an IgM antibody, and other immunoglobulin subtypes different from IgA antibody are intracellularly class-switched to an IgA antibody so that an IgA antibody is intracellularly produced.
  • the intestinal lamina basement membrane is not particularly limited as long as it is one of the layers constituting mucosa which present in, for example, the esophagus, stomach, small intestine (including duodenum, jejunum, ileum, etc.), and large intestine (including cecum, colon, rectum, etc.), and as long as the layer is located between the epithelial cell layer and the muscularis mucosae.
  • an intestinal lamina intestinal that is present in a small intestine and that contains lymphoid tissues, capillary vessels, lymphatic vessels, and the like, is preferable.
  • the method of collecting B cells from an intestinal lamina limbal is not particularly limited.
  • an intestine is collected, and the obtained intestine after washing is cut open to expose the mucosal layer, followed by shaking in a saline containing EDTA at an appropriate concentration to release and remove epithelial cells.
  • B cells are collected through treatment using a digestive enzyme, such as collagenase, at an appropriate concentration.
  • a digestive enzyme such as collagenase
  • the origin of the intestinal lamina intestinal lamina intestinal lamina intestinal lamina intestinal i.e., the origin of the B cells, is not particularly limited. Examples include mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, human, and the like.
  • the type of cells other than the B cells above (in this specification, sometimes referred to as “other cells”) are different from that of the B cells.
  • the other cells are not limited as long as they fuse with the B cells when contact with the B cells and prepare hybridomas, and as long as the prepared hybridomas maintain the function of the B cells, i.e., the function to produce an IgA antibody.
  • the other cells mentioned above are preferably cells that fuse with the B cells and prepare hybridomas that have an immortalizing function.
  • Specific examples of the other cells are preferably cancer cells which include myeloma cells, which are derived from myeloma.
  • the other cells are preferably myeloma cells.
  • the origin of the other cells is not particularly limited. Examples include mouse, rat, hamster, rabbit, goat, sheep, donkey, donkey, pig, cow, horse, chicken, monkey, chimpanzee, human, and the like.
  • to fuse means that the B cells and the other cells are inseparably unified.
  • inseparably excludes the phenomenon of cell division, which occurs when the fused cells proliferate.
  • the hybridoma are included in an example of fused cells.
  • the conditions at the time of mixing and fusing are not particularly limited.
  • the conditions usually used in fusing cells may be appropriately used.
  • the conditions used for culturing the B cells or other cells may be appropriately modified and used. Examples of such methods include a method comprising mixing B cells and cells other than the B cells in an appropriate medium to contact each other in the presence of, for example, polyethylene glycol; a method further comprising, after the mixing above, applying electrical stimulation; and a method comprising, after, for example, a method using viruses, such as Sendai virus, incubating the resulting product at 37° C. in 5% carbon dioxide conditions.
  • the time for fusion is also not particularly limited.
  • the time required for completion of fusion itself may be appropriately set.
  • the completion of fusion may be confirmed by appropriately modifying a known method that is usually used for fusing cells. Examples of such a method include a method of observing the degree of the progress of fusion under a microscope. It is also possible to appropriately select and use a known kit to fuse cells under its usage conditions.
  • Step 2 of the method for producing the monoclonal IgA antibody of the present invention comprises culturing the hybridomas prepared in step 1 above, determining cells that produce an IgA antibody that binds to at least two kinds of intestinal bacteria, and collecting the antibodies from the cells.
  • the hybridomas obtained in step 1 may be subjected to, for example, a subcloning step, such as a limiting dilution method or the like, in which the subcloning step usually used in the production of a monoclonal antibody.
  • a subcloning step such as a limiting dilution method or the like, in which the subcloning step usually used in the production of a monoclonal antibody.
  • the hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria may be determined, for example, by means of ELISA, EIA, RIA, FLISA, FIA, or the like, or by means of FACS or the like, using an detectable anti-IgA antibody (optionally labeled with, for example, radioisotope, fluorescence, or colorant), as described in the Examples below.
  • Examples of a specific method for determining the “hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacterial” include, but are not particularly limited to, the following two types of methods that use the anti-IgA antibody mentioned above. The two types of methods may also be appropriately used in combination.
  • the first method for determination is a method which comprises
  • step A may be performed in the following manner: the culture supernatant of the hybridomas obtained in step 1 is sampled, and the sampled culture supernatant is contacted with a first intestinal bacterium, which is immobilized in, for example, a well of a multi-well plate. Subsequently, the hybridoma is determined to be a hybridoma which produces an IgA antibody by confirming the presence of an IgA antibody that binds to the intestinal bacterium using the ELISA method.
  • step B may be performed in the following manner: the sampled culture supernatant of the hybridomas that are determined in step A to produce an IgA antibody is used as it is, or a culture supernatant of the hybridomas determined as above in step A is sampled again as required, and then the sampled culture supernatant is contacted with another (a second) intestinal bacterium, which is different from the first intestinal bacterium and which is immobilized in, for example, a well of a multi-well plate.
  • a second intestinal bacterium which is different from the first intestinal bacterium and which is immobilized in, for example, a well of a multi-well plate.
  • the hybridoma is determined to be a hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria by confirming the presence of an IgA antibody that binds to this intestinal bacterium is confirmed in the sampled product.
  • step or steps similar to step B may be continuously performed using a third or a subsequent intestinal bacterium different from the first and the second bacteria, as the other intestinal bacteria mentioned above after step B.
  • a first and a second (and optionally a third and a subsequent) intestinal bacteria may be immobilized in each well or on an experimental apparatus similar to a well plate.
  • the sampled culture supernatant is mixed with a variety of intestinal bacteria; thereafter, the resulting mixture is further contacted with an anti-IgA antibody.
  • the hybridoma is determined to be the hybridoma which produces an IgA antibody that binds to intestinal bacteria by detecting the formations of complexes of the variety of intestinal bacteria, IgA antibodies that bind to the variety of intestinal bacteria, and anti-IgA antibodies, using FACS analysis in an appropriate manner.
  • Examples of the second method for determination include a method which determines a hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria, from among the hybridomas obtained in step 1 above, using systems which detect the binding of the IgA antibody to each intestinal bacterium.
  • step A in the first method above two (optionally three or more) different kinds of intestinal bacteria are immobilized in, for example, different two (or three or more depending on the number of the kinds of intestinal bacteria) wells of a multi-well plate, the sampled culture supernatant of the hybridomas obtained in step 1 is contacted with two (or three or more) different intestinal bacteria in each well.
  • the hybridoma is determined as a hybridoma which produces IgA that binds to at least two kinds of intestinal bacteria by confirming the presence of IgA that binds to both of the two kinds (or all of the three or more kinds) of intestinal bacteria using the ELISA method.
  • the first and the second (optionally the third and subsequent) intestinal bacteria may be immobilized in each of wells or on an experimental apparatus similar to a well plate.
  • each sampled product is mixed with each kinds of intestinal bacteria, and the resulting mixture is further contacted to an anti-IgA antibody.
  • the hybridoma is determined to be the hybridoma which produces an IgA antibody that binds to intestinal bacteria by detecting the formations of complexes of the variety of intestinal bacteria, IgA antibodies that bind to the variety of intestinal bacteria, and anti-IgA antibodies in an appropriate manner.
  • a step which comprises cloning the hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria, by using, for example, a limiting dilution used in the method for producing the monoclonal antibody described above may be preformed.
  • the above step of determining the hybridoma may be repeatedly performed using two particular kinds of intestinal bacteria that are the same as those used to determine the hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria.
  • the collection method in step 2 is not particularly limited in detail.
  • Examples of the collection method include a method of collecting a supernatant of the culture medium of cells that produce an IgA antibody, and a method of collecting a lysate of the cells.
  • the lysate of the cells may be obtained by cell-lysis suitably using a combination of a known mechanical means, such as sonication and French press, and/or a known chemical treatment method using a detergent, a cell wall-digesting enzyme, and a cellular membrane-digesting enzyme. Thereafter, the liquid phase fractions obtained after a solid-liquid-separation step are collected, and the monoclonal IgA antibody of the present invention may be produced.
  • the hybridoma Before collecting IgA from the hybridoma, the hybridoma may be cultured in an appropriate medium for a specific period of time, and then, the method of collecting its supernatant or the method of collecting IgA from a lysate of the cells may be performed as described above. Alternatively, the collection may be performed by intraperitoneal administration of the hybridoma to an individual animal that is capable of being transplanted with the origin of this hybridoma, such as an immunodeficient mouse, and collecting IgA from the ascites of the individual.
  • the monoclonal IgA antibody collected in the above manner may be appropriately subjected to a known purification step.
  • the purification means is not particularly limited in detail.
  • Known protein purification means such as purification by precipitation using, for example, acetone and ammonium sulfate, and purification by, for example, affinity, anion-exchange, cation-exchange, size exclusion, or reversed-phase column chromatography, may be appropriately combined and used.
  • Examples of embodiments of the method for producing the monoclonal IgA antibody of the present invention also include a method which comprises introducing the nucleic acid described in detail in the “Nucleic Acid” section above into a cell which is capable of producing a monoclonal IgA antibody, culturing the cell, and collecting a monoclonal IgA antibody from the cell extract or culture supernatant, optionally followed by purification.
  • the cell which is capable of producing a monoclonal IgA antibody is not particularly limited as long as it is a cell that is capable of producing various proteins that usually function when folded into a higher-order structure from a mammal.
  • the cell may be appropriately selected from known cells, including mammal-derived cells, such as COS cells, HEK cells, HELA cells, and CHO cells, and insect-derived cells, such as Sf9.
  • the detailed method for introducing a nucleic acid, the conditions for culturing cells into which the nucleic acid is introduced, the collection method, and the purification method are not particularly limited, and vary depending on, for example, the type of the cells used. Known methods may be appropriately modified and combined to produce the monoclonal IgA antibody of the present invention.
  • nucleic acid when the monoclonal IgA antibody of the present invention is a chimeric antibody, a nucleic acid having a base sequence encoding a heavy chain variable region and a nucleic acid having a base sequence encoding a heavy chain constant region of different species, as well as a nucleic acid having a base sequence encoding a light chain variable region and a nucleic acid having a base sequence encoding a light chain constant region of different species are produced.
  • the produced nucleic acid having a base sequence encoding a heavy chain variable region is bound to the nucleic acid having a base sequence encoding a heavy chain constant region
  • the nucleic acid having a base sequence encoding a light chain variable region is bound to the nucleic acid having a base sequence encoding a light chain constant region.
  • the resulting nucleic acids may be introduced into a cell that is capable of producing the monoclonal IgA antibody as described above.
  • the monoclonal IgA antibody of the present invention may also be an antibody in which the heavy chain and/or light chain CDRs 1 to 3 have mouse-derived amino acid sequences while regions other than the CDRs have human-derived amino acid sequences (this antibody sometimes being referred to as a “humanized antibody”).
  • This humanized antibody may be produced as is the case for a chimeric antibody as described above.
  • the nucleic acids having base sequences encoding heavy chain and/or light chain CDRs 1 to 3, and nucleic acids having base sequences encoding the regions other than the CDRs are produced.
  • nucleic acids having base sequences encoding heavy chain and CDRs 1 to 3 are again bound to regions other than the CDRs and the nucleic acids having base sequences encoding light chain and CDRs 1 to 3 are again bound to regions other than the CDRs to obtain nucleic acids encoding a heavy chain and a light chain.
  • the resulting nucleic acids are introduced into a cell that is capable of producing the monoclonal IgA antibody as described above. To maintain the binding ability of an antibody, replacement of some bases with other bases may be required.
  • the monoclonal IgA antibody of the present invention may be produced by introducing a nucleic acid having a base sequence encoding the monoclonal IgA antibody and a nucleic acid having a base sequence encoding J chain into a cell that is capable of producing a monoclonal IgA antibody, as described above.
  • the base sequence encoding the J chain may be appropriately determined by using a known method, based on the J chain amino acid sequence shown on the NCBI website, as described in the “Monoclonal IgA Antibody” section above.
  • the nucleic acid may be produced using a known method, based on the determined base sequence.
  • the monoclonal IgA antibody of the present invention may be produced by introducing a nucleic acid having a base sequence encoding the monoclonal IgA antibody and a nucleic acid having a base sequence encoding the J chain, as well as a nucleic acid having a base sequence encoding a secretory component, into a cell which is capable of producing a monoclonal IgA antibody, as described above.
  • a method is disclosed in, for example, Li C et al., Sheng Wu Gong Cheng Xue Bao. 2011 February; 27(2): 219-25.
  • the monoclonal IgA antibody containing a secretory component of the present invention may be produced based on this disclosure or by appropriately modifying the disclosure.
  • the nucleic acid base sequence encoding a secretory component may be appropriately determined by using a known method based on the amino acid sequence of, for example, a polyimmunoglobulin receptor shown on the NCBI website, as described in the “Monoclonal IgA Antibody” section above.
  • the nucleic acid may be produced using a known method, based on the determined base sequence.
  • the hybridoma of the present invention produces the monoclonal IgA antibody of the present invention.
  • Hybridomas are specifically those obtained in step 1 described in the “Method for Producing Monoclonal IgA Antibody” section above, i.e., cells obtained by mixing and fusing the B cells with other types of cells, which are cells other than the B cells, as described in step 1 of the method for producing the monoclonal IgA antibody of the present invention.
  • hybridoma may be derived from the same species or different species.
  • hybridomas derived from the same species may be obtained by arranging the origin of the B cells to be the same as the origin of cells other than the B cells, and hybridomas derived from different species may be obtained by arranging the origin of the B cells to be different from the origin of cells other than the B cells.
  • the origin of the B cells and the origin of cells other than the B cells are appropriately selected, for example, from among the origins mentioned in relation to step described in the “Method for Producing Monoclonal IgA Antibody” section above so that their origins overlap with each other.
  • the origins of the hybridoma derived from the same species include human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • the origin of the B cells and the origin of cells other than the B cells may be appropriately selected, for example, from among the origins mentioned in relation to step 1 described in the “Method for Producing Monoclonal IgA Antibody” section above, and combined.
  • the origins of the hybridoma derived from different species include human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • the pharmaceutical composition of the present invention contains the monoclonal IgA antibody of the present invention.
  • the pharmaceutical composition of the present invention is not particularly limited, and is suitably used for the treatment of, for example, an intestinal disease.
  • the pharmaceutical composition of the present invention is more preferably used for treating an intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • the alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota are as described in the “Monoclonal IgA Antibody” section above.
  • the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is not particularly limited. Examples include inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, autoimmune diseases, and the like. Inflammatory bowel disease is preferable among them.
  • the pharmaceutical composition of the present invention is sufficient if it contains an effective amount of the monoclonal IgA antibody of the present invention.
  • the amount of the antibody of the present invention contained in 100 wt % of the pharmaceutical composition may be appropriately set to be within a range of 0.001 to 99.99 wt %, in consideration of, for example, the type of the target intestinal disease, the dosage form, the administration method, the target for administration, the degree of symptoms of the target for administration, and the degree of the effect achieved by the administration.
  • an effective amount refers to an amount that allows the monoclonal IgA antibody of the present invention to exert the effect of treating an intestinal disease, or an amount that allows the desired pharmacological and/or physiological effects (intestinal disease treatment effect) described above to be achieved.
  • Pharmaceutically acceptable carriers or additives may be incorporated in the pharmaceutical composition of the present invention, together with the monoclonal IgA antibody of the present invention.
  • pharmaceutically acceptable carriers or additives refers to optional carriers, diluents, excipients, suspending agents, lubricants, adjuvants, vehicles, delivery systems, emulsifiers, disintegrants, absorbents, preservatives, detergents, colorants, fragrances, or sweeteners.
  • Known carriers or additives may be used.
  • the pharmaceutical composition of the present invention is applicable to methods of treating an intestinal disease, comprising administering the composition to an individual suffering from the intestinal disease mentioned above.
  • the pharmaceutical composition of the present invention is also applicable to methods of preventing an intestinal disease, in which the methods comprise administering the composition to an individual who has not yet developed pathologies or symptoms of the intestinal disease described above but can possess a predisposition to the intestinal disease. These individuals may be used as the target for administration of the pharmaceutical composition of the present invention.
  • the individuals used as the target for administration are not particularly limited. Examples include human, mouse, rat, guinea pig, rabbit, hamster, dog, cat, weasel, and the like.
  • the dosage and administration method of the pharmaceutical composition may be suitably determined according to the type of intestinal disease from which an individual as the target for administration suffers, the sex, the race, the age, the general conditions, the severity of the disease, and the degree of desired effects, and the like.
  • the dosage may be suitably set within a range of 0.001 to 100 mg/kg/day.
  • the administration method is not particularly limited. Direct administration to the gastrointestinal tract is preferable. Examples of the administration method include oral administration, nasal administration, mucosal administration, enteral administration, and the like.
  • the enteral administration is not limited to administration through the anus.
  • the enteral administration includes administration through a tube or the like inserted into the gastrointestinal tract from outside the individual, as in gastrostoma.
  • the site in the digestive tract into which a tube is inserted is not limited, and may be, for example, the esophagus, stomach, small intestine (including the duodenum, jejunum, ileum, etc.), large intestine (including the cecum, colon, rectum, etc.) and the like.
  • the pharmaceutical composition of the present invention in the above dosage may be administered in a single dose or in a plurality of doses per day.
  • the administration interval may be every day, every other day, every week, every other week, every 2 to 3 weeks, every month, or every 2 to 3 months, as long as the effect of the treatment for the above disease is achieved.
  • the orally or enterally administered composition of the present invention contains the monoclonal IgA antibody of the present invention.
  • the use of the orally or enterally administered composition achieves the effect of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • the alternation of intestinal bacterial growth and pathological changes of intestinal bacterial growth in gut microbiota are as described in the “Monoclonal IgA Antibody” section above.
  • the mixing ratio of the monoclonal IgA antibody contained in the orally or enterally administered composition is not particularly limited, and may be appropriately adjusted according to the form, usage, and the like of the orally or enterally administered composition.
  • the mixing ratio may be usually about 0.001 to 99 wt % based on the total amount of the orally or enterally administered composition.
  • the individuals as a target in which the orally or enterally administered composition of the present invention is used are not particularly limited. Examples include human, mouse, rat, guinea pig, rabbit, hamster, dog, cat, weasel, and the like.
  • the monoclonal IgA antibody contained in the orally or enterally administered composition of the present invention has an effect of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, and is thus particularly useful as a composition that controls intestinal function, a composition that improves the intestinal environment, a composition that optimizes the intestinal environment, or a composition that prevents intestinal putrefaction.
  • the dosage of the orally or enterally administered composition of the present invention is not particularly limited as long as it is within a range that allows the effects of the orally or enterally administered composition to be exerted, and may be set according to the species of individual who takes the orally or enterally administered composition, the target effect, the target degree of achieving the effect, other various conditions, and the like.
  • the dosage may be converted into the amount of the monoclonal IgA antibody of the present invention, which is usually about 0.001 to 100 mg/kg/day. The amount may be taken in a single portion or several portions per day.
  • enteral administration is not limited to administration through the anus, as described in the “Pharmaceutical Composition” section above.
  • the enteral composition of the present invention may be blended with a known component so as to be used as intestinal lavage fluid.
  • the orally or enterally administered composition of the present invention contains the monoclonal IgA antibody of the present invention, which achieves the effect of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota. With the expectation of achieving such effects, the orally or enterally administered composition of the present invention may be suitably used in the fields of food or feed. Therefore, the orally or enterally administered composition of the present invention may be used as a food composition or a feed composition.
  • the orally or enterally administered composition of the present invention is most suitably used in the field of food.
  • a food composition may be provided as a food composition indicated as controlling intestinal function, improving the intestinal environment, optimizing the intestinal environment, preventing intestinal putrefaction, or the like.
  • examples of the food composition include food for specified health use, including conditional food for specified health use, nutrition supplement food, functional food, medical food, and the like.
  • the specific form of the food composition is not particularly limited. Examples include drinks, such as soft drinks, carbonated drinks, energy drinks, fruit drinks, lactic-acid drinks, and milk drinks; frozen desserts, such as ice cream, ice sherbet, and shaved ice; confectioneries, such as candies, gum, chocolate, tablet candies, snack confectioneries, biscuits, jelly, jam, cream, baked confectioneries; noodles, such as buckwheat noodles, wheat-flour noodles, bean vermicelli, Chinese-style noddies, and instant noodles; fish or livestock processed food, such as kamaboko (fish sausage), ham, and sausage; dairy products, such as processed milk products and fermented milk products; oil- and fat-processed food products such as salad oil, tempura oil, margarine, mayonnaise, shortening, whipped cream, and dressing; seasonings, such as dipping sauce and other sauces; and soups, stews, salads, daily dishes, rice seasonings, pickles, bread, cereal, and the like
  • the orally or enterally administered composition of the present invention is most suitably used in the field of feed.
  • a feed composition may be provided as a feed composition indicated as controlling intestinal function, improving the intestinal environment, optimizing the intestinal environment, preventing intestinal putrefaction, or the like.
  • the specific form of the feed composition is not particularly limited, and may be, for example, mixed with usual feed, optionally with a component that can be blended with usual feed, to obtain a feed composition, as long as the effect of the feed composition of the present invention described above is achieved. It is also possible to use the feed composition unmodified as feed.
  • the method for treating a disease according to the present invention is a method for treating an intestinal disease, in which the method comprises administering an effective amount of the monoclonal IgA antibody of the present invention, the pharmaceutical composition of the present invention, or the orally administered composition of the present invention to a human suffering from an intestinal disease.
  • the human suffering from an intestinal disease may be a target for administration mentioned in the “Pharmaceutical Composition” section above.
  • the specific administration method and dosage amount may also be as described in the “Pharmaceutical Composition” section above.
  • mice 8-week-old wild-type C57BL/6 mice (CLEA Japan, Inc.) were fed until the age of 20 weeks with free access to food and water in an experiment facility of the Nagahama Institute of Bio-Science and Technology. Subsequently, the mice were euthanized with carbon dioxide and then subjected to laparotomy to remove the entire length of the small intestine. After the connective tissue and Peyer's patches were removed from the removed small-intestine sample, a longitudinal incision was made through the small intestine, and the intestinal contents were washed out in a 10-cm dish filled with PBS. The small intestine was washed well with three to four changes of PBS.
  • mice expressing AID G23S mice expressing AID G23S
  • AID G23S mice in which a mutation is introduced at the N-terminal side of AID protein.
  • Such AID G23S mice can be created using a known method, for example, disclosed in Non-patent Literature 18.
  • a digestive-enzyme solution (prepared using 500 ml of RPMI 1640, 25 ml of FCS (final concentration of 5%), 2 ⁇ l of 2-mercaptoethanol (final concentration of 55 ⁇ M), 0.75 g of collagenase, and 5 ml of dispase (final concentration of 1 U/ml)) warmed at 37° C. was placed into a 50-ml tube.
  • the small-intestine fragments were further cut into pieces with scissors and added into the tube. After shaking at 37° C. for 60 minutes, the tube was allowed to stand for 10 seconds to allow the small-intestine tissue to sink. The supernatant was then transferred to a new 50-ml tube. This digestion process using the digestive-enzyme liquid was performed twice.
  • the supernatant separated in the digestion process was centrifuged at 1,500 rpm at 4° C. for 5 minutes, and the supernatant was discarded.
  • the resulting precipitate was further suspended in 1 ml of RPMI 1640 containing 2% FCS. The suspension was passed through a filter to remove tissue fractions, and the resulting suspension of cells was stored on ice.
  • the suspension of cells was collected in the same manner.
  • the two suspensions of cells i.e., the suspension of cells obtained after the first enzyme reaction and the suspension of cells obtained after the second enzyme reaction were combined, and the resulting suspension was used as intestinal lamina limba cells.
  • the intestinal lamina propria cells obtained in the Separation of Intestinal Lamina Propria Cells section above were fused with mouse myeloma NS1 cells to prepare hybridomas. Culture and maintenance of the NS1 cells were conducted before the cell fusion. The cell fusion was performed using the reagents of a ClonaCell (registered trademark)-HY Hybridoma Cloning Kit Provided from STEMCELL Technologies according to the protocol of the kit.
  • a ClonaCell registered trademark
  • the obtained hybridomas were then grown in a medium containing methylcellulose to perform cloning according to the protocol of the kit. Thereafter, the supernatants derived from each subclone were isolated from the growing hybridomas. For the antibodies contained in the supernatants, ELISA was performed to detect whether the produced antibodies were IgA, to measure the IgA antibody titer in the supernatants. Then, IgA-producing hybridoma clones were isorated. As a result, it was confirmed that a total of 37 clones were established.
  • the amplified PCR products of the VDJ region were directly sequenced to analyze the number of variations and VDJ usage.
  • the analysis revealed that 17 kinds of IgA-producing hybridomas were obtained as independent clones. These are respectively referred to as W1, W2, W3, W4, W6, W7, W11, W14, W24, W27, W28, W30, W32, W34, W37, W43, and W47.
  • the 27 clones of IgA antibody producing hybridomas obtained in the Preparation of IgA-producing Hybridomas section above were individually cultured on a large scale in RPMI 1640 containing 10% FCS, and the culture supernatants were collected by centrifugation. Subsequently, the obtained culture supernatants were passed through a 0.22- ⁇ m filter and then subjected to ammonium sulfate precipitation and dialysis against PBS, thereby partially purifying 27 kinds of monoclonal IgA antibodies (also referred to in the Example that follows as “monoclonal IgA antibodies,” preceded by the clone name).
  • each of the 27 clones of hybridomas obtained in the Formation of IgA-producing Hybridomas section was individually injected intraperitoneally into immunodeficient mice and bred for 10 to 21 days, and then ascites was collected from the mice. After the collected ascites was subjected to ammonium sulfate precipitation, the buffer was replaced with PBS using a PD-10 column. 27 kinds of monoclonal IgA antibodies were also thereby partially purified.
  • the concentration of each of the 27 kinds of monoclonal IgA antibodies prepared by the methods described above were measured with ELISA.
  • goat anti-mouse IgA (Southern Biotech) was used as an antibody for coating onto a solid phase in an amount of 2 ⁇ g/ml
  • ALP-labeled goat anti-mouse IgA (Southern Biotech) was used as an antibody for detection in an amount of 0.5 ⁇ g/ml.
  • Mouse IgA ⁇ (Immunology Consultants Laboratory) was used as a standard sample.
  • the cloned indigenous intestinal bacteria of the mice are specifically the following six species of bacteria:
  • a total of 13 species of intestinal bacteria i.e., the six cloned species of indigenous intestinal bacteria described above and the following commercially available bacteria were cultured in optimal conditions, and the bacterial cells were collected by centrifugation: Escherichia coli (DH5 ⁇ strain: obtained from TOYOBO Co., Ltd.), Lactobacillus casei (obtained from ATCC), Coprococcus eutactus (obtained from ATCC), Blautia coccoides (obtained from ATCC), Megamonas hypermegale (obtained from ATCC), Eubacterium rectale (obtained from ATCC), and Bifidobacterium bifidum (obtained from ATCC).
  • each species of bacteria was suspended in 0.05 M Na 2 CO 3 buffer and individually an ELISA plate was coated with each bacterial solution.
  • the 27 kinds of monoclonal IgA antibodies described above were individually added to measure the binding ability and specificity of these monoclonal IgA antibodies against the 13 species of intestinal bacteria. Then, the binding between the bacteria and the antibodies was detected according to the known ELISA method.
  • the antibody used for detection was the same as above.
  • FIG. 1 shows the results. The results revealed that, among the 27 kinds of monoclonal IgA, 22 kinds of monoclonal IgA (the W1, W3, W4, W6, W7, W11, W14, W24, W27, W30, W32, W34, W43, and W45 monoclonal IgA antibodies derived from wild-type mice; the G1, G9, G10, G12, G14, G15, G18, and G19 monoclonal IgA antibodies derived from G23S mice) bound to two or more species of the intestinal bacteria.
  • 22 kinds of monoclonal IgA the W1, W3, W4, W6, W7, W11, W14, W24, W27, W30, W32, W34, W43, and W45 monoclonal IgA antibodies derived from wild-type mice; the G1, G9, G10, G12, G14, G15, G18, and G19 monoclonal IgA antibodies derived from G23S mice
  • the indigenous intestinal bacteria used were Staphylococcus aureus, Escherichia coli and Enterococcus faecalis.
  • FIG. 2 shows the results.
  • the W27 monoclonal IgA antibody most efficiently bound to each species of the intestinal bacteria in a concentration-dependent manner.
  • the same experiment as used for the W27 monoclonal IgA antibody was performed for W27SC3F monoclonal IgA antibody, in which a secretory component bound to the W27 monoclonal IgA antibody, the W11 monoclonal IgA antibody, the W34 monoclonal IgA antibody, the W43 monoclonal IgA antibody, and the G15 monoclonal IgA antibody.
  • the W2 monoclonal IgA antibody was used as a negative control.
  • the W27SC3F monoclonal IgA antibody was produced as follows. First, RNA was extracted from a fragment of about 1 cm of the small intestine of a wild-type mouse. A reverse transcription reaction was performed using the RNA with SuperScript III Produced by Invitrogen to obtain cDNA. The extracellular domain of the polyimmunoglobulin receptor was amplified by PCR using the cDNA as a template and using two primers (EcoRI SCF: 5′-gaattcaccatgaggetctacttg-3′; SEQ ID NO: 69 and Flag SC3R: 5′-ctegagtcacttgtcgtcategtetttgtagteccegggatt-3′; SEQ ID NO: 70).
  • the base sequence of FLAG-tag was added to the reverse primer to make it possible to detect its protein expression in cells with anti-FLAG antibody.
  • the base sequence of the amplified DNA encoded the amino acid sequence set forth in SEQ ID NO: 71.
  • the sequence of FLAG-tag was added to the C-terminal (mSC3F-FLAG).
  • the obtained PCR product was subjected to restriction enzyme treatment and cloned into pcDNA3.1 (+) vector (Invitrogen).
  • the completed expression vector is hereafter referred to as “pcDNA3.1 (+)/mSC 3 F.”
  • the plasmid DNA of pcDNA3.1 (+)/mSC3F was prepared from Escherichia coli and transfected into a hybridoma that produces the W27 monoclonal antibody with Nucleofector (AMAXA). Selection with G418 was then performed.
  • the W27SC3F monoclonal IgA antibody was obtained from the thus-selected hybridoma, according to the method described above for collecting monoclonal IgA antibodies from hybridomas.
  • the indigenous intestinal bacteria used were Enterococcus faecalis, Staphylococcus aureus, Escherichia coli, and Pseudomonas fulva.
  • FIG. 3 shows the results. This experiment also revealed that the W27 monoclonal IgA antibody most efficiently bound to each species of the intestinal bacteria in a concentration-dependent manner.
  • Escherichia coli DH5 ⁇ , commercially available product
  • Escherichia coli a cloned strain from mouse intestinal content
  • Pseudomonas fulva Staphylococcus aureus
  • Eubacterium rectale were used as intestinal bacteria, and each was subjected to shaking culture in 10 ml of LB or an optimum culture medium under conditions appropriate for each species of the bacteria. After the bacterial cells were collected by centrifugation, they were suspended in PBS containing 1% NP-40, sonicated on ice, and allowed to stand on ice for 30 minutes. The supernatants were then obtained by centrifugation.
  • FIG. 4 shows the results.
  • a known method was used to analyze the amino acid sequences of, among the monoclonal IgA antibodies obtained by the method described above, five monoclonal IgA antibodies confirmed as binding to two or more species of intestinal bacteria, i.e., the W27, W30, W34, W43, and W11 monoclonal IgA antibodies.
  • the amino acid sequences were analyzed by using a known method. Specifically, 5′ and 3′ RACE reactions were performed to obtain the full-length base sequences.
  • the RACE method was performed according to the procedure of an In-Fusion (registered trademark) SMARTerTM Directional cDNA library Construction Kit (Clontech).
  • For the heavy chain sequence analysis was performed using a combination of the primers included in the kit and the primers mentioned above.
  • Tables 4 to 8 show the results.
  • the underlined portions in “Full-length Sequence” in these tables indicate variable region, and the portions in bold in “Full-length Sequence” and “Variable Region” indicate CDR1, CDR2, and CDR3 in order from the front to the back (from the N-terminus).
  • nucleic acid sequences encoding these amino acids were as follows:
  • Each of the immunoprecipitation samples was subjected to acetone precipitation and dissolved in a buffer for two-dimensional electrophoresis.
  • the gel used in the first dimension was agar gel (pH of 3 to 8; ATTO).
  • 6% SDS-PAGE was performed.
  • Duplicated samples were prepared every time and simultaneously electrophoresed on two gels.
  • One sample was then subjected to the Western blotting described above to confirm the location of the target protein in the gel. Specifically, after protein transfer to a filter, the transferred protein was stained with a MemCodeTM Reversible Protein Stain Kit (Thermo Scientific) to obtain an image of the staining ( FIG. 5 ).
  • the target protein was identified based on the location information obtained from the first gel and excised from the second gel.
  • the excised gel was subjected to in-gel enzymatic digestion with trypsin at 37° C. for 15 hours.
  • the prepared mutants had the amino acid sequences at the following positions in the amino acid sequence represented by SEQ ID NO: 74:
  • FIG. 10 shows the results.
  • the W27 monoclonal IgA antibody was orally administered to mice in a state of overreaction of the intestinal immune system. Hyperplasia of Peyer's patch germinal center and increase in the production of inflammatory cytokines was observed in intestinal tissue of the mice.
  • Feed was also given to all the mice in the same manner as in usual feeding.
  • mice were euthanized, and the Peyer's patches were excised from the small intestine of tested mice.
  • the Peyer's patch tissue was separated into single cells using glass slides, followed by staining of surface antigens of the cells with the antibodies described below.
  • the percentage of the cell number of germinal center B cell fractions that exhibited B220 + PNA high was determined using flow cytometry analysis to investigate whether the germinal centers themselves regressed due to the administration of the W27 monoclonal IgA antibody.
  • the antibodies used in the flow cytometry are as follows:
  • AID G23S mice are suitable for use as a mouse model of inflammatory bowel disease, ulcerative colitis, and like diseases.
  • Peyer's patch germinal center B cells grew excessively in the AID G23S mice.
  • IgA antibodies in the intestinal immune system are produced in Peyer's patch germinal center B cells.
  • an excessive increase in the B cells indicates that IgA antibodies are excessively produced in the intestinal immune system.
  • T cells are complementarily activated in the intestinal immune system, which results in the increase in the production of inflammatory cytokines to cause inflammation, as described above.
  • the W27 monoclonal IgA antibody which has the effect of reducing the number of Peyer's patch germinal center B cells, makes it possible to normalize the intestinal immune system and suppress the function of, for example, T cells, thereby resolving inflammation.
  • the W27 monoclonal IgA antibody is effective against diseases caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, such as inflammatory bowel disease and ulcerative colitis, and, furthermore, intestinal diseases.
  • FIG. 11 shows the comparative results of analysis indicating redaction or pathological atrophy in the crypts between the large intestine of 13- to 15-week-old AID G23S mice to which the W27 monoclonal IgA antibody was orally administered for four weeks and the large intestine of 13- to 15-week-old wild-type mice or the large intestine of 13- to 15-week-old AID G23S mice not treated with W27 monoclonal IgA antibody.
  • the contents of the entire large intestine were removed, and the large intestine was washed with saline, wound around a toothpick, embedded in OCT compound, and frozen.
  • the W27 monoclonal IgA antibody was orally administered to the AID knockout mice in the same dose and method as in the oral administration experiment described above. Specifically, the W27 monoclonal IgA antibody was added to drinking water at a concentration of 25 ⁇ g/ml, and the resulting drinking water was administered by oral ingestion for 28 days in a sustained manner. On day 2, feces were collected. 100 mg of the collected feces was suspended in 0.9 ml of PBS, and the suspension was centrifuged to collect the supernatant. The IgA concentration in the supernatant was measured by ELISA.
  • FIG. 8 shows the results.
  • the W27 monoclonal IgA antibody was detected from the feces. This fact revealed that after being orally administered, the W27 monoclonal IgA antibody reached the intestine with no influence of, for example, digestive enzymes in the gastrointestinal tract. This suggests that the W27 monoclonal antibody sufficiently exhibits a function as an orally administered composition.
  • Escherichia coli strain DH5 ⁇ was added to an LB liquid medium and subjected to shaking culture at 37° C. overnight. The following day, the resulting Escherichia coli liquid was suitably diluted, seeded onto an LB plate, and cultured at 37° C. overnight. The number of Escherichia coli in the Escherichia coli liquid was calculated by counting the number of colonies on the plate on the following day. The obtained number was defined as the number of Escherichia coli at the start of the growth suppression experiment.
  • the 96-well plate was subjected to static culture at 37° C. for 7 hours. After 7 hours, the resulting Escherichia coli liquids were individually diluted appropriately, seeded onto LB plates, and cultured at 37° C. overnight. On the following day, the number of colonies on each LB plate was counted to measure the number of Escherichia coli.
  • the number of the bacterial cells calculated at the start of the experiment described above was defined as 1. Using this standard, the numbers of the bacterial cells after incubation with the IgA antibodies were calculated and plotted in a graph as the proliferation rate (the ordinate of the graph in FIG. 12 ).
  • FIG. 12 shows the results.
  • the W27SC3F monoclonal IgA antibody which is secretory IgA, exhibits the most potent growth suppression effect. This fact suggests that secretory IgA dimers actually secreted in the intestine in vivo recognize and bind to the bacteria and then exhibits unique effector functions, resulting in suppression of Escherichia coli growth. This suggested that when a monoclonal IgA antibody is used for controlling intestinal bacteria, it is preferably in the form of secretory IgA.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Pulmonology (AREA)
  • Diabetes (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Transplantation (AREA)
  • Child & Adolescent Psychology (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Nutrition Science (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The present invention provides a component having effects in vivo of improving or optimizing the intestinal environment, suppressing intestinal putrefaction, or suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota. The invention also provides an active ingredient suitably used for treating intestinal diseases. The invention provides a monoclonal IgA antibody that binds to amino acids 11 to 333 of serine hydroxymethyltransferase.

Description

    TECHNICAL FIELD
  • The present invention relates to a monoclonal IgA antibody, an orally or enterally administered composition containing the monoclonal IgA antibody, and a pharmaceutical composition containing the monoclonal IgA antibody.
  • BACKGROUND ART
  • For a living body, the inside of the intestinal tract is equivalent to the outside of the body and is always exposed to a very wide variety and large number of intestinal indigenous bacteria, viruses, and antigens derived from, for example, food. These intestinal indigenous bacteria form gut microbiota (hereinafter “gut microbiota” may be referred to as “intestinal bacterial flora”).
  • It has been clarified that gut microbiota performs various functions in a living body via mucosal surfaces constructed with intestinal epithelial cells and other cells. It has also been found that when intestinal bacteria are not present, the intestinal immune system cannot normally develop (Non-patent Literature (NPL) 1 to 3).
  • If gut microbiota undergoes a change, and the symbiotic balance between the host and intestinal bacteria is disrupted, the homeostasis of the intestinal immune system is disrupted due to the intestinal immune system being overly stimulated. As a result, many diseases, such as inflammatory bowel disease, colorectal cancer, asthma, allergies, and obesity, may be induced with the disruption of the homeostasis. In view of this, the intestinal immune system is known to play an important role not only in eliminating pathogens, etc., but also in maintaining homeostasis of the whole immune system (Non-patent Literature (NPL) 4 to 7).
  • The surface of mucosal tissue in the gastrointestinal tract is a route by which antigens, such as indigenous bacteria, pathogenic microorganisms, and allergens invade a living body. The surface of mucosal tissue is continuously attacked as the site where these many pathogenic microorganisms from the external environment invade, and is exposed to various antigens. The system for recognizing and/or responding to foreign antigens, including these pathogenic microorganisms, is called the mucosal immune system. Many cells that are responsible for mucosal immune system are present immediately below the surface of mucosal tissue in the gastrointestinal tract. These cells form a dynamic immune organization by which an immune response occurs against pathogenic microorganisms, food antigens, allergens, exogenous foreign antigens, and the like.
  • The mucosal immune system constructs unique immune system that is based on an IgA antibody derived from an intestine against foreign exogenous antigens taken up through the mucosal surface constructed with intestinal epithelial cells. The intestine-derived IgA antibody is produced not only within specific tissues that are sites of immune response, such as Peyer's patches, mesenteric lymph nodes, and isolated lymphoid follicles, in a T-cell-dependent manner, but also produced in a large amount by antibody-producing cells disseminated among the intestinal lamina propria (Non-patent Literature (NPL) 8 and 9).
  • One of the functions of the intestine-derived IgA antibody is to eliminate pathogens. The intestine-derived IgA antibody secreted into the lumen binds to pathogens and their toxins in the intestinal lumen and neutralizes them. Alternatively, the intestine-derived IgA antibody binds to pathogens, toxins, etc., that invade intestinal epithelial cells, lamina propria, and the like, and neutralizes them while eliminating them as the intestine-derived IgA antibody itself is secreted into the lumen. A feature of the function of intestine-derived IgA antibody is that they do not cause inflammatory reactions, unlike reactions of the systemic immune system in which general antibodies are involved (Non-patent Literature (NPL) 10 to 12).
  • Another function of intestine-derived IgA antibody is to maintain the symbiotic relationship between intestinal indigenous bacteria and their hosts. An intestine-derived IgA antibody recognizes and binds to not only pathogens but also indigenous bacteria to prevent excessive entry of indigenous bacteria into the mucous membrane. In addition, it is believed that indigenous bacteria are not eliminated by intestine-derived IgA, and that intestine-derived IgA antibodies binding to indigenous bacteria are localized in the mucin layer on epithelial cells and form a biological film with the indigenous bacteria, in which the biological film prevents pathogens from contacting or invading the epithelial cells (Non-patent Literature (NPL) 13 and 14).
  • In relation to these intestinal mucosal immune systems, somatic hypermutation and class switching of antibody are known to play an important role to construct, in particular, the humoral immune system. Somatic hypermutation is a mechanism that is provided in vivo so as to diversify the immunoglobulin gene of antibody-producing B cells and produce high-affinity antibodies. Antibody class switching is a phenomenon in which the structure of the H-chain constant region is changed while the variable region of the antibody is maintained. In other words, antibody class switching is a phenomenon in which the class of immunoglobulin generated from a selected cell producing an IgM antibody is changed to different classes of immunoglobulins, such as IgG, IgE, and IgA, with the same variable region as the IgM. Due to a combination of somatic hypermutation and class switch recombination of the antibody, a variety of antibodies with various antigen-binding sites is produced, and antibodies of each class with respect to each antigen-binding site are produced. As a result, it is possible to appropriately regulate the immune functions in the body.
  • Both somatic hypermutation and class switching are known to require an activation-induced cytidine deaminase (AID) protein. The N-terminal domain of the AID protein is known to be involved in somatic hypermutation, while C-terminal domain of AID protein is known to be involved in class switching (Non-patent Literature (NPL) 15 and 16). In somatic hypermutation, AID is highly likely to cause DNA cleavage in an antibody gene, and the DNA cleavage triggers the introduction of mutation in an antibody gene (Non-patent Literature (NPL) 17).
  • In mice expressing AID-G23S (AID G23S mouse), which carries one amino acid substitution (glycine to serine) at position 23 of the AID protein, class switching occurs, and antibodies of each class are sufficiently produced. However, somatic hypermutation does not occur, and antigen binding ability of the antibodies is reduced in an AID G23S mouse (Non-Patent literature (NPL) 18).
  • Inflammatory bowel disease is difficult to cure and is thus specified as an intractable disease. This disease is an example of diseases caused by disruption of the balance between the host immune system and intestinal bacteria, i.e., alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota (“alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota” may be refer to as “dysbiosis”). In a clinical setting, this disease is treated by systemic administration of an immunosuppressant agent, such as a steroid and an anti-TNF antibody. However, these drugs require long-term administration, and a significant problem of side effects arises from these drugs. Therefore, it is desired that a medicinal drug that has reduced side effects and that is effective in treating or preventing intestinal diseases, such as inflammatory bowel disease, is developed.
  • CITATION LIST Non-Patent Literature
  • NPL 1: Cerf-Bensussan N and Gaboriau-Routhiau V, Nat Rev Immunol 2010; 10:735
  • NPL 2: Hooper L V and Macpherson A J, Nat Rev Immunol 2010; 10:159
  • NPL 3: Round J L and Mazmanian S K, Proc Natl Acad Sci USA 2010; 107:12204
  • NPL 4: Vijay-Kumar M et al., Science 2010; 328:228
  • NPL 5: Shulzhenko N et al., Nat Med 2011; 17:1585
  • NPL 6: Bry L et al., Science 1996; 273:1380
  • NPL 7: Turnbaugh P J et al., Nature 2006; 444:1027
  • NFL 8: Cerutti A et al., Ann NY Acad Sci 2011; 1238:132
  • NPL 9: Fagarasan S et al., Annu Rev Immunol 2010; 28:243
  • NPL 10: Fernandez M I et al., Immunity 2003; 18:739
  • NPL 11: Martinoli C et al., Immunity 2007; 27:975
  • NPL 12: Boullier S et al., J Immunol 2009; 183:5879
  • NPL 13: Phalipon A et al., Immunity 2002; 17:107
  • NPL 14: Macpherson A J and Uhr T, Science 2004; 303:1662
  • NPL 15: Shinkura R et al., Nat Immunol 2004; 5:707
  • NPL 16: Ta V T et al., Nat Immunol 2003; 4:843
  • NPL 17: Chaudhuri J et al. Nature 2003; 422:726
  • NPL 18: Wei M et al., Nature Immunology 12(3), 264-270, 2011
  • SUMMARY OF INVENTION Technical Problem
  • An object of the present invention is to provide a component having effects in vivo of improving or optimizing the intestinal environment, suppressing intestinal putrefaction, or suppressing alternation of intestinal bacterial growth or pathological changes of intestinal bacterial growth in gut microbiota. Another object of the present invention is to provide an active ingredient suitably used for treating intestinal diseases.
  • Solution to Problem
  • The present inventor conducted extensive research to solve the above problems and found that a monoclonal IgA antibody that specifically binds to a particular region of a protein having a particular amino acid sequence has effects to suppress an excessive response in the intestinal immune system and to make recovery from reduction of crypts in the lamina propria in the large intestine. These effects of a monoclonal IgA antibody were confirmed by orally administering the antibody to an individual.
  • The present invention has been accomplished based on the above findings and includes the broad embodiments described below.
  • Item 1: A monoclonal IgA antibody that binds to amino acids 11 to 333 of serine hydroxymethyltransferase.
  • The embodiment of the invention described in Item 1 broadly includes the embodiments of monoclonal IgA antibody described in the following Items 1-1 to 1-17.
  • Item 1-1: The monoclonal IgA antibody according to Item 1, wherein the monoclonal IgA antibody binds to amino acids 25 to 44 of serine hydroxymethyltransferase.
  • Item 1-2: The monoclonal IgA antibody according to Item 1, wherein the monoclonal IgA antibody binds to amino acids 25 to 28 of serine hydroxymethyltransferase.
  • Item 1-3: The monoclonal IgA antibody according to Item 1, 1-1, or 1-2, wherein the monoclonal IgA antibody comprises a heavy chain variable region containing
    • (1) a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, 13, 23, 33, or 43,
    • (2) a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 4, 14, 24, 34, or 44, and
    • (3) a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 5, 15, 25, 35, or 45,
    • and/or a light chain variable region containing
    • (I) a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, 18, 28, 38, or 48,
    • (II) a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 9, 19, 29, 39, or 49, and
    • (III) a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10, 20, 30, 40 or 50.
  • Item 1-4: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-3, wherein the monoclonal IgA antibody comprises a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, 12, 22, 32, or 42, and/or a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7, 17, 27, 37, or 47.
  • Item 1-5: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-4, wherein the monoclonal IgA antibody comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31, or 41, and/or a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46.
  • Item 1-6: The monoclonal IgA antibody according to any one of items 1 and 1-1 to 1-5, wherein the monoclonal IgA antibody inhibits the growth of at least two kinds of intestinal bacteria.
  • Item 1-7: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-6, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 1-8: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-7, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 1-9: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-8, wherein the monoclonal IgA antibody is IgA1 or IgA2.
  • Item 1-10: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-9, wherein the monoclonal IgA antibody contains a chain-containing polymer.
  • Item 1-11: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-10, wherein the monoclonal IgA antibody contains a secretory component.
  • Item 1-12: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-11, wherein the monoclonal IgA antibody has an amino acid sequence derived from the same species.
  • Item 1-13: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-12, wherein the monoclonal IgA antibody has an amino acid sequence derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 1-14: The monoclonal IgA antibody according to any one of Items 1 and 1-1 to 1-11, wherein the monoclonal IgA antibody has amino acid sequences derived from different species.
  • Item 1-15: The monoclonal IgA antibody according to any one of Items 1, 1-1 to 1-11, and 1-14, wherein the monoclonal IgA antibody has amino acid sequences derived from at least two species selected from the group consisting of a mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, monkey, chicken, chimpanzee, and human.
  • Item 1-16: The monoclonal IgA antibody according to any one of Items 1, 1-1 to 1-11, 1-14, and 1-15, wherein the monoclonal IgA antibody is a humanized antibody.
  • Item 1-17: The monoclonal IgA antibody according to any one of Items 1, 1-1 to 1-11, 1-14, and 1-15, wherein the monoclonal IgA antibody is a chimeric antibody.
  • Item 2: A method for producing the monoclonal IgA antibody of Item 1, wherein the method comprises the following steps 1 and 2:
  • (1) step 1: mixing and fusing B cells collected from an intestinal lamina propria with other types of cells to prepare hybridomas; and
  • (2) step 2: culturing the hybridomas formed in step 1, determining cells that produce a monoclonal IgA antibody that binds to at least two kinds of intestinal bacteria, and collecting the IgA antibody from the cells.
  • The embodiment of the invention described in Item 2 broadly includes the embodiments of the monoclonal IgA antibody production method described in the following Items 2-1 to 2-18.
  • Item 2-1: The production method according to Item 2, wherein the B cells are IgA antibody-producing cells.
  • Item 2-2: The production method according to Item 2 or 2-1, wherein the intestinal lamina propria is derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 2-3: The Production method according to Item 2, 2-1, or 2-2, wherein the other cells are myeloma cells.
  • Item 2-4: The production method according to any one of Items 2 and 2-1 to 2-3 wherein the other cells are derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 2-5: The production method according to any one of Items 2 and 2-1 to 2-4, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 2-6: The production method according to any one of Items 2 and 2-1 to 2-5, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 2-7: The production method according to any one of Items 2 and 2-1 to 2-6, wherein the monoclonal IgA antibody is IgA1 or IgA2.
  • Item 2-8: The production method according to any one of Items 2 and 2-1 to 2-7, wherein the monoclonal IgA antibody contains a J chain-containing polymer.
  • Item 2-9: The production method according to any one of Items 2 and 2-1 to 2-8, wherein the monoclonal IgA antibody contains a secretory component.
  • Item 2-10: The production method according to any one of Items 2 and 2-1 to 2-9, wherein the monoclonal IgA antibody has an amino acid sequence derived from the same species.
  • Item 2-11: The production method according to any one of Items 2 and 2-1 to 2-10, wherein the monoclonal IgA antibody has an amino acid sequence derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 2-12: The production method according to any one of Items 2 and 2-1 to 2-9, wherein the monoclonal IgA antibody has amino acid sequences derived from different species.
  • Item 2-13: The production method according to any one of Items 2, 2-1 to 2-9, and 2-12, wherein the monoclonal IgA antibody has amino acid sequences derived from at least two species selected from the group consisting of mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and human.
  • Item 2-14: The production method according to any one of Items 2, 2-1 to 2-9, 2-12, and 2-13, wherein the monoclonal IgA antibody is a humanized antibody.
  • Item 2-15: The production method according to any one of Items 2, 2-1 to 2-9, 2-12, and 2-13, wherein the monoclonal IgA antibody is a chimeric antibody.
  • Item 2-16: The production method according to any one of Items 2 and 2-1 to 2-15, wherein the monoclonal IgA antibody comprises a heavy chain variable region containing
    • (1) a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, 13, 23, 33, or 43,
    • (2) a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 4, 14, 24, 34, or 44, and
    • (3) a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 5, 15, 25, 35, or 45,
    • and/or a light chain variable region containing
    • (I) a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, 18, 28, 38, or 48,
    • (II) a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID No: 9, 19, 29, 39, or 49, and
    • (III) a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10, 20, 30, 0 or 50.
  • Item 2-17: The production method according to any one of Items 2 and 2-1 to 2-16, wherein the monoclonal IgA antibody comprises a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, 12, 22, 32, or 42, and/or a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7, 17, 27, 37, or 47.
  • Item 2-18: The production method according to any one of Items 2 and 2-1 to 2-17, wherein the monoclonal IgA antibody comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31, or 41, and/or a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46.
  • Item 3: A pharmaceutical composition containing the monoclonal IgA antibody of Item 1.
  • The embodiment of the invention described in Item 3 broadly includes the embodiments of pharmaceutical composition described in the following Items 3-1 to 3-6.
  • Item 3-1: The pharmaceutical composition according to Item 3, wherein the pharmaceutical composition is used in the treatment of an intestinal disease.
  • Item 3-2: The pharmaceutical composition according to Item 3 or 3-1, wherein the intestinal disease is caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 3-3: The pharmaceutical composition according to Item 3, 3-1, or 3-2, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 3-4: The pharmaceutical composition according to any one of Items 3 and 3-1 to 3-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 3-5: The pharmaceutical composition according to any one of Items 3 and 3-1 to 3-4, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 3-6: The pharmaceutical composition according to any one of Items 3 and 3-1 to 3-5, wherein the pharmaceutical composition is orally or enterally administered.
  • Item 4: An orally or enterally administered composition containing the monoclonal IgA antibody of Item 1.
  • The embodiment of the invention described in Item 4 broadly includes the embodiments of the orally or enterally administered composition described in the following Items 4-1 to 4-6.
  • Item 4-1: The orally or enterally administered composition according to Item 4, wherein the orally or enterally administered composition suppresses alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 4-2: The orally or enterally administered composition according to Item 4 or 4-1, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 4-3: The orally or enterally administered composition according to Item 4, 4-1, or 4-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 4-4: The orally or enterally administered composition according to any one of Items 4 and 4-1 to 4-3, wherein the orally or enterally administered composition is a composition that improves the intestinal environment, a composition that optimizes the intestinal environment, or a composition that prevents intestinal putrefaction.
  • Item 4-5: The orally or enterally administered composition according to any one of items 4 and 4-1 to 4-4, wherein the orally or enterally administered composition is a food and beverage composition.
  • Item 4-6: The orally or enterally administered composition according to any one of Items 4 and 4-1 to 4-5, wherein the orally or enterally administered composition is a feed composition.
  • Item 5: A nucleic acid encoding the monoclonal IgA antibody of Item 1.
  • Item 6: A hybridoma that produces the monoclonal IgA antibody of Item 1.
  • The embodiment of the invention described in Item 6 broadly includes the embodiments of the hybridoma described in the following Items 6-1 to 6-4.
  • Item 6-1: The hybridoma according to Item 6, wherein the hybridoma is derived from the same species.
  • Item 6-2: The hybridoma according to Item 5 or 6-1, wherein the hybridoma is derived from mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 6-3: The hybridoma according to Item 6, wherein the hybridoma is derived from different species.
  • Item 6-4: The hybridoma according to Item 6 or 6-2, wherein the hybridoma is derived from at least two species selected from the group consisting of mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, or human.
  • Item 7: A method for suppressing the growth of at least two kinds of intestinal bacteria, wherein the method comprises step of contacting the antibody of Item 1 to at least two kinds of intestinal bacteria.
  • The embodiment of the invention described in Item 7 broadly includes the embodiments of the disease treatment method described in the following Items 7 to 7-3.
  • Item 7-1: The method according to Item 7, wherein the contacting of the antibody to the intestinal bacteria is performed within the intestine.
  • Item 7-2: The treatment method according to Item 7 or 7-1, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 7-3: The treatment method according to any one of Items 7, 7-1, or 7-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 8: A method for treating an intestinal disease, wherein the method comprises the step of administering an effective amount of the antibody of Item 1 to a human suffering from an intestinal disease.
  • The embodiment of the invention described in Item 8 broadly includes the embodiments of the disease treatment method described in the following Items 8-1 to 8-5.
  • Item 8-1: The treatment method according to Item 8, wherein the intestinal disease is caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 8-2: The treatment method according to Item 8 or 8-1, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 8-3: The treatment method according to Item 8, 8-1, or 8-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 8-4: The treatment method according to any one of Items 8 and 8-1 to 8-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 8-5: The treatment method according to any one of Items 8 and 8-1 to 8-4, wherein the administration is performed orally or enterally.
  • Item 9: A monoclonal IgA antibody for use in treating an intestinal disease, wherein the monoclonal IgA antibody is defined in Item 1.
  • The embodiment of the invention described in Item 9 broadly includes the embodiments of the monoclonal IgA antibody described in the following Items 9-1 to 9-5.
  • Item 9-1: The monoclonal IgA antibody according to Item 9, wherein the monoclonal IgA antibody is used in treating an intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 9-2: The monoclonal IgA antibody according to Item 8 or 8-1, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 9-3: The monoclonal IgA antibody according to Item 9, 9-1, or 9-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 9-4: The monoclonal IgA antibody according to any one of Items 9 and 9-1 to 9-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 9-5: The monoclonal IgA antibody according to any one of Items 9 and 9-1 to 9-4, wherein the monoclonal IgA antibody is used for oral or enteral administration.
  • Item 10: Use of the monoclonal IgA antibody of Item 1, for the manufacture of a medicament for treating an intestinal disease.
  • The embodiment of the invention described in Item 10 broadly includes the embodiments of the use of monoclonal IgA antibody described in the following Items 10-1 to 10-5.
  • Item 10-1: The use according to Item 10, wherein the intestinal disease is caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota.
  • Item 10-2: The use according to Item 10 or 10-1, wherein the intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is selected from the group consisting of inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • Item 10-3: The use according to Item 10, 10-1 or 10-2, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas, and
    • bacteria belonging to the genus Enterorhabdus.
  • Item 10-4: The use according to any one of Items 10 and 10-1 to 10-3, wherein the intestinal bacteria are at least two kinds of bacteria selected from the group consisting of
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva, and
    • Enterorhabdus mucosicola.
  • Item 10-5: The use according to any one of Items 10 and 10-1 to 10-4, wherein the use is for oral or enteral administration.
  • BRIEF DESCRIPTION OF DRAWINGS
  • FIG. 1 shows experimental results to investigate the binding ability of monoclonal IgA for various intestinal bacteria. In FIG. 1, the rows in the table indicate the bacteria from top to bottom: Escherichia coli (DH5α strain), Escherichia coli (a cloned strain from mouse intestinal bacteria), Staphylococcus aureus, Enterococcus faecalis, Pseudomonas fulva, Lactobacillus murinus, Enterorhabdus mucosicola, Lactobacillus casei, Coprococcus eutactus, Blautia coccoides, Megamonas hypermegale, Eubacterium rectale, and Bifidobacterium bifidum. In FIG. 1, the columns in the table indicate the names of the following clones from left to right: W1, W2, W3, W4, W6, W7, W11, W14, W24, W27, W28, W30, W32, W34, W37, W43, and W45, followed by G1, G8, G9, G10, G12, G14, G15, G16, G18, and G19. “N/A” in FIG. 1 indicates “unconfirmed.”
  • FIG. 2 shows experimental results to evaluate the concentration-dependent binding ability of monoclonal IgA for various intestinal bacteria. From left to right, the graphs illustrate results of binding to Staphylococcus aureus, Escherichia coli, and Enterococcus faecalis. In the graphs of FIG. 2, the ordinate indicates OD (405 nm) values, and the abscissa indicates the concentration of each IgA antibody used (0.017, 0.05, 0.17, 0.5, 1.7, 5.0, 17, and 50 μg/ml).
  • FIG. 3 shows experimental results to evaluate the concentration-dependent binding ability of monoclonal IgA for various intestinal bacteria. The graph in the upper left indicates results of binding to Enterococcus faecalis, the graph in the upper right indicates results of binding to Staphylococcus aureus, the graph in the lower left indicates results of binding to Escherichia coli, and the graph in the lower right indicates results of binding to Pseudomonas fulva. In the graphs of FIG. 3, the ordinate indicates OD (405 nm) values, and the abscissa indicates the concentration of each IgA antibody used (0.017, 0.05, 0.17, 0.5, 1.7, 5.0, 17, and 50 μg/ml).
  • FIG. 4A-D show results of Western blot analysis for cell extracts from various intestinal bacteria by using various monoclonal IgA antibodies. FIG. 4(A) indicates experimental results using W27 monoclonal IgA antibody, FIG. 4(B) indicates experimental results using W30 monoclonal IgA antibody, and FIG. 4(C) indicates experimental results using W45 monoclonal IgA antibody. In each figure, the lanes from left to right indicate the extracts of Escherichia coli (DH5α strain; commercially available product), Escherichia coli (a cloned strain from mouse intestinal bacteria), Pseudomonas fulva, and Staphylococcus aureus. FIG. 4(D) indicates experimental results using W27 monoclonal IgA antibody. The lanes from the left to the right indicate the extracts of Eubacterium rectale, Blautia coccoides, Coprococcus eutactus, Megamonas hypermegale, Lactobacillus casei, and Bifidobacterium bifidum.
  • FIG. 5 shows results of two-dimensional electrophoresis. The top left indicates results of Western blotting, the top right indicates results of MemCode reversible protein staining, and the bottom row indicates results of silver staining. Spots (arrows) were confirmed to be located at the same position in all the figures, and the gel was excised and subjected to MS analysis.
  • FIG. 6 shows HE-stained sections of the large intestine of G23S mice.
  • FIG. 7 shows experimental results to measure the number of Peyer's patch germinal center B cells when W27 monoclonal IgA antibody was orally administered to mice.
  • FIG. 8 is a graph showing experimental results to confirm the kinetics in the body when W27 monoclonal IgA antibody was orally administered to mice. The ordinate in the graph indicates the antibody titer (μg/ml) of the IgA antibody in feces.
  • FIG. 9 shows results of Western blotting using various monoclonal IgA antibodies. Most of these poly-reactive IgA antibodies recognize serine hydroxymethyltransferase (SHMT).
  • FIG. 10 shows results of an experiment to identify the epitope for various monoclonal IgA antibodies, using various mutants of serine hydroxymethyltransferase.
  • FIG. 11 shows HE-stained sections of the large intestine of G23S mice. This shows the state of the crypts when W27 monoclonal IgA antibody was administered. The atrophy in the crypts observed in the large intestine of G23S mice was normalized by administration of the W27 antibody.
  • FIG. 12 is a graph showing the effect of the monoclonal IgA antibody of the present invention on Escherichia coli growth suppression.
  • DESCRIPTION OF EMBODIMENTS Monoclonal IgA Antibody
  • The monoclonal IgA antibody of the present invention specifically binds to amino acids 11 to 333 of the amino acid sequence of serine hydroxymethyltransferase. The amino acids from either 11 or 25 to any of 28, 37, 44, 250, or 330 (11 to 250, 11 to 44, 11 to 37, 11 to 28, 25 to 333, 25 to 250, 25 to 44, 25 to 37, or 25 to 28) of the amino acid sequence are preferable, and the amino acids 23 to 44 of the amino acid sequence are more preferable, and the amino acids 25 to 28 of the amino acid sequence are most preferable.
  • Serine hydroxymethyltransferase has a molecular weight of about 45 to 50 kDa and an isoelectric point of about 4.3 to 4.7. Specifically, when it is derived from, for example, Escherichia coli, serine hydroxymethyltransferase is a protein consisting of, for example, the amino acid sequence of accession no. J01620 J01621; and version J01620.1 GI: 146216, shown on the NCBI website. More specifically, this protein has the amino acid sequence represented by SEQ ID NO 74. This protein is an enzyme that functions to reversibly convert L-serine to glycine, and tetrahydrofolic acid to 5,10-methylene tetrahydrofolic acid at the same time. The conformation of this enzyme is highly conserved in Escherichia coli and also in mammals.
  • TABLE 1
    Origine (start aa)-----sequence----(end aa)
    Escherichia coli 21 QEKV RQ EEHI ELIASEN YTSPRVM  44
    Eubacterium rectale 20 DEFE RQNSHI ELIASEN WVSPAVM  43
    Pseudomonas fulva 21 QEAL RQ EEHI ELIASEN YTSPAVM  44
    Staphylococcus aureus 17 REFQ RQ NSNI ELIASEN FVSEAVM  40
    Bacteroides fragilis 13 KEHQ RQ LKGI ELIASEN FVSDQVM  36
    Haemophilus influenzae 21 DENR RQ EEHI ELIASEN YASPRVM  44
    Kiebsiella pneumoniae 21 QEKV RQ EEHI ELIASEN YTSPRVM  44
    Legionella pneumophilia 21 DEKR RQ EEHI ELIASEN YVSPRVL  44
    Rickettsia rickettsi 21 HEKL RQ SSVI ELIASEN FVSPAVL  44
    Salmonella paratyphi A 21 QEKV RQ EEHI ELIASEN YTSPRVM  44
    Salmonella typhimurium 21 QEKV RQ EEHI ELIASEN YTSPRVM  44
    Shigella flexneri 21 QEKV RQ EEHI ELIASEN YTSPRVM  44
    Streptococcus pneumoniae 21 KEEE RQ QNNI ELIASEN VVSKAVM  44
    Yersinia pestis bv. AntiqueM 21 QEVV RQ EEHI ELIASEN YTSPRVM  44
    Mycobaceteirumtuberculosis 18 KELG RQ RDTL E M IASEN FVPRAVL  41
    Burkholderiamallei 22 QENV RQ EEHI ELIASEN YTSPAVM  45
    Lactobacilluscasei 16 NEEE RQ EHNI ELIASEN IVSPAVR  39
    Coprococcus eutactus 20 DELN RQNNNL ELIASEN IVSKAVM  43
    Bordatellaparapertussia 32 AERQ RQ MHSI ELIASEN FVSQAVL  55
    Saccharomycescerevisiae 46 QERH RQ KHSI  T LI P SEN FTSKAVM  69
    Schizosaccharomycespompe 47 SEKS RQ KESI ALIASEN FTSRAVM  70
    Arabidopsisthaliana 96 KEKD RQ FRSL ELIASEN FTSRAVM 119
    Rabbit 62 REKD RQ CRGL ELIASEN FCIRAAL  85
    Mouse 33 KESN RQ RVGL ELIASEN PASRAVL  56
    Human 62 REKD RQ CRGL ELIASEN FCSRAAL  85
    Megamonashypermegale         motif not found.
    Bifidobacteriumbifidum         motif not found
  • Table 1 shows the alignment between the amino acids 21 to 44 of the amino acid sequence of Escherichia coli-derived serine hydroxymethyltransferase, in which the amino acid sequence of serine hydroxymethyltransferase is represented by SEQ ID NO: 74, and the amino acid sequence of other intestinal bacteria which correspond to amino acids 21 to 44 of the amino acid sequences of Escherichia coli-derived serine hydroxymethyltransferase. Amino acids 25 to 26 (RQ), 31 to 44, and, in particular, 31 to 37 (ELIASEN) of Escherichia coli-derived serine hydroxymethyltransferase are highly conserved in a large number of the species as shown in Table 1. As described in the Examples below, these amino acid sequences, i.e., amino acids 25 to 26 (RQ) and 31 to 44 of the amino acid sequence of Escherichia coli-derived serine hydroxymethyltransferase, are the smallest units of the amino acid sequence that are considered to be included in the epitope of Escherichia coli-derived serine hydroxymethyltransferase, to which the monoclonal IgA antibody of the present invention binds. Therefore, the epitope for the monoclonal IgA antibody or the present invention is considered to contain regions corresponding to amino acids 25 to 26 and 31 to 44 of the amino acid sequence represented by SEQ ID NO: 74, in addition to amino acids 25 to 28 of the amino acid sequence.
  • In addition to Escherichia coli, examples of the origins of serine hydroxymethyltransferase which are bound with the monoclonal IgA antibody of the present invention include, but are not particularly limited to, bacteria belonging to the genus Pseudomonas, such as Pseudomonas fulva; Staphylococci, such as Staphylococcus aureus; Eubacterium rectale, Haemophilus influenzae, Klebsiella pneumoniae, Legionella pneumophila, Salmonella paratyphi A, Salmonella typhimurium, Shigella flexneri, Yersinia pestis bv. Antique, Burkholderia mallei, and the like.
  • The serine hydroxymethyltransferase that is derived from an origin other than the origins listed as examples above is not bound with monoclonal IgA antibody of the present invention or the antibody tends to dissociate immediately even if the binding between the serine hydroxymethyltransferase and the antibody occurs. Examples of such origins include, but are not particularly limited to, Lactobacillus casei, Bifidobacterium bifidum, and like lactobacillus, Blautia coccoides, Coprococcus eutactus, Megamonas hypermegale, and Bordetella parapertussis; Saccharomyces cerevisiae, Schizosaccharomyces pompe, Arabidopsis thaliana, rabbit, mouse, human, and like eukaryotes. The presence or absence of the bond and the binding tendency are confirmed by applying Western blotting using the monoclonal IgA antibody of the present invention to the lysates of various cultured cells.
  • As described above, the particular site (epitope) of serine hydroxymethyltransferase which is specifically bound with the monoclonal IgA antibody of the present invention may be confirmed, for example, as described in the Examples of the present specification: a truncated mutant of serine hydroxymethyltransferase is produced, and known immunochemistry techniques, such as Western blotting, may be used to confirm whether the monoclonal IgA of the present invention binds to the produced truncated mutant protein.
  • Alternatively, a mutant may be produced in which a portion of the amino acid sequence of wild-type serine hydroxymethyltransferase derived from, for example, Escherichia coli to which the monoclonal IgA antibody of the present invention binds as described above is replaced with an amino acid sequence that corresponds to the portion of the amino acid sequence above and that is a portion of the amino acid sequence of wild-type serine hydroxymethyltransferase derived from, for example, lactobacillus in which the portion is not bound with the monoclonal IgA antibody of the present invention or dissociates immediately even if the binding between the portion and the antibody occurs as described above. When the produced mutant protein cannot be bound with the monoclonal IgA antibody of the present invention or shows decrease in binding ability compared to that of wild-type serine hydroxymethyltransferase, the replaced portion of the amino acid sequence may be determined to be the amino acid sequence to which the monoclonal IgA antibody of the present invention specifically binds in the amino acid sequence of the serine hydroxymethyltransferase. To confirm whether the binding occurs, whether the binding ability is deteriorated, and the like, well-known immunochemistry techniques, such as those described above, may be appropriately used.
  • The term “monoclonal” used in this specification is a modifying word, expressing characteristics of, for example, antibodies obtained from a substantially homogeneous population of antibodies. The individual antibodies in the population of antibodies are identical, except for naturally occurring mutations that may possibly be present in minor amounts.
  • The monoclonal IgA antibody of the present invention is one type of immunoglobulin. Examples of embodiments of the antibody include antibodies having a heavy chain variable region and/or a light chain variable region. Of these, more preferable embodiments of the antibody include antibodies comprising a heavy chain further having a constant region and/or a light chain further having a constant region. Even more preferable embodiments of the antibody include antibodies comprising a heavy chain and a light chain.
  • The heavy chain and the light chain are constructed mainly from polypeptide chains, and the heavy chain and the light chain each contain a region called a variable region, which recognizes an antigen. (These regions are usually called a “heavy chain variable region” and a “light chain variable region,” respectively.)
  • The variable region sequentially contains regions called CDRs 1 to 3, which are defined as regions with more particular recognition of antigens, in this order from the amino terminus. More precisely, the CDRs 1 to 3 are also referred to as a heavy chain CDR 1, a heavy chain CDR 2, a heavy chain CDR 3, a light chain CDR 1, a light chain CDR 2, a light chain CDR 3, and the like. Regions other than CDRs 1 to 3 in the heavy chain and the light chain are referred to as heavy chain FRs 1 to 4 and light chain FRs 1 to 4, respectively, in order from the amino terminus.
  • Neither the heavy chain variable region nor the light chain variable region of the monoclonal IgA antibody of the present invention necessarily contains all of the CDRs 1 to 3, and each may contain at least one CDR, and preferably contain CDR 3.
  • The amino acid sequences of polypeptides which construct the heavy chain CDRs 1 to 3 and the light chain CDRs 1 to 3 are not particularly limited. Examples are,
    • for the heavy chain CDR 1, the amino acid sequence represented by any of SEQ ID NOs: 3, 13, 23, 33, or 43;
    • for the heavy chain CDR 2, the amino acid sequence represented by any of SEQ ID NOs: 4, 14, 24, 34, or 44;
    • for the heavy chain CDR 3, the ammo acid sequence represented by any of SEQ ID NOs: 5, 15, 25, 35, or 45;
    • for the light chain CDR 1, the amino acid sequence represented by any of SEQ ID NOs: 8, 18, 28, 38, or 48;
    • for the light chain CDR 2, the amino acid sequence represented by any of SEQ ID NOs: 9, 19, 29, 39, or 49; and
    • for the light chain CDR 3, the amino acid sequence represented by any of SEQ ID NOs: 10, 20, 30, 40, or 50.
  • The heavy chain variable region of the monoclonal IgA antibody of the present invention is not particularly limited. Examples of embodiments of the heavy chain variable region containing CDRs 1 to 3 include a heavy chain variable region which sequentially contains the following CDRs 1 to 3:
    • (1) heavy chain CDR 1 consisting of the amino acid sequence represented by any of SEQ ID NOs: 3, 13, 23, 33, or 43;
    • (2) heavy chain CDR 2 consisting of the amino acid sequence represented by any of SEQ ID NOs: 4, 14, 24, 34, or 44; and
    • (3) heavy chain CDR 3 consisting of the amino acid sequence represented by any of SEQ ID NOs: 5, 15, 25, 35, or 45, in this order from the amino terminus.
  • The light chain variable region containing CDRs 1 to 3 is also not limited. Examples of such an embodiment include a light chain variable region which sequentially contains the following CDRs 1 to 3:
    • (I) light chain CDR 1 consisting of the amino acid sequence represented by any of SEQ ID NOs: 8, 18, 28, 38, or 48;
    • (II) light chain CDR 2 consisting of the amino acid sequence represented by any of SEQ ID NOs: 9, 19, 29, 39, or 49; and
    • (III) light chain CDR 3 consisting of the amino acid sequence represented by any of SEQ ID NOs: 10, 20, 30, 40, or 50, in this order from amino terminus.
  • More preferable examples of embodiments of the heavy chain variable region containing CDRs 1 to 3 include a heavy chain variable region which sequentially contains a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 4, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 5, in this order from the amino terminus;
    • a heavy chain variable region sequentially containing a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 13, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 14, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 15, in this order from the amino terminus;
    • a heavy chain variable region sequentially containing a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 23, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 24, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 25, in this order from the amino terminus;
    • a heavy chain variable region sequentially containing a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 33, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 34, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 35, in this order from the amino terminus; or
    • a heavy chain variable region sequentially containing a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 43, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 44 and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 45, in this order from the amino terminus.
  • An even more preferable heavy chain variable region is a heavy chain variable region which sequentially contains a heavy chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, a heavy chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 4, and a heavy chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 5, in this order from the amino terminus.
  • More preferable examples of the light chain variable region containing CDRs 1 to 3 include a light chain variable region which sequentially contains a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 9, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10, in this order from the amino terminus;
    • a light chain variable region sequentially containing a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 18, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 19, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 20, in this order from the amino terminus;
    • a light chain variable region sequentially containing a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 28, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 29, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 30, in this order from the amino terminus;
    • a light chain variable region sequentially containing a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 38, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 39, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 40, in this order from the amino terminus; or
    • a light chain variable region sequentially containing a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 48, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 49, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 50, in this order from the amino terminus.
  • An even more preferable light chain variable region containing CDRs 1 to 3 is a light chain variable region which sequentially contains a light chain CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, a light chain CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 9, and a light chain CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10, in this order from the amino terminus.
  • Of the heavy chain variable regions mentioned above, a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, 12, 22, 32, or 42 is more preferable, and a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2 is most preferable.
  • Of the light chain variable regions mentioned above, a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7, 17, 27, 37, or 47 is more preferable, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7 is most preferable.
  • The monoclonal IgA antibody of the present invention may also have a construct in which the heavy chain variable region and/or the light chain variable region described above are appropriately combined. The monoclonal IgA antibody of these other embodiments has a structure called, for example, F(ab′)2, Fab, Fv, scFv, scFv-Fc, and minibody.
  • Examples of more preferable embodiments of the monoclonal IgA antibody of the present invention include a monoclonal IgA antibody in which each of the heavy chain variable region and/or a light chain variable region described above further contains a constant region.
  • Such monoclonal IgA is not particularly limited. Examples include a monoclonal IgA antibody comprising a heavy chain which consists of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31 or 41, and/or a light chain which consists of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46.
  • A monoclonal IgA antibody comprising a heavy chain which consists of the amino acid sequence represented by SEQ ID NO: 1, 11, 21, 31, or 41, and a light chain which consists of the amino acid sequence represented by SEQ ID NO: 6, 16, 26, 36, or 46 is more preferable.
  • Even more preferable embodiments include a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6;
    • a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 11 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 16;
    • a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 21 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 26;
    • a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 31 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 36;
    • a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 41 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 46.
      Of these, a monoclonal IgA antibody which comprises a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1 and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6 is even more preferable.
  • The monoclonal IgA antibody of the present invention may be a monomer or a polymer, and preferably a dimer. When the monoclonal antibody is a polymer, the monoclonal antibody contains a J chain described later.
  • A J chain is a peptide consisting of an amino acid sequence with no antigen-recognition site, and is a peptide consisting of an amino acid sequence different from those of the heavy chains and light chains mentioned above. Specific examples of this amino acid sequence include an amino acid sequence derived from mouse, such as an amino acid sequence of accession no. AAA38673; version AAA38673.1 GI: 196379, shown on the National Center of Biotechnology Information (NCBI) website (http://www.ncbi.nlm.nih.gov/); an amino acid sequence derived from human, such as an amino acid sequence of accession no. NP_653247; version NP_653247.1 GI: 21489959, also shown on the NCBI website; and the like. The monoclonal IgA antibody monomers are corrected with a J chain by forming disulfide are bound between each monomer heavy chain and the J chain.
  • The airline acid sequence for the above monoclonal IgA antibody of the present invention may be appropriately mutated to an extent that the functions, effects, etc., of the monoclonal IgA antibody described in this specification are not attenuated. The exact number of introduced mutations is also not particularly limited. Mutations are usually introduced such that the amino acid sequence of the resulting mutant has an identity of 85% or more, preferably 90% or more, more preferably 95% or more, and most preferably 99% or more, with the amino acid sequence before mutation.
  • The term “identity” used in this specification refers to the degree of identical amino acid sequences or nucleotide sequences among two or more comparable amino acid sequences or nucleotide sequences. Accordingly, when the identity between two amino acid sequences or nucleotide sequences is high, the identity or similarity of these sequences is high. The level of identity between amino acid sequences or between nucleotide sequences is determined using, for example, FASTA, which is a sequence analysis tool, based on default parameters.
  • Alternatively, level of identity may be determined using the BLAST algorithm by Karlin and Altschul (e.g., Karlin S, Altschul S F, Proc Natl Acad Sci USA. 87: 2264-2268 (1990); and Karlin S. Altschul S F, Natl Acad Sci USA, 90: 5873-7(1993)). Programs such as BLASTN and BLASTX based on the BLAST algorithm described above have been developed (e.g., Altschul S F, Gish W. Miller W, Myers E W, Lipman D J, J Mol Biol, 215: 403-10 (1990)). Detailed procedures for these analytical methods are known, and the detailed procedures may be referred to the website of NCBI.
  • The term “mutation” used above includes substitution, deletion, insertion, and the like. A known method without particular limitation may be used as a specific method for introducing mutations. For example, conservative substitution may be used for substitution.
  • The term “conservative substitution” used in this specification refers to a replacement of an amino acid residue with another amino acid residue having a similar side chain.
  • For example, a conservative substitution refers to a technique of replacement between amino acid residues with basic side chains, such as lysine, arginine, and histidine. A conservative substitution also includes a replacement between amino acid residues with acid side chains, such as aspartic acid and glutamic acid; a replacement between amino acid residues with uncharged polar side chains, such as glycine, asparagine, glutamine, serine, threonine, tyrosine, and cysteine; a replacement between amino acid residues with non-polar side chains, such as alanine, valine, leucine, isoleucine, praline, phenylalanine, methionine, and tryptophan; a replacement between amino acid residues with β-branched side chains, such as threonine, valine, and isoleucine; and a replacement between amino acid residues with aromatic side chains, such as tyrosine, phenylalanine, tryptophan, and histidine.
  • The subclasses of the monoclonal IgA antibody above are not particularly limited, and may be, for example, IgA1 and IgA2.
  • The monoclonal IgA antibody of the present invention may contain a secretory component. A secretory component is a peptide containing an amino acid sequence with no antigen recognition site, as with the J chain described above, and is usually a sugar chain-modified peptide containing an amino acid sequence that is different from those of the heavy chains and light chains mentioned above.
  • A specific example of the amino acid sequence of the secretory component is derived from a mouse. Specific examples of the amino acid sequence of the secretory component include an amino acid sequence which corresponds to an extracellular domain of the amino acid sequence of polyimmunoglobulin receptor of accession no. 070570; version 070570.1 GI: 6225856, shown on the NCBI website, and the like. In the amino acid sequence shown in the accession no. 070570, the amino acids 19 to 638 of the amino acid sequence correspond to the secretory component.
  • A specific example of the amino acid sequence of the secretory component derived from a human. Examples include an amino acid sequence which corresponds to an extracellular domain of the amino acid sequence of polyimmunoglobulin receptor of accession no. P01833; version P01833.4 GI: 150421625, shown on the NCBI website, and the like. In the amino acid sequence shown in the accession P01833, the amino acids 19 to 645 of the amino acid sequence correspond to the secretory component.
  • To produce the monoclonal IgA antibody containing the secretory component described above, it is possible to encompass a further step of introducing a nucleic acid having the base sequence encoding the secretory component region of the polyimmunoglobulin receptor into the hybridomas obtained in step 1 above. The detailed methods of the introduction are not particularly limited, and a known method may be appropriately modified.
  • The monoclonal IgA antibody above may have an amino acid sequence derived from the same species. Alternatively, the monoclonal IgA antibodies above may have amino acid sequences derived from different species. Examples of the origins of the monoclonal IgA antibody from the same species include human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • Examples of the monoclonal IgA antibodies from different species include, but are not particularly limited to, the monoclonal IgA antibodies from at least two species selected from human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • Specific examples of embodiments of the monoclonal IgA antibodies having amino acid sequences derived from different species include the monoclonal IgA antibodies having an amino acid sequence derived from a human, together with an amino acid sequence derived from a non-human animal species. In this monoclonal IgA antibody, the amino acid sequence of the entire heavy chain and light chain variable regions are derived from a non-human animal species while the amino acid sequences of the other regions are derived from a human. This monoclonal IgA antibody is sometimes called, in particular, a chimeric antibody.
  • The monoclonal IgA antibody of the present invention inhibits the growth of at least two kinds of intestinal bacteria.
  • The term “intestinal bacteria” used in this specification is not particularly limited as long as they are indigenous bacteria in the intestine of a living body. Examples of the intestinal bacteria include bacteria that form gut microbiota in the living body and that are involved in maintaining homeostasis in the intestinal immune system.
  • Examples of intestinal bacteria include, but are not particularly limited to,
    • bacteria belonging to the genus Prevotella,
    • bacteria belonging to the genus Bacteroides,
    • bacteria belonging to the genus Megamonas,
    • bacteria belonging to the genus Bifidobacterium,
    • bacteria belonging to the genus Faecalibacterium,
    • bacteria belonging to the genus Coprococcus,
    • bacteria belonging to the genus Ruminococcus,
    • bacteria belonging to the genus Blautia,
    • bacteria belonging to the genus Eubacterium,
    • bacteria belonging to the genus Roseburia,
    • bacteria belonging to the genus Lactobacillus,
    • bacteria belonging to the genus Clostridium,
    • bacteria belonging to the genus Escherichia,
    • bacteria belonging to the genus Staphylococcus,
    • bacteria belonging to the genus Enterococcus,
    • bacteria belonging to the genus Pseudomonas,
    • bacteria belonging to the genus Enterorhabdus, and the like.
  • In the genus of bacteria listed above, more specific examples include bacteria such as
    • Prevotella melaninogenica,
    • Bacteroidetes vulgatus,
    • Megamonas funiformis,
    • Megamonas hypermegale,
    • Bifidobacterium bifidum,
    • Faecalibacterium prausnitzii,
    • Coprococcus eutactus,
    • Ruminococcus obeum,
    • Blautia productus,
    • Blautia coccoides,
    • Eubacterium rectale,
    • Roseburia intestinalis,
    • Lactobacillus murinus,
    • Lactobacillus casei,
    • Clostridium difficile,
    • Escherichia coli,
    • Staphylococcus aureus,
    • Enterococcus faecalis,
    • Pseudomonas fulva,
    • Enterorhabdus mucosicola, and the like.
  • The monoclonal antibody of the present invention has an effect of making recovery from the reduction of crypts or the atrophy of crypts in the large intestinal lamina propria, as described in the Examples below. A reduction in the crypts in the large intestinal lamina propria is seen in histopathological findings of an intestinal disease caused by, in particular, alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, and is, in general, a chronic pathology often observed in ulcerative colitis.
  • Therefore, the monoclonal IgA antibody of the present invention is expected to have effects of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, and is further expected to have effects of treating, for example, intestinal diseases that are caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, such as inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, and autoimmune diseases.
  • The alternation of intestinal bacterial growth is not particularly limited, and refers to, for example, a state of growth alternation of bacteria that reside in the intestine.
  • The pathological changes in gut microbiota are not particularly limited, and refer to a state of abnormality in maintaining the homeostasis in the symbiotic relationship with the host, the abnormality being caused by, for example, a change in the species of intestinal bacteria that form gut microbiota and a change in the proportion of each of the intestinal bacterium.
  • The alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota are not necessarily limited to a state affected by an intestinal disease, and can also be a state of having a factor for inducing an intestinal disease.
  • The term “treatment” used in this specification means attainment of desired pharmacological and/or physiological effects. The effects include partially or completely curing a disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease. These effects also include an effect of inhibiting or delaying the progression of a disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease; an effect of alleviating pathologies and symptoms (i.e., ameliorating a disease or symptoms, or causing reversal of the progression of a disease or symptoms); and an effect of preventing recurrence of a disease.
  • The above effects also include an effect of partially or completely preventing the onset of a disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease in individuals who can possess a predisposition to the disease and/or adverse effects (e.g., pathologies and symptoms) caused by the disease but who have not yet been diagnosed as having the predisposition. Accordingly, the term “treatment” also means “remission,” “prevention of recurrence,” “prevention of disease,” and the like.
  • As described above, the monoclonal IgA antibody of the present invention is expected to exert excellent effects when used in the treatment of intestinal diseases. These effects are achieved when the monoclonal antibody is administered orally or enterally to an individual. This confirms that the monoclonal IgA antibody of the present invention is useful as an active ingredient of an orally or enterally administered composition or a pharmaceutical composition.
  • Nucleic Acid
  • The nucleic acid of the present invention encodes the monoclonal IgA antibody of the present invention. More specifically, the nucleic acid of the present invention has a base sequence encoding the amino acid sequence represented by any one of SEQ ID NOs: 1 to 50. The nucleic acid above may be a ribonucleotide or a deoxyribonucleotide. The form of the nucleic acid is not particularly limited, and may be a single chain or a double chain.
  • A base sequence encoding one of the amino acid sequences mentioned above is not limited to one kind of nucleic acid base sequence. In accordance with the purpose of the use of the nucleic acid, the base sequence may be determined by appropriately selecting codons coding for the amino acids. As the purpose of the use, for example, the base sequence may be used to express the monoclonal IgA antibody of the present invention in a cell to produce the monoclonal IgA antibody in the cell. In particular, each codon may be selected in consideration of the codon frequency depending to the species of host cell used in the production of the monoclonal IgA antibody.
  • Such a base sequence may be easily determined in silico by using, for example, a known program. It is also possible for the nucleic acid of the present invention to have a base sequence encoding the amino acid sequence represented by any one of SEQ ID NOs: 1 to 50 that has been mutated as described in detail in the “Monoclonal IgA Antibody” section.
  • More specific examples of the base sequence include, but are not particularly limited to, the base sequences of SEQ ID NOs: 51 to 60. Table 2 below shows the correspondence between these base sequences and the amino acid sequences of SEQ ID NOs: 1 to 50 shown in the “Monoclonal IgA Antibody” section above.
  • TABLE 2
    Base Sequence Amino Acid Sequence
    Heavy Chain SEQ ID NO: 51 SEQ ID NO: 1
    SEQ ID NO: 52 SEQ ID NO: 11
    SEQ ID NO: 53 SEQ ID NO: 21
    SEQ ID NO: 54 SEQ ID NO: 31
    SEQ ID NO: 55 SEQ ID NO: 41
    Light Chain SEQ ID NO: 56 SEQ ID NO: 6
    SEQ ID NO: 57 SEQ ID NO: 16
    SEQ ID NO: 58 SEQ ID NO: 26
    SEQ ID NO: 59 SEQ ID NO: 36
    SEQ ID NO: 60 SEQ ID NO: 46
  • Method for Producing Monoclonal IgA Antibody
  • The method for producing a monoclonal IgA antibody of the present invention is a method for producing the monoclonal IgA described above, and characterized in that the method comprises the following steps 1 and 2.
  • Step1
  • Step 1 is a step of mixing and fusing B cells collected from an intestinal lamina propria with other types of cells to prepare hybridomas.
  • Step 2
  • Step 2 is a step of culturing the hybridomas formed in step 1, determining cells that produce an IgA antibody that binds to at least two kinds of intestinal bacteria, and collecting the IgA antibody from the cells.
  • To obtain a structure in which a heavy chain variable region and/or a light chain variable region is appropriately combined as described below, the method for producing the monoclonal IgA antibody of the present invention may optionally further comprise, after step 2, for example, a step of treatment with an IgA-specific protease or the like, a step of functional group introduction, which enables chemical bond, such as a disulfide bond, and sequentially, a step of chemical bond formation via the functional group.
  • The following describes in detail step 1 and step 2 of the method for producing the monoclonal IgA antibody of the present invention.
  • Step 1
  • Step 1 of the method for producing the monoclonal IgA antibody of the present invention comprises mixing and fusing B cells collected from an intestinal lamina propria with other types of cells to prepare hybridomas.
  • The B cells used in step 1 are located in the intestinal lamina propria. The B cells are not necessarily limited to those that contain IgA antibody-encoding DNA or mRNA and produce an IgA antibody by translation of the mRNA, as long as they function to produce an IgA antibody. Examples of the B cells include cells in which an IgG antibody, an IgM antibody, and other immunoglobulin subtypes different from IgA antibody are intracellularly class-switched to an IgA antibody so that an IgA antibody is intracellularly produced.
  • The intestinal lamina propria is not particularly limited as long as it is one of the layers constituting mucosa which present in, for example, the esophagus, stomach, small intestine (including duodenum, jejunum, ileum, etc.), and large intestine (including cecum, colon, rectum, etc.), and as long as the layer is located between the epithelial cell layer and the muscularis mucosae. In particular, an intestinal lamina propria that is present in a small intestine and that contains lymphoid tissues, capillary vessels, lymphatic vessels, and the like, is preferable.
  • The method of collecting B cells from an intestinal lamina propria is not particularly limited. For example, an intestine is collected, and the obtained intestine after washing is cut open to expose the mucosal layer, followed by shaking in a saline containing EDTA at an appropriate concentration to release and remove epithelial cells. Subsequently, B cells are collected through treatment using a digestive enzyme, such as collagenase, at an appropriate concentration. Other than the method mentioned above, any known method may be used to collect B cells. It is also possible to use commercially available B cells derived from an intestinal lamina propria.
  • The origin of the intestinal lamina propria, i.e., the origin of the B cells, is not particularly limited. Examples include mouse, rat, hamster, rabbit, goat, sheep, donkey, pig, cow, horse, chicken, monkey, chimpanzee, human, and the like.
  • The type of cells other than the B cells above (in this specification, sometimes referred to as “other cells”) are different from that of the B cells. The other cells are not limited as long as they fuse with the B cells when contact with the B cells and prepare hybridomas, and as long as the prepared hybridomas maintain the function of the B cells, i.e., the function to produce an IgA antibody.
  • The other cells mentioned above are preferably cells that fuse with the B cells and prepare hybridomas that have an immortalizing function. Specific examples of the other cells are preferably cancer cells which include myeloma cells, which are derived from myeloma. The other cells are preferably myeloma cells.
  • The origin of the other cells is not particularly limited. Examples include mouse, rat, hamster, rabbit, goat, sheep, donkey, donkey, pig, cow, horse, chicken, monkey, chimpanzee, human, and the like.
  • The term “to fuse” means that the B cells and the other cells are inseparably unified. The term “inseparably” as used herein excludes the phenomenon of cell division, which occurs when the fused cells proliferate. In this specification, the hybridoma are included in an example of fused cells.
  • The conditions at the time of mixing and fusing are not particularly limited. The conditions usually used in fusing cells may be appropriately used. For example, the conditions used for culturing the B cells or other cells may be appropriately modified and used. Examples of such methods include a method comprising mixing B cells and cells other than the B cells in an appropriate medium to contact each other in the presence of, for example, polyethylene glycol; a method further comprising, after the mixing above, applying electrical stimulation; and a method comprising, after, for example, a method using viruses, such as Sendai virus, incubating the resulting product at 37° C. in 5% carbon dioxide conditions.
  • The time for fusion is also not particularly limited. The time required for completion of fusion itself may be appropriately set. The completion of fusion may be confirmed by appropriately modifying a known method that is usually used for fusing cells. Examples of such a method include a method of observing the degree of the progress of fusion under a microscope. It is also possible to appropriately select and use a known kit to fuse cells under its usage conditions.
  • Step 2
  • Step 2 of the method for producing the monoclonal IgA antibody of the present invention comprises culturing the hybridomas prepared in step 1 above, determining cells that produce an IgA antibody that binds to at least two kinds of intestinal bacteria, and collecting the antibodies from the cells.
  • Before step 2 of the method of the present invention, the hybridomas obtained in step 1 may be subjected to, for example, a subcloning step, such as a limiting dilution method or the like, in which the subcloning step usually used in the production of a monoclonal antibody.
  • The hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria may be determined, for example, by means of ELISA, EIA, RIA, FLISA, FIA, or the like, or by means of FACS or the like, using an detectable anti-IgA antibody (optionally labeled with, for example, radioisotope, fluorescence, or colorant), as described in the Examples below.
  • Examples of a specific method for determining the “hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacterial” include, but are not particularly limited to, the following two types of methods that use the anti-IgA antibody mentioned above. The two types of methods may also be appropriately used in combination.
  • The first method for determination is a method which comprises
    • (A) a step of determining, from among the hybridomas obtained in step 1 above, individual hybridomas that each produce an IgA antibody that binds to an intestinal bacterium; and
    • (B) a step of confirming whether the IgA antibody produced by the hybridomas determined in step A binds to other intestinal bacteria different from the intestinal bacterium described above, and determining, from among the hybridomas determined in step A, a hybridoma that produces an IgA antibody that bind to both kinds of the intestinal bacteria.
  • In this case, for example, when the ELISA method is used, step A may be performed in the following manner: the culture supernatant of the hybridomas obtained in step 1 is sampled, and the sampled culture supernatant is contacted with a first intestinal bacterium, which is immobilized in, for example, a well of a multi-well plate. Subsequently, the hybridoma is determined to be a hybridoma which produces an IgA antibody by confirming the presence of an IgA antibody that binds to the intestinal bacterium using the ELISA method.
  • Alternatively, step B may be performed in the following manner: the sampled culture supernatant of the hybridomas that are determined in step A to produce an IgA antibody is used as it is, or a culture supernatant of the hybridomas determined as above in step A is sampled again as required, and then the sampled culture supernatant is contacted with another (a second) intestinal bacterium, which is different from the first intestinal bacterium and which is immobilized in, for example, a well of a multi-well plate. Subsequently, the hybridoma is determined to be a hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria by confirming the presence of an IgA antibody that binds to this intestinal bacterium is confirmed in the sampled product.
  • Of course, a step or steps similar to step B may be continuously performed using a third or a subsequent intestinal bacterium different from the first and the second bacteria, as the other intestinal bacteria mentioned above after step B.
  • When a means such as EIA, RIA, FLISA, or FIA is used, as with the ELISA method described above as an example, a first and a second (and optionally a third and a subsequent) intestinal bacteria may be immobilized in each well or on an experimental apparatus similar to a well plate.
  • When the FACS method is selected, the following procedures may be applied: the sampled culture supernatant is mixed with a variety of intestinal bacteria; thereafter, the resulting mixture is further contacted with an anti-IgA antibody. Subsequently, the hybridoma is determined to be the hybridoma which produces an IgA antibody that binds to intestinal bacteria by detecting the formations of complexes of the variety of intestinal bacteria, IgA antibodies that bind to the variety of intestinal bacteria, and anti-IgA antibodies, using FACS analysis in an appropriate manner.
  • Examples of the second method for determination include a method which determines a hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria, from among the hybridomas obtained in step 1 above, using systems which detect the binding of the IgA antibody to each intestinal bacterium.
  • Regarding the above, when, for example, a means using the ELISA method is used, the following may be given as an example method: in step A in the first method above, two (optionally three or more) different kinds of intestinal bacteria are immobilized in, for example, different two (or three or more depending on the number of the kinds of intestinal bacteria) wells of a multi-well plate, the sampled culture supernatant of the hybridomas obtained in step 1 is contacted with two (or three or more) different intestinal bacteria in each well. Subsequently, the hybridoma is determined as a hybridoma which produces IgA that binds to at least two kinds of intestinal bacteria by confirming the presence of IgA that binds to both of the two kinds (or all of the three or more kinds) of intestinal bacteria using the ELISA method.
  • When a means such as EIA, RIA, FLISA, or FIA is used, as in the case when ELISA is used, the first and the second (optionally the third and subsequent) intestinal bacteria may be immobilized in each of wells or on an experimental apparatus similar to a well plate.
  • When the FACS method is selected, each sampled product is mixed with each kinds of intestinal bacteria, and the resulting mixture is further contacted to an anti-IgA antibody. Subsequently, the hybridoma is determined to be the hybridoma which produces an IgA antibody that binds to intestinal bacteria by detecting the formations of complexes of the variety of intestinal bacteria, IgA antibodies that bind to the variety of intestinal bacteria, and anti-IgA antibodies in an appropriate manner.
  • After a hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria is determined in accordance with the method described above, a step which comprises cloning the hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria, by using, for example, a limiting dilution used in the method for producing the monoclonal antibody described above may be preformed.
  • When the cloning is performed, the above step of determining the hybridoma may be repeatedly performed using two particular kinds of intestinal bacteria that are the same as those used to determine the hybridoma that produces an IgA antibody that binds to at least two kinds of intestinal bacteria.
  • The collection method in step 2 is not particularly limited in detail. Examples of the collection method include a method of collecting a supernatant of the culture medium of cells that produce an IgA antibody, and a method of collecting a lysate of the cells. The lysate of the cells may be obtained by cell-lysis suitably using a combination of a known mechanical means, such as sonication and French press, and/or a known chemical treatment method using a detergent, a cell wall-digesting enzyme, and a cellular membrane-digesting enzyme. Thereafter, the liquid phase fractions obtained after a solid-liquid-separation step are collected, and the monoclonal IgA antibody of the present invention may be produced.
  • Before collecting IgA from the hybridoma, the hybridoma may be cultured in an appropriate medium for a specific period of time, and then, the method of collecting its supernatant or the method of collecting IgA from a lysate of the cells may be performed as described above. Alternatively, the collection may be performed by intraperitoneal administration of the hybridoma to an individual animal that is capable of being transplanted with the origin of this hybridoma, such as an immunodeficient mouse, and collecting IgA from the ascites of the individual.
  • The monoclonal IgA antibody collected in the above manner may be appropriately subjected to a known purification step. The purification means is not particularly limited in detail. Known protein purification means, such as purification by precipitation using, for example, acetone and ammonium sulfate, and purification by, for example, affinity, anion-exchange, cation-exchange, size exclusion, or reversed-phase column chromatography, may be appropriately combined and used.
  • Examples of embodiments of the method for producing the monoclonal IgA antibody of the present invention also include a method which comprises introducing the nucleic acid described in detail in the “Nucleic Acid” section above into a cell which is capable of producing a monoclonal IgA antibody, culturing the cell, and collecting a monoclonal IgA antibody from the cell extract or culture supernatant, optionally followed by purification.
  • The cell which is capable of producing a monoclonal IgA antibody is not particularly limited as long as it is a cell that is capable of producing various proteins that usually function when folded into a higher-order structure from a mammal. The cell may be appropriately selected from known cells, including mammal-derived cells, such as COS cells, HEK cells, HELA cells, and CHO cells, and insect-derived cells, such as Sf9.
  • The detailed method for introducing a nucleic acid, the conditions for culturing cells into which the nucleic acid is introduced, the collection method, and the purification method are not particularly limited, and vary depending on, for example, the type of the cells used. Known methods may be appropriately modified and combined to produce the monoclonal IgA antibody of the present invention.
  • Regarding the nucleic acid described above, when the monoclonal IgA antibody of the present invention is a chimeric antibody, a nucleic acid having a base sequence encoding a heavy chain variable region and a nucleic acid having a base sequence encoding a heavy chain constant region of different species, as well as a nucleic acid having a base sequence encoding a light chain variable region and a nucleic acid having a base sequence encoding a light chain constant region of different species are produced. Next, the produced nucleic acid having a base sequence encoding a heavy chain variable region is bound to the nucleic acid having a base sequence encoding a heavy chain constant region, and the nucleic acid having a base sequence encoding a light chain variable region is bound to the nucleic acid having a base sequence encoding a light chain constant region. Then, the resulting nucleic acids may be introduced into a cell that is capable of producing the monoclonal IgA antibody as described above.
  • The monoclonal IgA antibody of the present invention may also be an antibody in which the heavy chain and/or light chain CDRs 1 to 3 have mouse-derived amino acid sequences while regions other than the CDRs have human-derived amino acid sequences (this antibody sometimes being referred to as a “humanized antibody”). This humanized antibody may be produced as is the case for a chimeric antibody as described above. The nucleic acids having base sequences encoding heavy chain and/or light chain CDRs 1 to 3, and nucleic acids having base sequences encoding the regions other than the CDRs are produced. Next, the nucleic acids having base sequences encoding heavy chain and CDRs 1 to 3 are again bound to regions other than the CDRs and the nucleic acids having base sequences encoding light chain and CDRs 1 to 3 are again bound to regions other than the CDRs to obtain nucleic acids encoding a heavy chain and a light chain. Then, the resulting nucleic acids are introduced into a cell that is capable of producing the monoclonal IgA antibody as described above. To maintain the binding ability of an antibody, replacement of some bases with other bases may be required.
  • When the monoclonal IgA antibody of the present invention contains a J chain, the monoclonal IgA antibody of the present invention may be produced by introducing a nucleic acid having a base sequence encoding the monoclonal IgA antibody and a nucleic acid having a base sequence encoding J chain into a cell that is capable of producing a monoclonal IgA antibody, as described above.
  • The base sequence encoding the J chain may be appropriately determined by using a known method, based on the J chain amino acid sequence shown on the NCBI website, as described in the “Monoclonal IgA Antibody” section above. The nucleic acid may be produced using a known method, based on the determined base sequence.
  • When the monoclonal IgA antibody of the present invention contains a secretory component, the monoclonal IgA antibody of the present invention may be produced by introducing a nucleic acid having a base sequence encoding the monoclonal IgA antibody and a nucleic acid having a base sequence encoding the J chain, as well as a nucleic acid having a base sequence encoding a secretory component, into a cell which is capable of producing a monoclonal IgA antibody, as described above. Such a method is disclosed in, for example, Li C et al., Sheng Wu Gong Cheng Xue Bao. 2011 February; 27(2): 219-25. The monoclonal IgA antibody containing a secretory component of the present invention may be produced based on this disclosure or by appropriately modifying the disclosure.
  • The nucleic acid base sequence encoding a secretory component may be appropriately determined by using a known method based on the amino acid sequence of, for example, a polyimmunoglobulin receptor shown on the NCBI website, as described in the “Monoclonal IgA Antibody” section above. The nucleic acid may be produced using a known method, based on the determined base sequence.
  • Hybridoma
  • The hybridoma of the present invention produces the monoclonal IgA antibody of the present invention.
  • Hybridomas are specifically those obtained in step 1 described in the “Method for Producing Monoclonal IgA Antibody” section above, i.e., cells obtained by mixing and fusing the B cells with other types of cells, which are cells other than the B cells, as described in step 1 of the method for producing the monoclonal IgA antibody of the present invention.
  • The hybridoma may be derived from the same species or different species. In the “Method for Producing Monoclonal IgA Antibody” section above, hybridomas derived from the same species may be obtained by arranging the origin of the B cells to be the same as the origin of cells other than the B cells, and hybridomas derived from different species may be obtained by arranging the origin of the B cells to be different from the origin of cells other than the B cells.
  • To obtain a hybridoma derived from the same species, the origin of the B cells and the origin of cells other than the B cells are appropriately selected, for example, from among the origins mentioned in relation to step described in the “Method for Producing Monoclonal IgA Antibody” section above so that their origins overlap with each other. Examples of the origins of the hybridoma derived from the same species include human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • To obtain a hybridoma derived from different species, the origin of the B cells and the origin of cells other than the B cells may be appropriately selected, for example, from among the origins mentioned in relation to step 1 described in the “Method for Producing Monoclonal IgA Antibody” section above, and combined. Examples of the origins of the hybridoma derived from different species include human, mouse, rat, hamster, rabbit, goat, donkey, pig, cow, horse, chicken, monkey, chimpanzee, and the like.
  • Pharmaceutical Composition
  • The pharmaceutical composition of the present invention contains the monoclonal IgA antibody of the present invention.
  • The pharmaceutical composition of the present invention is not particularly limited, and is suitably used for the treatment of, for example, an intestinal disease. The pharmaceutical composition of the present invention is more preferably used for treating an intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota. The alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota are as described in the “Monoclonal IgA Antibody” section above.
  • The intestinal disease caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota is not particularly limited. Examples include inflammatory bowel disease, ulcerative colitis, Crohn's disease, allergies, asthma, obesity, autoimmune diseases, and the like. Inflammatory bowel disease is preferable among them.
  • The pharmaceutical composition of the present invention is sufficient if it contains an effective amount of the monoclonal IgA antibody of the present invention. For example, the amount of the antibody of the present invention contained in 100 wt % of the pharmaceutical composition may be appropriately set to be within a range of 0.001 to 99.99 wt %, in consideration of, for example, the type of the target intestinal disease, the dosage form, the administration method, the target for administration, the degree of symptoms of the target for administration, and the degree of the effect achieved by the administration.
  • The term “effective amount” used in this specification refers to an amount that allows the monoclonal IgA antibody of the present invention to exert the effect of treating an intestinal disease, or an amount that allows the desired pharmacological and/or physiological effects (intestinal disease treatment effect) described above to be achieved.
  • Pharmaceutically acceptable carriers or additives may be incorporated in the pharmaceutical composition of the present invention, together with the monoclonal IgA antibody of the present invention. The phrase “pharmaceutically acceptable carriers or additives” used herein refers to optional carriers, diluents, excipients, suspending agents, lubricants, adjuvants, vehicles, delivery systems, emulsifiers, disintegrants, absorbents, preservatives, detergents, colorants, fragrances, or sweeteners. Known carriers or additives may be used.
  • The pharmaceutical composition of the present invention is applicable to methods of treating an intestinal disease, comprising administering the composition to an individual suffering from the intestinal disease mentioned above. The pharmaceutical composition of the present invention is also applicable to methods of preventing an intestinal disease, in which the methods comprise administering the composition to an individual who has not yet developed pathologies or symptoms of the intestinal disease described above but can possess a predisposition to the intestinal disease. These individuals may be used as the target for administration of the pharmaceutical composition of the present invention.
  • The individuals used as the target for administration are not particularly limited. Examples include human, mouse, rat, guinea pig, rabbit, hamster, dog, cat, weasel, and the like.
  • The dosage and administration method of the pharmaceutical composition may be suitably determined according to the type of intestinal disease from which an individual as the target for administration suffers, the sex, the race, the age, the general conditions, the severity of the disease, and the degree of desired effects, and the like. The dosage may be suitably set within a range of 0.001 to 100 mg/kg/day.
  • The administration method is not particularly limited. Direct administration to the gastrointestinal tract is preferable. Examples of the administration method include oral administration, nasal administration, mucosal administration, enteral administration, and the like.
  • The enteral administration is not limited to administration through the anus. For example, the enteral administration includes administration through a tube or the like inserted into the gastrointestinal tract from outside the individual, as in gastrostoma. The site in the digestive tract into which a tube is inserted is not limited, and may be, for example, the esophagus, stomach, small intestine (including the duodenum, jejunum, ileum, etc.), large intestine (including the cecum, colon, rectum, etc.) and the like.
  • The pharmaceutical composition of the present invention in the above dosage may be administered in a single dose or in a plurality of doses per day. The administration interval may be every day, every other day, every week, every other week, every 2 to 3 weeks, every month, or every 2 to 3 months, as long as the effect of the treatment for the above disease is achieved.
  • Orally or Enterally Administered Composition
  • The orally or enterally administered composition of the present invention contains the monoclonal IgA antibody of the present invention. The use of the orally or enterally administered composition achieves the effect of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota. The alternation of intestinal bacterial growth and pathological changes of intestinal bacterial growth in gut microbiota are as described in the “Monoclonal IgA Antibody” section above.
  • The mixing ratio of the monoclonal IgA antibody contained in the orally or enterally administered composition is not particularly limited, and may be appropriately adjusted according to the form, usage, and the like of the orally or enterally administered composition. The mixing ratio may be usually about 0.001 to 99 wt % based on the total amount of the orally or enterally administered composition.
  • The individuals as a target in which the orally or enterally administered composition of the present invention is used are not particularly limited. Examples include human, mouse, rat, guinea pig, rabbit, hamster, dog, cat, weasel, and the like.
  • As described above, the monoclonal IgA antibody contained in the orally or enterally administered composition of the present invention has an effect of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, and is thus particularly useful as a composition that controls intestinal function, a composition that improves the intestinal environment, a composition that optimizes the intestinal environment, or a composition that prevents intestinal putrefaction.
  • The dosage of the orally or enterally administered composition of the present invention is not particularly limited as long as it is within a range that allows the effects of the orally or enterally administered composition to be exerted, and may be set according to the species of individual who takes the orally or enterally administered composition, the target effect, the target degree of achieving the effect, other various conditions, and the like. Specifically, the dosage may be converted into the amount of the monoclonal IgA antibody of the present invention, which is usually about 0.001 to 100 mg/kg/day. The amount may be taken in a single portion or several portions per day.
  • The enteral administration is not limited to administration through the anus, as described in the “Pharmaceutical Composition” section above. For example, the enteral composition of the present invention may be blended with a known component so as to be used as intestinal lavage fluid.
  • The orally or enterally administered composition of the present invention contains the monoclonal IgA antibody of the present invention, which achieves the effect of suppressing alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota. With the expectation of achieving such effects, the orally or enterally administered composition of the present invention may be suitably used in the fields of food or feed. Therefore, the orally or enterally administered composition of the present invention may be used as a food composition or a feed composition.
  • As a food composition, the orally or enterally administered composition of the present invention is most suitably used in the field of food. Such a food composition may be provided as a food composition indicated as controlling intestinal function, improving the intestinal environment, optimizing the intestinal environment, preventing intestinal putrefaction, or the like.
  • In addition to common food products, examples of the food composition include food for specified health use, including conditional food for specified health use, nutrition supplement food, functional food, medical food, and the like.
  • The specific form of the food composition is not particularly limited. Examples include drinks, such as soft drinks, carbonated drinks, energy drinks, fruit drinks, lactic-acid drinks, and milk drinks; frozen desserts, such as ice cream, ice sherbet, and shaved ice; confectioneries, such as candies, gum, chocolate, tablet candies, snack confectioneries, biscuits, jelly, jam, cream, baked confectioneries; noodles, such as buckwheat noodles, wheat-flour noodles, bean vermicelli, Chinese-style noddies, and instant noodles; fish or livestock processed food, such as kamaboko (fish sausage), ham, and sausage; dairy products, such as processed milk products and fermented milk products; oil- and fat-processed food products such as salad oil, tempura oil, margarine, mayonnaise, shortening, whipped cream, and dressing; seasonings, such as dipping sauce and other sauces; and soups, stews, salads, daily dishes, rice seasonings, pickles, bread, cereal, and the like. The form of food for specified health use, nutrition supplement food, functional food, or the like, may be a powder, granules, a capsule, a lozenge, a tablet, a syrup, or the like.
  • As the feed composition, the orally or enterally administered composition of the present invention is most suitably used in the field of feed. Such a feed composition may be provided as a feed composition indicated as controlling intestinal function, improving the intestinal environment, optimizing the intestinal environment, preventing intestinal putrefaction, or the like.
  • The specific form of the feed composition is not particularly limited, and may be, for example, mixed with usual feed, optionally with a component that can be blended with usual feed, to obtain a feed composition, as long as the effect of the feed composition of the present invention described above is achieved. It is also possible to use the feed composition unmodified as feed.
  • Method for Treating a Disease
  • The method for treating a disease according to the present invention is a method for treating an intestinal disease, in which the method comprises administering an effective amount of the monoclonal IgA antibody of the present invention, the pharmaceutical composition of the present invention, or the orally administered composition of the present invention to a human suffering from an intestinal disease.
  • The human suffering from an intestinal disease may be a target for administration mentioned in the “Pharmaceutical Composition” section above. The specific administration method and dosage amount may also be as described in the “Pharmaceutical Composition” section above.
  • EXAMPLES
  • The present invention is described below in more detail but is, of course, not limited to the following Examples.
  • Example 1 Preparation of Antibodies 1-1: Separation of Intestinal Lamina Propria Cells
  • 8-week-old wild-type C57BL/6 mice (CLEA Japan, Inc.) were fed until the age of 20 weeks with free access to food and water in an experiment facility of the Nagahama Institute of Bio-Science and Technology. Subsequently, the mice were euthanized with carbon dioxide and then subjected to laparotomy to remove the entire length of the small intestine. After the connective tissue and Peyer's patches were removed from the removed small-intestine sample, a longitudinal incision was made through the small intestine, and the intestinal contents were washed out in a 10-cm dish filled with PBS. The small intestine was washed well with three to four changes of PBS.
  • As with the wild-type C57BL/6 mice, the small intestine was also collected from mice expressing AID G23S (AID G23S mice), in which a mutation is introduced at the N-terminal side of AID protein. Such AID G23S mice can be created using a known method, for example, disclosed in Non-patent Literature 18.
  • Next, 50 ml of PBS containing 1 mM EDTA was placed into a 50-ml tube. The washed small intestine was cut into lengths of 0.5 to 1 cm and added into the tube. After shaking at 37° C. for 20 minutes, the small-intestine fragments were collected in a strainer, and PBS was then discarded. Further, the small-intestine fragments were placed into a tube as described above. After vigorous shaking for 10 seconds, the small-intestine fragments were collected in a strainer again, and PBS was then discarded in the same manner. This vigorous shaking of the small intestine with 50 ml of PBS for 10 seconds was repeated twice.
  • Thereafter, 50 ml of a digestive-enzyme solution (prepared using 500 ml of RPMI 1640, 25 ml of FCS (final concentration of 5%), 2 μl of 2-mercaptoethanol (final concentration of 55 μM), 0.75 g of collagenase, and 5 ml of dispase (final concentration of 1 U/ml)) warmed at 37° C. was placed into a 50-ml tube. The small-intestine fragments were further cut into pieces with scissors and added into the tube. After shaking at 37° C. for 60 minutes, the tube was allowed to stand for 10 seconds to allow the small-intestine tissue to sink. The supernatant was then transferred to a new 50-ml tube. This digestion process using the digestive-enzyme liquid was performed twice.
  • The supernatant separated in the digestion process was centrifuged at 1,500 rpm at 4° C. for 5 minutes, and the supernatant was discarded. The resulting precipitate was further suspended in 1 ml of RPMI 1640 containing 2% FCS. The suspension was passed through a filter to remove tissue fractions, and the resulting suspension of cells was stored on ice.
  • After the second enzyme reaction described above was performed for 60 minutes, the suspension of cells was collected in the same manner. The two suspensions of cells, i.e., the suspension of cells obtained after the first enzyme reaction and the suspension of cells obtained after the second enzyme reaction were combined, and the resulting suspension was used as intestinal lamina propria cells.
  • Preparation of IgA-Producing Hybridomas
  • The intestinal lamina propria cells obtained in the Separation of Intestinal Lamina Propria Cells section above were fused with mouse myeloma NS1 cells to prepare hybridomas. Culture and maintenance of the NS1 cells were conducted before the cell fusion. The cell fusion was performed using the reagents of a ClonaCell (registered trademark)-HY Hybridoma Cloning Kit Provided from STEMCELL Technologies according to the protocol of the kit.
  • The obtained hybridomas were then grown in a medium containing methylcellulose to perform cloning according to the protocol of the kit. Thereafter, the supernatants derived from each subclone were isolated from the growing hybridomas. For the antibodies contained in the supernatants, ELISA was performed to detect whether the produced antibodies were IgA, to measure the IgA antibody titer in the supernatants. Then, IgA-producing hybridoma clones were isorated. As a result, it was confirmed that a total of 37 clones were established.
  • RNA was extracted from each clone by IsogenII (Nippon Gene Co., Ltd.), and cDNA was synthesized using the RNA as a template. Then, RT-PCR was performed using seven primers for antibody Vh region (MH1 to MH7) and a Cα region-specific primer (IgAR). Table 3 shows the detailed base sequences of these primers.
  • TABLE 3
    Primer Name Base Sequence
    MH1 (SEQ ID NO: 61) SARGTNMAGCTGSAGTC
    MH2 (SEQ ID NO: 62) SARGTNMAGCTGSAGSAGTCWGG
    MH3 (SEQ ID NO: 63) CAGGTTACTCTGAAAGWTSTG
    MH4 (SEQ ID NO: 64) GAGGTCCARCTGCAACARTC
    MH5 (SEQ ID NO: 65) CAGGTCCAACTVCAGCARCC
    MH6 (SEQ ID NO: 66) GAGGTGAASSTGGTGGAATC
    MH7 (SEQ ID NO: 67) GATGTGAACTTGGAAGTGTC
    IgAR (SEQ ID NO: 68) GATGGTGGGATTTCTCGCAGAC

    In the base sequences shown in Table 3, S indicates G or C; R indicates A or G; N indicates A, C, G, or T; M indicates A or C; W indicates A or T; and V indicates G, C, or A.
  • The amplified PCR products of the VDJ region were directly sequenced to analyze the number of variations and VDJ usage. The analysis revealed that 17 kinds of IgA-producing hybridomas were obtained as independent clones. These are respectively referred to as W1, W2, W3, W4, W6, W7, W11, W14, W24, W27, W28, W30, W32, W34, W37, W43, and W47.
  • Ten independent clones of IgA-producing hybridomas were obtained from G23S mice by performing an experiment in the same manner. These are respectively referred to as G1, G8, G9, G10, G12, G14, G15, G16, G18, and G19.
  • 1-2: Preparation of IgA Antibodies
  • The 27 clones of IgA antibody producing hybridomas obtained in the Preparation of IgA-producing Hybridomas section above were individually cultured on a large scale in RPMI 1640 containing 10% FCS, and the culture supernatants were collected by centrifugation. Subsequently, the obtained culture supernatants were passed through a 0.22-μm filter and then subjected to ammonium sulfate precipitation and dialysis against PBS, thereby partially purifying 27 kinds of monoclonal IgA antibodies (also referred to in the Example that follows as “monoclonal IgA antibodies,” preceded by the clone name).
  • In another method, each of the 27 clones of hybridomas obtained in the Formation of IgA-producing Hybridomas section was individually injected intraperitoneally into immunodeficient mice and bred for 10 to 21 days, and then ascites was collected from the mice. After the collected ascites was subjected to ammonium sulfate precipitation, the buffer was replaced with PBS using a PD-10 column. 27 kinds of monoclonal IgA antibodies were also thereby partially purified.
  • The concentration of each of the 27 kinds of monoclonal IgA antibodies prepared by the methods described above were measured with ELISA. In the measurement, goat anti-mouse IgA (Southern Biotech) was used as an antibody for coating onto a solid phase in an amount of 2 μg/ml, and ALP-labeled goat anti-mouse IgA (Southern Biotech) was used as an antibody for detection in an amount of 0.5 μg/ml. Mouse IgA κ (Immunology Consultants Laboratory) was used as a standard sample.
  • 1-3: Preparation of Indigenous Intestinal Bacteria
  • After feces of wild-type mice kept in the SPF room of the experiment facility of the Nagahama Institute of Bio-Science and Technology were suspended in PBS, the diluted suspension was spread on a blood agar plate and cultured at 37° C. for 48 to 72 hours. Thereafter, PCR of 16S rRNA gene was directly performed from the obtained colonies. The resulting PCR products were sequenced to identify the bacteria of each colony. Six species of mouse intestinal bacteria were cloned in this manner.
  • The cloned indigenous intestinal bacteria of the mice are specifically the following six species of bacteria:
    • Enterorhabdus mucosicola;
    • Escherichia coli;
    • Staphylococcus aureus;
    • Lactobacillus murinus;
    • Enterococcus faecalis;
    • Pseudomonas fulva.
    1-4: Investigation of Binding Ability and Specificity for Intestinal Bacteria
  • A total of 13 species of intestinal bacteria, i.e., the six cloned species of indigenous intestinal bacteria described above and the following commercially available bacteria were cultured in optimal conditions, and the bacterial cells were collected by centrifugation: Escherichia coli (DH5α strain: obtained from TOYOBO Co., Ltd.), Lactobacillus casei (obtained from ATCC), Coprococcus eutactus (obtained from ATCC), Blautia coccoides (obtained from ATCC), Megamonas hypermegale (obtained from ATCC), Eubacterium rectale (obtained from ATCC), and Bifidobacterium bifidum (obtained from ATCC).
  • Specifically, each species of bacteria was suspended in 0.05 M Na2CO3 buffer and individually an ELISA plate was coated with each bacterial solution. After blocking by a known method, the 27 kinds of monoclonal IgA antibodies described above (concentration of 1.4 μg/ml) were individually added to measure the binding ability and specificity of these monoclonal IgA antibodies against the 13 species of intestinal bacteria. Then, the binding between the bacteria and the antibodies was detected according to the known ELISA method. The antibody used for detection was the same as above.
  • FIG. 1 shows the results. The results revealed that, among the 27 kinds of monoclonal IgA, 22 kinds of monoclonal IgA (the W1, W3, W4, W6, W7, W11, W14, W24, W27, W30, W32, W34, W43, and W45 monoclonal IgA antibodies derived from wild-type mice; the G1, G9, G10, G12, G14, G15, G18, and G19 monoclonal IgA antibodies derived from G23S mice) bound to two or more species of the intestinal bacteria.
  • Subsequently, an experiment to compare the binding strength of such monoclonal IgA antibodies against intestinal bacteria was performed by changing the concentrations of the antibodies used. Specifically, the experiment was performed using a measurement method with the ELISA described above. The monoclonal IgA antibodies used were the W27, G15, and G19 monoclonal IgA antibodies. The W2 monoclonal IgA antibody was used as a negative control.
  • The indigenous intestinal bacteria used were Staphylococcus aureus, Escherichia coli and Enterococcus faecalis.
  • FIG. 2 shows the results. Among several monoclonal IgA antibodies, the W27 monoclonal IgA antibody most efficiently bound to each species of the intestinal bacteria in a concentration-dependent manner.
  • The same experiment as used for the W27 monoclonal IgA antibody was performed for W27SC3F monoclonal IgA antibody, in which a secretory component bound to the W27 monoclonal IgA antibody, the W11 monoclonal IgA antibody, the W34 monoclonal IgA antibody, the W43 monoclonal IgA antibody, and the G15 monoclonal IgA antibody. The W2 monoclonal IgA antibody was used as a negative control.
  • The W27SC3F monoclonal IgA antibody was produced as follows. First, RNA was extracted from a fragment of about 1 cm of the small intestine of a wild-type mouse. A reverse transcription reaction was performed using the RNA with SuperScript III Produced by Invitrogen to obtain cDNA. The extracellular domain of the polyimmunoglobulin receptor was amplified by PCR using the cDNA as a template and using two primers (EcoRI SCF: 5′-gaattcaccatgaggetctacttg-3′; SEQ ID NO: 69 and Flag SC3R: 5′-ctegagtcacttgtcgtcategtetttgtagteccegggatt-3′; SEQ ID NO: 70). In the amplification, the base sequence of FLAG-tag was added to the reverse primer to make it possible to detect its protein expression in cells with anti-FLAG antibody. The base sequence of the amplified DNA encoded the amino acid sequence set forth in SEQ ID NO: 71. The sequence of FLAG-tag was added to the C-terminal (mSC3F-FLAG).
  • The obtained PCR product was subjected to restriction enzyme treatment and cloned into pcDNA3.1 (+) vector (Invitrogen). The completed expression vector is hereafter referred to as “pcDNA3.1 (+)/mSC3F.” The plasmid DNA of pcDNA3.1 (+)/mSC3F was prepared from Escherichia coli and transfected into a hybridoma that produces the W27 monoclonal antibody with Nucleofector (AMAXA). Selection with G418 was then performed. The W27SC3F monoclonal IgA antibody was obtained from the thus-selected hybridoma, according to the method described above for collecting monoclonal IgA antibodies from hybridomas.
  • The indigenous intestinal bacteria used were Enterococcus faecalis, Staphylococcus aureus, Escherichia coli, and Pseudomonas fulva.
  • FIG. 3 shows the results. This experiment also revealed that the W27 monoclonal IgA antibody most efficiently bound to each species of the intestinal bacteria in a concentration-dependent manner.
  • 1-5: Western Blot Analysis for Bacteria using Monoclonal IgA Antibodies
  • Escherichia coli (DH5α, commercially available product), Escherichia coli (a cloned strain from mouse intestinal content), Pseudomonas fulva, Staphylococcus aureus, and Eubacterium rectale were used as intestinal bacteria, and each was subjected to shaking culture in 10 ml of LB or an optimum culture medium under conditions appropriate for each species of the bacteria. After the bacterial cells were collected by centrifugation, they were suspended in PBS containing 1% NP-40, sonicated on ice, and allowed to stand on ice for 30 minutes. The supernatants were then obtained by centrifugation. SDS-buffer (containing 2-ME) was added to the supernatants, and protein denaturation was performed with heat treatment at 95° C. for 10 minutes. 8% SDS-PAGE was performed, followed by protein transfer to filters. After blocking, a Western blotting method in which reactions were performed using the W27, W30, and W45 monoclonal IgA antibodies (2 μg/ml), followed by using goat anti-mouse IgA (1 μg/ml) (Southern Biotechnology) and IR800 anti-goat IgG (0.2 μg/ml) (Rockland), and if necessary labeled anti-Goat IgG, was performed to detect the signals with Odyssey (LI-COR).
  • FIG. 4 shows the results. The results revealed that the W27, W30, and W45 monoclonal IgA antibodies bound to the extracts of all the bacteria described above. Thus, the experimental results suggested that the W27, W30, and W45 monoclonal IgA antibodies recognized one of the constituent proteins of intestinal bacteria as an antigen. Further, it was revealed that the molecular weight of this constituent protein was about 45 to 50 kDa.
  • Furthermore, an experiment was performed using Eubacterium rectale, Blautia coccoides, Coprococcus eutactus, Megamonas hypermegale, Lactobacillus casei, and Bifidobacterium bifidum in the same manner as described above. The monoclonal IgA antibody used was W27. FIG. 4 shows the results. The results revealed that the W27 monoclonal IgA antibody did not bind to the proteins in extracts of the bacteria, except for Eubacterium rectale.
  • 1-6: Analysis of the Amino Acid Sequences of Monoclonal IgA Antibodies
  • A known method was used to analyze the amino acid sequences of, among the monoclonal IgA antibodies obtained by the method described above, five monoclonal IgA antibodies confirmed as binding to two or more species of intestinal bacteria, i.e., the W27, W30, W34, W43, and W11 monoclonal IgA antibodies.
  • The amino acid sequences were analyzed by using a known method. Specifically, 5′ and 3′ RACE reactions were performed to obtain the full-length base sequences. The RACE method was performed according to the procedure of an In-Fusion (registered trademark) SMARTer™ Directional cDNA library Construction Kit (Clontech). For the heavy chain, sequence analysis was performed using a combination of the primers included in the kit and the primers mentioned above. For the light chain, sequence analysis was performed using the following primers in combination.
  • CkR:
    (SEQ ID NO: 72)
    5′-AACGTGAGGGTGCTGCTCATG-3′
    deg Vk:
    (SEQ ID NO: 73)
    5′-GGCTGCAGSTTCAGTGGCAGTGGRTCWGGRAC-3′
  • Tables 4 to 8 show the results. The underlined portions in “Full-length Sequence” in these tables indicate variable region, and the portions in bold in “Full-length Sequence” and “Variable Region” indicate CDR1, CDR2, and CDR3 in order from the front to the back (from the N-terminus).
  • The nucleic acid sequences encoding these amino acids were as follows:
    • W27 monoclonal IgA antibody; heavy chain: SEQ ID NO: 51, light chain: SEQ ID NO: 52;
    • W30 monoclonal IgA antibody; heavy chain: SEQ ID NO: 53, light chain: SEQ ID NO: 54;
    • W34 monoclonal IgA antibody; heavy chain: SEQ ID NO: 55, light chain: SEQ ID NO: 56;
    • W43 monoclonal IgA antibody; heavy chain: SEQ ID NO: 57, light chain: SEQ ID NO: 58;
    • W11 monoclonal IgA antibody; heavy chain: SEQ ID NO: 59, light chain: SEQ ID NO: 60
  • TABLE 4
    <Table 4: Amino acid Sequence of W27>
    Heavy Chain Full-length Sequence MAVVTGVNSEVQLQQSGSELVKSGASVKLSCTVSGFNFT
    (SEQ ID NO: 1) DYYIHWVRQRTEQGLEWIGRIDPENDETTYAPKFQGKAT
    MTADTSSNTAYLQLTSLTSEDTAVYYCARSTVLDYWGHG
    TTLTVSSESARNPTIYPLTLPRALSSDPVIIGCLIHDYF
    PSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTL
    PAVECPEGESVKCSVQHDSNAVQHLDVKCSGPPPPCPPC
    PPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGA
    VFTWEPSTQKDAVQKKAVQNSCGCNSVSSVLPGCAERWN
    SGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPP
    SEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPES
    YLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCM
    VGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY
    Variable region MAVVTGVNSEVQLQQSGSELVKSGASVKLSCTVSGFNFT
    (SEQ ID NO: 2) DYYIHWVRQRTEQGLEWIGRIDPENDETTYAPKFQGKAT
    MTADTSSNTAYLQLTSLTSEDTAVYYCARSTVLDYWGHG
    TTLTVSS
    CDR1 (SEQ ID NO: 3) DYYTH
    CDR2 (SEQ ID NO: 4 RIDPENDETTYAPKFQG
    CDR3 (SEQ ID NO: 5) STVL
    Light Chain Pull-length Sequence MFWIPGFSSDVLMTQTPLSLPVSLGDQASISCRASQSIV
    (SEQ ID NO: 6) HTNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSG
    SGSGTDFILKISRVEAEDLGVYYCFQGSHVPPTFGGGTK
    LEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPK
    DINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
    TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
    Variable region MFWIPGFSSDVLMTQTPLSLPVSLGDQASISCRASQSIV
    (SEQ ID NO: 7) HTNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSG
    SGSGTDFILKISRVEAECLGVYYCFQGSHVPPTFGGGTK
    LEVKRADAAPTVSIFPPSSEQLTSGG
    CDR1 (SEQ ID NO: 8) RASQSIVHTNGNTYLE
    CDR2 (SEQ ID NO: 9) KVSNRFS
    CDR3 (SEQ ID NO: 10) FQGSHVPP
  • TABLE 5
    <Table 5: Amino acid Sequence of W30>
    Heavy Chain Full-length Sequence MSSPQTLNTLTLTMGWNWIFLFLLSGTAGVHSEVQLQQ
    (SEQ ID NO: 11) SGPVLVKPGASVKMSCKASGYTFTDYFLNWIKQSHGKS
    LELIGVINPYNDGVTYNRKFKGKATLTVDKSSSTAYME
    LTSLTSGDSAVYYCARSGDGFYLYYFDYWGQGTTLTVS
    SESARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTM
    NVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVE
    CPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPS
    CHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVF
    TWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNS
    GASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPP
    SEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPE
    SYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYS
    CMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDG
    ICY
    Variable region MSSPQTLNTLTLTMGWNWIFLFLLSGTAGVHSEVQLQQ
    (SEQ ID NO: 12) SGPVLVKPGASVKMSCKASGYTFTDYFLNWIKQSHGKS
    LELIGVINPYNDGVTYNRKFKGKATLTVDKSSSTAYME
    LTSLTSGDSAVYYCARSGDGFYLYYFDYWGQGTTLTVS
    S
    CDR1 (SEQ ID NO: 13) DYFLN
    CDR2 (SEQ ID NO: 14) VINPYNDGVTYNRKFKG
    CDR3 (SEQ ID NO: 15) SGDGFYL
    Light Chain Pull-length Sequence MVFTPQILGLMLPWISASRGEIVLTQSPVTLSVTPGDN
    (SEQ ID NO: 16) VSLSCRASQSISYNLHWFQQKSHESPRLLIKFASQSIS
    GIPSRFRGYGSGTDFTLSINSVETSDFGMYFCQQSNSW
    PQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASV
    VCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKD
    STYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKS
    FNRNEC
    Variable region MVFTPQILGLMLFWISASRGEIVLTQSPVTLSVTPGDN
    (SEQ ID NO: 17) VSLSCRASQSISYNLHWFQQKSHESPRLLIKFASQSIS
    GIPSRFRGYGSGTDFTLSINSVETEDFGMYFCQQSNSW
    PQTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGG
    CDR1 (SEQ ID NO: 18) RASQSISYNLH
    CDR2 (SEQ ID NO: 19) FASQSIS
    CDR3 (SEQ ID NO: 20) QQSNSWPQ
  • TABLE 6
    <Table 6: Amino acid Sequence of W34>
    Heavy Chain Full-length Sequence MSVLILLWLFTAFPGILSDVQLQESGPGMVKPSQSLSL
    (SEQ ID NO: 21) TCTVTGYSITSGYDWHWIRHFPGNKLEWMGYISYSGST
    DYNPALRSRISTTRDTSTNHFFLKVNSVTTEDTATYYC
    ARDGYGSNYVMAYWGQGTSVTVSSESARNPTIYPLTLP
    RALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVN
    FPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDS
    NAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDL
    LLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKA
    VQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDT
    LTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCL
    VRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGA
    TTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQK
    TIDRLSGKPTNVSVSVIMSEGDGICY
    Variable region MSVLILLWLFTAFPGILSDVQLQESGPGMVKPSQSLSL
    (SEQ ID NO: 22) TCTVTGYSITSGYDWHWIRHFPGNKLEWMGYISYSGST
    DYNPALRSRISITRDTSTNHFFLKVNSVTTEDTATYYC
    ARDGYGSNYVMAYWGQGTSVTVSS
    CDR1 (SEQ ID NO: 23) SGYDWH
    CDR2 (SEQ ID NO: 24) YISYSGSTDYNPALRS
    CDR3 (SEQ ID NO: 25) DGYGSN
    Light Chain Full-length Sequence MHFQVQIFSFLLISASVIMSRGQIVLTQSPAIMSASPG
    (SEQ ID NO: 26) EKVTITCSASSSVHYIHWFQLKPGTSPKLWIYSTSNLA
    SGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSS
    YPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGAS
    VVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSK
    DSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVK
    SFNRNEC
    Variable region MHFQVQIFSFLLISASVIMSRGQIVLTQSPAIMSASPG
    (SEQ ID NO: 27) EKVTITCSASSSVHYIHWFQLKPGTSPKLWIYSTSNLA
    SGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSS
    YPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGG
    CDR1 (SEQ ID NO: 28) SASSSVHYIH
    CDR2 (SEQ ID NO: 29) STSNLAS
    CDR3 (SEQ ID NO: 30) QQRSSYPL
  • TABLE 7
    <Table 7: Amino acid Sequence of W43>
    Heavy Chain Full-length Sequence MSSPQTLNTLTLTMGWSWIFLFLLSEAAGVLSEVQLQQ
    (SEQ ID NO: 31) SGPELVKPGASVKMSCKASGYTFTDYNMHWVKQSHGKS
    LEWIGYINLYNDGTDYSQKFEGRSTLTLNKSSNTAYME
    LRSLTSEDSAVYYCARDYGNFAYFFDYWGQGTTLTVSS
    ESARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMN
    VTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVEC
    PEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSC
    HPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFT
    WEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSG
    ASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPS
    EELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPES
    YLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSC
    MVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGI
    CY
    Variable region MSSPQTLNTLTLTMGWSWIFLFLLSEAAGVLSEVQLQQ
    (SEQ ID NO: 32) SGPELVKPGASVKMSCKASGYTFTDYNMHWVKQSHGKS
    LEWIGYINLYNDGTDYSQKFEGRSTLTLNKSSNTAYME
    LRSLTSEDSAVYYCARDYGNFAYFFDYWGQGTTLTVSS
    CDR1 (SEQ ID NO: 33) DYNMH
    CDR2 (SEQ ID NO: 34) YINLYNDGTDYSQKFEG
    CDR3 (SEQ ID NO: 35) DYGNFAYF
    Light Chain Full-length Sequence MTMLSLAPLLSLLLLCVSDSRAETTVTQSPASLSVATG
    (SEQ ID NO: 36) EKVTIRCITSTDIDDDMNWFQQRPGEPPKLLISEGNVL
    RPGVPSRFSSSGYGTDFVFTIEDTLSEDVADYYCLQSD
    NMPLSFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGA
    SVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS
    KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIV
    KSFNRNEC
    Variable region MTMLSLAPLLSLLLLCVSDSRAETTVTQSPASLSVATG
    (SEQ ID NO: 37) EKVTIRCITSTDIDDDMNWFQQRPGEPPKLLISEGNVL
    RPGVPSRFSSSGYGTDFVFTIEDTLSEDVADYYCLQSD
    NMPLSFGAGTKLELKRADAAPTVSIFPPSSEQLTSGG
    CDR1 (SEQ ID NO: 38) ITSTDIDDDMN
    CDR2 (SEQ ID NO: 39) EGNVLRP
    CDR3 (SEQ ID NO: 40) LQSDNMPLS
  • TABLE 8
    <Table 8: Amino acid Sequence of W11
    Heavy Chain Full-length Sequence MAVLGLLFCLVTFPSCVLSQVQLKQSGPGLVQPSQSLS
    (SEQ ID NO: 41) ITCTVSGFSLTNYGVHWIRQSPGKGLEWLGVIWSGGRI
    DYNAAFISRLNINKDNSKSQVFFKMNSLQTDDTAIYYC
    ARTYDGYYFFQYWGQGTPLTVSSESARNPTIYPLTLPR
    ALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNF
    PPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSN
    AVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLL
    LGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAV
    QNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTL
    TGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLV
    RAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGAT
    TYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKT
    IDRLSGKPTNVSVSVIMSEGDGICY
    Variable region MAVLGLLFCLVTFPSCVLSQVQLKQSGPGLVQPSQSLS
    (SEQ ID NO: 42) ITCTVSGFSLTNYGVHWIRQSPGKGLEWLGVIWSGGRI
    DYNAAFISRLNINKDNSKSQVFFKMNSLQTDDTAIYYC
    ARTYDGYYFFQYWGQGTPLTVSS
    CDR1 (SEQ ID NO: 43) NYGVH
    CDR2 (SEQ ID NO: 44) VIWSGGRIDYNAAFIS
    CDR3 (SEQ ID NO: 45) TYDGYYFFQ
    Light Chain Full-length Sequence MKLPVRLLVLMFWIPASSSDVVMTQTPLSLPVSLGDEA
    (SEQ ID NO: 46) SISCRSSRSLIHSNGHTFLDWYLQKPGQSPKLLIYKVS
    NRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCAQ
    STHAPLLTFGAGTKLELKRADAAPTVSIFPPSSEQLTS
    GGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTD
    QDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTS
    PIVKSFNRNEC
    Variable region MKLPVRLLVLMFWIPASSSDVVMTQTPLSLPVSLGDEA
    (SEQ ID NO: 47) SISCRSSRSLIHSNGHTFLDWYLQKPGQSPKLLIYKVS
    NRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCAQ
    STHAPLLTFGAGTKLELKRADAAPTVSIFPPSSEQLTS
    CDR1 (SEQ ID NO: 48) RSSRSLIHSNGHTFLD
    CDR2 (SEQ ID NO: 49) KVSNRFS
    CDR3 (SEQ ID NO: 50) AQSTHAPL
  • Example 2 Experiment to Identify Antigens for Monoclonal IgA Antibodies 2-1: Immunoprecipitation Experiment
  • After cell extracts were prepared from three species of bacteria, i.e., Escherichia coli (DH5α), Pseudomonas fulva, and Staphylococcus aureus, by the method described in section 1-5 above, 2-ME (final concentration of 300 mM) and SDS (final concentration of 1%) were added, and heat denaturation was performed at 95° C. for 10 minutes. Thereafter, in each solution, the 2-ME concentration was adjusted to 60 mM, and the SDS concentration was adjusted to 0.2%. First, 100 μl of Protein G Sepharose 4 Fast Flow (GE) that had been washed was added to each cell extract, and the resulting mixtures were mixed by inversion at 4° C. for 30 minutes. Components that non-specifically bind to Protein G Sepharose were then eliminated by centrifugation. 5 μg of the W27 monoclonal IgA antibody was added to each of the cell extracts obtained after the pre-clear, and the resulting mixtures were allowed to stand on ice for 30 minutes. Thereafter, 5 μg of goat anti-mouse IgA was added, and the resulting mixtures were allowed to stand on ice for another 30 minutes. Subsequently, 30 μl of Protein G Sepharose 4 Fast Flow (GE) that had been washed was added, and the resulting mixtures were mixed by inversion at 4° C. for 15 hours. Alter a washing procedure with PBS containing 1% NP-40 was performed four times, a SDS-buffer (containing 2-ME) was added to the Protein G Sepharose, and protein denaturation was performed by heat treatment at 95° C. for 10 minutes (immunoprecipitation samples). These samples were subjected to 8% SDS-PAGE and then the Western blotting described above confirmed that the protein detected in section 1-5 above was concentrated (FIG. 5).
  • 2-2: Two-Dimensional Electrophoresis and MS Analysis
  • Each of the immunoprecipitation samples was subjected to acetone precipitation and dissolved in a buffer for two-dimensional electrophoresis. The gel used in the first dimension was agar gel (pH of 3 to 8; ATTO). In the second dimension, 6% SDS-PAGE was performed. Duplicated samples were prepared every time and simultaneously electrophoresed on two gels. One sample was then subjected to the Western blotting described above to confirm the location of the target protein in the gel. Specifically, after protein transfer to a filter, the transferred protein was stained with a MemCode™ Reversible Protein Stain Kit (Thermo Scientific) to obtain an image of the staining (FIG. 5).
  • Subsequently, after bleaching, the usual Western blotting described above was performed to obtain an image to confirm the location of the target protein (FIG. 5). The two images identified a spot of the target protein in two dimensions. The gel for the other sample was silver-stained (Sil-Best Stain; Nacalai Tesque) to visualize all the proteins. The target protein was identified based on the location information obtained from the first gel and excised from the second gel.
  • The excised gel was subjected to in-gel enzymatic digestion with trypsin at 37° C. for 15 hours.
  • MS analysis was performed with LCMS-IT-TOF (Shimadzu Corporation). The analysis results revealed that the protein in the spot was serine hydroxymethyltransferase as an antigen.
  • Subsequently, the full length of serine hydroxymethyltransferase represented by the amino acid sequence (SEQ ID NO: 74 that was c-Myc tagged at the C-terminus) was expressed in Escherichia coli (DH5α). Binding of each of the above antibodies (the W11, W27, W30, W34, and W43 monoclonal IgA antibodies) to serine hydroxymethyltransferase was examined by Western blotting. FIG. 9 shows the results.
  • The results revealed that not only the W27 monoclonal IgA antibody, but also the W11, W30, W34, and W43 monoclonal IgA antibodies, recognized serine hydroxymethyltransferase as an antigen.
  • 2-3: Epitope Identification Experiment
  • Next, various mutants and wild type of serine hydroxymethyltransferase were expressed in Escherichia coli cells and 293T cells. An experiment was performed to investigate the epitope of the monoclonal antibodies described above.
  • The prepared mutants had the amino acid sequences at the following positions in the amino acid sequence represented by SEQ ID NO: 74:
    • (1) sequence represented by amino acids 1 to 417 (full length: wild-type),
    • (2) sequence represented by amino acids 11 to 417 (Δ2-10),
    • (3) sequence represented by amino acids 20 to 417 (Δ2-25),
    • (4) sequence represented by amino acids 29 to 417 (Δ2-28),
    • (5) sequence represented by amino acids 1 to 333 (Δ334-417), and
    • (6) sequence represented by amino acids 1 to 250 (Δ251-417).
      Each sequence was added Myc-tag (40aa) at the C-terminus.
  • Cell lysates containing these wild type and mutants of serine hydroxymethyltransferase were subjected to Western blotting in the same manner as described above. The antibody used was the W27 monoclonal IgA antibody. FIG. 10 shows the results.
  • The results shown in FIG. 10 revealed that the W27 monoclonal IgA antibody bound to Δ2-25 mutant, but did not bind to Δ2-28 mutant. This fact was clear from the experiment using the 293T system, which was believed to be free of the influence of endogenous serine hydroxy methyltransferase derived from Escherichia coli. It was also revealed that the W27 monoclonal IgA antibody bound to Δ251-417 mutant and Δ334-417 mutant.
  • Example 3 Oral Administration Experiment for W27 Monoclonal IgA Antibody 3-1: Analysis of Disease Model of G23S Mice
  • Large intestinal tissue sections of AID G23S mice were prepared and stained with HE to investigate the degree of inflammation. As a result, significant reduction or atrophy in the crypts was observed even at 13-16 weeks of age compared with wild-type mice (FIG. 6). In particular, at 40 weeks or more of age, significant reduction or atrophy in the crypts and infiltration of inflammatory cells into mucosa of the large intestine were observed. Immunostaining showed that a larger number of CD11B+ cells, IL-6 positive cells, IL-6, IL-17, and like inflammatory cells were present than in the wild-type mice.
  • Further, the results of measuring the expression levels of TNFα, IFNγ, IL-1β, IL-17, IL-6 and like inflammatory cytokines by a method using quantitative PCR similarly revealed that a larger number of inflammatory cells were present in the large intestinal tissues of AID G23S mice compared with those of the wild-type mice. The above facts revealed that AID G23S mice were suitable for use as a mouse model of inflammatory bowel disease, ulcerative colitis, and like diseases.
  • 3-2: Effect of W27 Monoclonal IgA Antibody
  • The W27 monoclonal IgA antibody was orally administered to mice in a state of overreaction of the intestinal immune system. Hyperplasia of Peyer's patch germinal center and increase in the production of inflammatory cytokines was observed in intestinal tissue of the mice.
  • In the experiment, 10- to 12-week-old male AID G23S mice were used (Balb/c background). The W27 monoclonal IgA antibody was added to drinking water for feeding at a concentration of 25 μg/ml, and the resulting drinking water was orally given to AID G23S mice for 28 days. An experiment in which only water was given to AID G23S mice and an experiment in which only water was likewise given to wild-type mice were performed as negative controls.
  • Feed was also given to all the mice in the same manner as in usual feeding.
  • One month after the start of the administration of W27 monoclonal IgA antibody, the mice were euthanized, and the Peyer's patches were excised from the small intestine of tested mice. The Peyer's patch tissue was separated into single cells using glass slides, followed by staining of surface antigens of the cells with the antibodies described below. The percentage of the cell number of germinal center B cell fractions that exhibited B220+PNAhigh was determined using flow cytometry analysis to investigate whether the germinal centers themselves regressed due to the administration of the W27 monoclonal IgA antibody.
  • The antibodies used in the flow cytometry are as follows:
    • PE-Cy7-labeled anti-mouse B220 (eBioscience);
    • Biotinylated peanut agglutinin (VECTOR laboratories);
    • Streptavidin APC (eBioscience).
  • Analysis of variance and t-test were performed to determine whether there was a significant difference in the percentage of Peyer's patch germinal center B cells between the administration group and the two negative control groups. Specifically, the percentage of Peyer's patch germinal center B cells of each group and the number of the Peyer's patch germinal center B cells of each group were analyzed. FIG. 7 shows the results.
  • The number of Peyer's patch germinal center B cells notably increased in the AID G23S mice not treated with W27 monoclonal IgA antibody. In contrast, it was revealed that the number of germinal center B cells in AID G23S mice treated with W27 monoclonal IgA antibody was notably reduced to a level similar to that of the wild-type mice by oral administration of the W27 monoclonal IgA antibody.
  • As described above, it is clear that AID G23S mice are suitable for use as a mouse model of inflammatory bowel disease, ulcerative colitis, and like diseases. In addition, Peyer's patch germinal center B cells grew excessively in the AID G23S mice. IgA antibodies in the intestinal immune system are produced in Peyer's patch germinal center B cells. Thus, an excessive increase in the B cells indicates that IgA antibodies are excessively produced in the intestinal immune system. This means that the state in AID G23S mice does not satisfactorily prevent entry of intestinal bacteria into intestinal mucosa. To improve such a state, T cells are complementarily activated in the intestinal immune system, which results in the increase in the production of inflammatory cytokines to cause inflammation, as described above.
  • Therefore, the W27 monoclonal IgA antibody, which has the effect of reducing the number of Peyer's patch germinal center B cells, makes it possible to normalize the intestinal immune system and suppress the function of, for example, T cells, thereby resolving inflammation. This clearly suggested that the W27 monoclonal IgA antibody is effective against diseases caused by alternation of intestinal bacterial growth and/or pathological changes of intestinal bacterial growth in gut microbiota, such as inflammatory bowel disease and ulcerative colitis, and, furthermore, intestinal diseases.
  • FIG. 11 shows the comparative results of analysis indicating redaction or pathological atrophy in the crypts between the large intestine of 13- to 15-week-old AID G23S mice to which the W27 monoclonal IgA antibody was orally administered for four weeks and the large intestine of 13- to 15-week-old wild-type mice or the large intestine of 13- to 15-week-old AID G23S mice not treated with W27 monoclonal IgA antibody. The contents of the entire large intestine were removed, and the large intestine was washed with saline, wound around a toothpick, embedded in OCT compound, and frozen. Thereafter, frozen sections with a thickness of 6 microns were prepared and subjected to hematoxylin eosin staining. Pathological portions in which reduction in the crypts was observed under a microscope were specified, and the extent of pathological portions in the entire large intestine was quantified and summarized graphically in FIG. 11 a. Typical tissue images are shown in FIG. 11 b.
  • 3-3: Experiment for Kinetics of W27 Monoclonal IgA Antibody in the Body Through Oral Administration
  • An experiment was performed to confirm whether the W27 monoclonal IgA antibody reaches the intestine via the digestive tract after being orally administered. AID knockout mice in which IgA is not produced were used in the experiment.
  • The W27 monoclonal IgA antibody was orally administered to the AID knockout mice in the same dose and method as in the oral administration experiment described above. Specifically, the W27 monoclonal IgA antibody was added to drinking water at a concentration of 25 μg/ml, and the resulting drinking water was administered by oral ingestion for 28 days in a sustained manner. On day 2, feces were collected. 100 mg of the collected feces was suspended in 0.9 ml of PBS, and the suspension was centrifuged to collect the supernatant. The IgA concentration in the supernatant was measured by ELISA.
  • FIG. 8 shows the results. The W27 monoclonal IgA antibody was detected from the feces. This fact revealed that after being orally administered, the W27 monoclonal IgA antibody reached the intestine with no influence of, for example, digestive enzymes in the gastrointestinal tract. This suggests that the W27 monoclonal antibody sufficiently exhibits a function as an orally administered composition.
  • 3-4: Bacterial Cell Growth Suppression Effect Attained by using Monoclonal IgA Antibodies
  • Escherichia coli strain DH5α was added to an LB liquid medium and subjected to shaking culture at 37° C. overnight. The following day, the resulting Escherichia coli liquid was suitably diluted, seeded onto an LB plate, and cultured at 37° C. overnight. The number of Escherichia coli in the Escherichia coli liquid was calculated by counting the number of colonies on the plate on the following day. The obtained number was defined as the number of Escherichia coli at the start of the growth suppression experiment.
  • At the same time as the Escherichia coli liquid was seeded onto the LB plate, 50 μl of Escherichia coli diluted in an LB liquid medium was added to a 96-well plate, and, further, the W27 monoclonal IgA antibody, the W27SC3F monoclonal IgA antibody, and the W2 monoclonal IgA antibody were individually added at a final concentration of 1.6 mg/ml.
  • The 96-well plate was subjected to static culture at 37° C. for 7 hours. After 7 hours, the resulting Escherichia coli liquids were individually diluted appropriately, seeded onto LB plates, and cultured at 37° C. overnight. On the following day, the number of colonies on each LB plate was counted to measure the number of Escherichia coli. The number of the bacterial cells calculated at the start of the experiment described above was defined as 1. Using this standard, the numbers of the bacterial cells after incubation with the IgA antibodies were calculated and plotted in a graph as the proliferation rate (the ordinate of the graph in FIG. 12). FIG. 12 shows the results.
  • From the results shown in FIG. 12, it can be found that there was a significant difference in the proliferation rate of Escherichia coli between the treatment of the W2 monoclonal IgA antibody and that of the W27 monoclonal IgA antibody. Although the detailed mechanism is unclear, the result of the above Example clarifies that the W2 monoclonal IgA antibody does not likely bind to Escherichia coli. The results thus suggested that the W27 monoclonal IgA antibody binds to Escherichia coli, thereby suppressing the growth of Escherichia coli.
  • Furthermore, the W27SC3F monoclonal IgA antibody, which is secretory IgA, exhibits the most potent growth suppression effect. This fact suggests that secretory IgA dimers actually secreted in the intestine in vivo recognize and bind to the bacteria and then exhibits unique effector functions, resulting in suppression of Escherichia coli growth. This suggested that when a monoclonal IgA antibody is used for controlling intestinal bacteria, it is preferably in the form of secretory IgA.

Claims (21)

1.-26. (canceled)
27. A method for treating an intestinal disease in a human subject in need thereof, comprising administering to the subject an effective amount of a monoclonal antibody, wherein the monoclonal antibody is capable of binding to serine hydroxymethyltransferase.
28. The method according to claim 27, wherein the monoclonal antibody is orally or enterally administered.
29. The method according to claim 27, wherein the monoclonal antibody binds to serine hydroxymethyltransferase represented by SEQ ID NO: 74.
30. The method according to claim 27, wherein the monoclonal antibody binds to amino acids 11 to 333 of serine hydroxymethyltransferase represented by SEQ ID NO: 74.
31. The method according to claim 27, wherein the monoclonal antibody binds to an epitope comprising amino acids 26 to 28 of serine hydroxymethyltransferase represented by SEQ ID NO: 74.
32. The method according to claim 27, wherein the monoclonal antibody has a structure selected from the group consisting of F(ab′)2, Fab, Fv, scFv, scFv-Fc, and mini body.
33. The method according to claim 27, wherein the monoclonal antibody is IgA.
34. The method according to claim 33, wherein the monoclonal antibody is IgA1 or IgA2.
35. The method according to claim 34, wherein the monoclonal antibody is a J chain-containing polymer.
36. The method according to claim 34, wherein the monoclonal antibody comprises a secretory component.
37. The method according to claim 27, wherein the monoclonal antibody comprises:
(1) a heavy chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 3, CDR 2 consisting of the amino add sequence represented by SEQ ID NO: 4, and CDR 3 consisting of the amino add sequence represented by SEQ ID NO: 5, and
a light chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 8, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 9, and CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 10;
(2) a heavy chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 13, CDR 2 consisting of the amino add sequence represented by SEQ ID NO: 14, and CDR 3 consisting of the amino add sequence represented by SEQ ID NO: 15, and
a light chain variable region comprising CDR 1 consisting of the amino add sequence represented by SEQ ID NO: 18, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 19, and CDR 3 consisting of the amino add sequence represented by SEQ ID NO: 20;
(3) a heavy chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 23, CDR 2 consisting of the amino add sequence represented by SEQ ID NO: 24, and CDR 3 consisting of the amino add sequence represented by SEQ ID NO: 25, and
a light chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 28, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 29, and CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 30;
(4) a heavy chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 33, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 34, and CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 35, and
a light chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 38, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 39, and CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 40; or
(5) a heavy chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 43, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 44, and CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 45, and
a light chain variable region comprising CDR 1 consisting of the amino acid sequence represented by SEQ ID NO: 48, CDR 2 consisting of the amino acid sequence represented by SEQ ID NO: 49, and CDR 3 consisting of the amino acid sequence represented by SEQ ID NO: 50.
38. The method according to claim 27, wherein the monoclonal antibody comprises:
(I) a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 2, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 7;
(II) a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 12, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 17;
(III) a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 22, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 27;
(IV) a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 32, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 37; or
(V) a heavy chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 42, and a light chain variable region consisting of the amino acid sequence represented by SEQ ID NO: 47.
39. The method according to claim 27, wherein the monoclonal antibody comprises:
(a) a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 1, and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 6;
(b) a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 11, and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 16;
(c) a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 21, and a light chain consisting of the amino add sequence represented by SEQ ID NO: 26;
(d) a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 31, and a light chain consisting of the amino add sequence represented by SEQ ID NO: 36; or
(e) a heavy chain consisting of the amino acid sequence represented by SEQ ID NO: 41, and a light chain consisting of the amino acid sequence represented by SEQ ID NO: 46.
40. The method according to claim 37, wherein the monoclonal antibody binds to at least one kind of intestinal bacteria selected from the group consisting of:
Eubacterium rectale,
Lactobacillus murinus,
Escherichia coli,
Staphylococcus aureus,
Enterococcus faecalis,
Pseudomonas fulva, and
Enterorhabdus mucosicola.
41. The method according to claim 27, wherein the monoclonal antibody binds to at least two kinds of intestinal bacteria selected from the group consisting of:
Eubacterium rectale,
Lactobacillus murinus,
Escherichia coli,
Staphylococcus aureus,
Enterococcus faecalis,
Pseudomonas fulva, and
Enterorhabdus mucosicola.
42. The method according to claim 41, wherein the monoclonal antibody fails to bind to at least one kind of intestinal bacteria selected from the group consisting of:
Blautia coccoides,
Coprococcus eutactus,
Megamonas hypermegale,
Lactobacillus casei, and
Bifidobacterium bifidum.
43. The method according to claim 27, wherein the monoclonal antibody is a humanized antibody or a chimeric antibody.
44. The method according to claim 27, wherein the intestinal disease is an inflammatory bowel disease.
45. The method according to claim 44, wherein the inflammatory bowel disease is Crohn's disease.
46. The method according to claim 44, wherein the inflammatory bowel disease is ulcerative colitis.
US15/676,641 2013-03-11 2017-08-14 METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY Abandoned US20180009906A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/676,641 US20180009906A1 (en) 2013-03-11 2017-08-14 METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY

Applications Claiming Priority (7)

Application Number Priority Date Filing Date Title
JP2013048365 2013-03-11
JP2013-048365 2013-03-11
JP2013-167120 2013-08-09
JP2013167120 2013-08-09
PCT/JP2014/056216 WO2014142084A1 (en) 2013-03-11 2014-03-10 METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY
US201514773923A 2015-10-16 2015-10-16
US15/676,641 US20180009906A1 (en) 2013-03-11 2017-08-14 METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
PCT/JP2014/056216 Division WO2014142084A1 (en) 2013-03-11 2014-03-10 METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY
US14/773,923 Division US9765151B2 (en) 2013-03-11 2014-03-10 Method for producing monoclonal IgA antibody

Publications (1)

Publication Number Publication Date
US20180009906A1 true US20180009906A1 (en) 2018-01-11

Family

ID=51536740

Family Applications (2)

Application Number Title Priority Date Filing Date
US14/773,923 Expired - Fee Related US9765151B2 (en) 2013-03-11 2014-03-10 Method for producing monoclonal IgA antibody
US15/676,641 Abandoned US20180009906A1 (en) 2013-03-11 2017-08-14 METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US14/773,923 Expired - Fee Related US9765151B2 (en) 2013-03-11 2014-03-10 Method for producing monoclonal IgA antibody

Country Status (5)

Country Link
US (2) US9765151B2 (en)
EP (1) EP2995679A4 (en)
JP (2) JP5916946B2 (en)
CN (1) CN105246917A (en)
WO (1) WO2014142084A1 (en)

Families Citing this family (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105246917A (en) * 2013-03-11 2016-01-13 学校法人关西文理综合学园 Method for producing monoclonal igA antibody
US10160797B2 (en) 2013-03-15 2018-12-25 Sanofi Pasteur Biologics, Llc Antibodies against Clostridium difficile toxins and methods of using the same
WO2018181621A1 (en) * 2017-03-28 2018-10-04 味の素株式会社 Feed composition for improving intraintestinal environment
EP3656389A4 (en) * 2017-07-18 2021-11-03 Keio University Anti-bacterial composition against th1 cell-inducing bacteria
EP3683303A4 (en) * 2017-09-15 2021-05-05 BGI Shenzhen Megamonas funiformis and applications thereof
CA3105222A1 (en) * 2018-07-17 2020-01-23 Humabs Biomed Sa Antibodies against campylobacter species
CN112888448B (en) * 2018-12-07 2023-07-25 深圳华大生命科学研究院 Use of megamonas simplex for preventing and/or treating metabolic diseases
US20230340082A1 (en) * 2020-07-10 2023-10-26 The Wistar Institute Of Anatomy And Biology Dna antibody constructs for use against rotavirus
CN113122507B (en) * 2021-04-27 2023-03-24 江南大学 Double-antibody sandwich ELISA (enzyme-Linked immuno sorbent assay) method for rapidly detecting pseudomonas aeruginosa
CA3217726A1 (en) * 2021-05-04 2022-11-10 Oren Bogin Anti-nkg2d antibodies and uses thereof
CN117716035A (en) 2021-07-01 2024-03-15 国立大学法人东京大学 Antibodies that bind to clostridium difficile
WO2023277166A1 (en) 2021-07-02 2023-01-05 国立大学法人 東京大学 Monoclonal antibody-containing composition for suppressing clostridium difficile bacteria
CN118043074A (en) 2021-09-30 2024-05-14 伊加尔株式会社 Compositions containing monoclonal antibodies
CN117467016B (en) * 2023-12-27 2024-03-12 北京索莱宝科技有限公司 Antibodies to human IgA, antibody combinations and uses thereof

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN1381567A (en) * 2001-04-18 2002-11-27 上海博德基因开发有限公司 Polypeptide-serine hydroxymethyl transferase-10.56 and polynucleotide for coding it
KR101667623B1 (en) * 2005-11-30 2016-10-19 애브비 인코포레이티드 Monoclonal antibodies against amyloid beta protein and uses thereof
NZ589297A (en) * 2008-05-15 2011-12-22 Health L P W Process for producing milk fractions rich in secretory immunoglobulins
CN105246917A (en) * 2013-03-11 2016-01-13 学校法人关西文理综合学园 Method for producing monoclonal igA antibody

Also Published As

Publication number Publication date
JPWO2014142084A1 (en) 2017-02-16
US20160039944A1 (en) 2016-02-11
US9765151B2 (en) 2017-09-19
JP2016183153A (en) 2016-10-20
EP2995679A4 (en) 2016-12-14
JP5916946B2 (en) 2016-05-11
WO2014142084A1 (en) 2014-09-18
EP2995679A1 (en) 2016-03-16
CN105246917A (en) 2016-01-13

Similar Documents

Publication Publication Date Title
US20180009906A1 (en) METHOD FOR PRODUCING MONOCLONAL IgA ANTIBODY
JP6469052B2 (en) Methods for improving antibody physical properties
KR20120128688A (en) Antibody against serotype i lipopolysaccharide of pseudomonas aeruginosa
Ikai et al. Mfa4, an accessory protein of Mfa1 fimbriae, modulates fimbrial biogenesis, cell auto-aggregation, and biofilm formation in Porphyromonas gingivalis
US10865247B2 (en) Anti-human CD69 antibody, and use thereof for medical purposes
EP3266872B1 (en) Novel anti-pad4 antibody
US10968281B2 (en) Anti-LSP1 antibody
EP4365293A1 (en) Antibody binding to clostridium difficile
EP4364755A1 (en) Monoclonal antibody-containing composition for suppressing clostridium difficile bacteria
WO2023054726A1 (en) Composition containing monoclonal antibody
WO2023219175A1 (en) Method and composition both for treating or diagnosing inflammatory bowel disease (ibd)
US20240025985A1 (en) Agent for Preventing or Treating Frontotemporal Lobar Degeneration
Fujimura-Yamamoto et al. Intestinal microbiota and colon cancer

Legal Events

Date Code Title Description
AS Assignment

Owner name: CURED INC., JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:KANSAI BUNRI SOGO GAKUEN;REEL/FRAME:043286/0718

Effective date: 20170227

Owner name: KANSAI BUNRI SOGO GAKUEN, JAPAN

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SHINKURA, REIKO;REEL/FRAME:043286/0669

Effective date: 20150825

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION