US20170307618A1 - Method for predicting the risk of getting cancer or diagnosing cancer in a female subject - Google Patents
Method for predicting the risk of getting cancer or diagnosing cancer in a female subject Download PDFInfo
- Publication number
- US20170307618A1 US20170307618A1 US15/641,436 US201715641436A US2017307618A1 US 20170307618 A1 US20170307618 A1 US 20170307618A1 US 201715641436 A US201715641436 A US 201715641436A US 2017307618 A1 US2017307618 A1 US 2017307618A1
- Authority
- US
- United States
- Prior art keywords
- pro
- seq
- enkephalin
- antibody
- cancer
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 103
- 201000011510 cancer Diseases 0.000 title claims abstract description 101
- 238000000034 method Methods 0.000 title claims abstract description 64
- 102100038931 Proenkephalin-A Human genes 0.000 claims abstract description 158
- 108010041071 proenkephalin Proteins 0.000 claims abstract description 158
- 239000012634 fragment Substances 0.000 claims abstract description 84
- 150000001413 amino acids Chemical class 0.000 claims abstract description 32
- 210000001124 body fluid Anatomy 0.000 claims abstract description 26
- 238000003745 diagnosis Methods 0.000 claims abstract description 14
- 230000002596 correlated effect Effects 0.000 claims abstract description 10
- 206010006187 Breast cancer Diseases 0.000 claims description 48
- 208000026310 Breast neoplasm Diseases 0.000 claims description 48
- 108010054321 proneurotensin Proteins 0.000 claims description 39
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 36
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 36
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 28
- 239000007790 solid phase Substances 0.000 claims description 18
- 239000011230 binding agent Substances 0.000 claims description 15
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 14
- 201000005202 lung cancer Diseases 0.000 claims description 14
- 208000020816 lung neoplasm Diseases 0.000 claims description 14
- 238000004458 analytical method Methods 0.000 claims description 12
- 238000003018 immunoassay Methods 0.000 claims description 12
- 210000002381 plasma Anatomy 0.000 claims description 6
- 230000035945 sensitivity Effects 0.000 claims description 5
- 230000000391 smoking effect Effects 0.000 claims description 5
- 210000002966 serum Anatomy 0.000 claims description 4
- 238000004364 calculation method Methods 0.000 claims description 3
- 206010012601 diabetes mellitus Diseases 0.000 claims description 3
- 230000003449 preventive effect Effects 0.000 claims description 3
- 230000004044 response Effects 0.000 claims description 3
- 230000001225 therapeutic effect Effects 0.000 claims description 3
- YFGBQHOOROIVKG-FKBYEOEOSA-N Met-enkephalin Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 YFGBQHOOROIVKG-FKBYEOEOSA-N 0.000 claims description 2
- 210000004369 blood Anatomy 0.000 claims description 2
- 239000008280 blood Substances 0.000 claims description 2
- 238000013517 stratification Methods 0.000 claims 2
- 208000024172 Cardiovascular disease Diseases 0.000 claims 1
- 238000012801 analytical assay Methods 0.000 claims 1
- 238000002560 therapeutic procedure Methods 0.000 claims 1
- 102400000988 Met-enkephalin Human genes 0.000 abstract description 17
- YFGBQHOOROIVKG-BHDDXSALSA-N (2R)-2-[[(2R)-2-[[2-[[2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]acetyl]amino]-3-phenylpropanoyl]amino]-4-methylsulfanylbutanoic acid Chemical compound C([C@H](C(=O)N[C@H](CCSC)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 YFGBQHOOROIVKG-BHDDXSALSA-N 0.000 abstract description 14
- 108010042237 Methionine Enkephalin Proteins 0.000 abstract description 14
- 108010022337 Leucine Enkephalin Proteins 0.000 abstract description 13
- URLZCHNOLZSCCA-UHFFFAOYSA-N leu-enkephalin Chemical compound C=1C=C(O)C=CC=1CC(N)C(=O)NCC(=O)NCC(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=CC=C1 URLZCHNOLZSCCA-UHFFFAOYSA-N 0.000 abstract description 13
- 102100024622 Proenkephalin-B Human genes 0.000 abstract 1
- 238000003556 assay Methods 0.000 description 28
- 235000001014 amino acid Nutrition 0.000 description 18
- 102400000243 Leu-enkephalin Human genes 0.000 description 12
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 9
- 238000002372 labelling Methods 0.000 description 9
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 8
- 239000000090 biomarker Substances 0.000 description 8
- 229940098773 bovine serum albumin Drugs 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 238000005406 washing Methods 0.000 description 7
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 6
- 230000003053 immunization Effects 0.000 description 6
- 238000002649 immunization Methods 0.000 description 6
- URLZCHNOLZSCCA-VABKMULXSA-N Leu-enkephalin Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 URLZCHNOLZSCCA-VABKMULXSA-N 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 108010092674 Enkephalins Proteins 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- RXNXLAHQOVLMIE-UHFFFAOYSA-N phenyl 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC1=CC=CC=C1 RXNXLAHQOVLMIE-UHFFFAOYSA-N 0.000 description 4
- 239000000700 radioactive tracer Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 4
- 102000008214 Glutamate decarboxylase Human genes 0.000 description 3
- 108091022930 Glutamate decarboxylase Proteins 0.000 description 3
- 101800001325 Met-enkephalin Proteins 0.000 description 3
- 239000004793 Polystyrene Substances 0.000 description 3
- 210000004027 cell Anatomy 0.000 description 3
- 235000005911 diet Nutrition 0.000 description 3
- 230000037213 diet Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 229920002223 polystyrene Polymers 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000012492 Biacore method Methods 0.000 description 2
- KTQKWSPZOZKAEE-LJADHVKFSA-N Met-enkephalin-Arg-Phe Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 KTQKWSPZOZKAEE-LJADHVKFSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 229920004890 Triton X-100 Polymers 0.000 description 2
- 239000013504 Triton X-100 Substances 0.000 description 2
- ZDVWPPFTKCGYBB-UHFFFAOYSA-N [4-[3-(2,5-dioxopyrrolidin-1-yl)oxy-3-oxopropyl]phenyl] 10-methylacridin-10-ium-9-carboxylate Chemical compound C12=CC=CC=C2[N+](C)=C2C=CC=CC2=C1C(=O)OC(C=C1)=CC=C1CCC(=O)ON1C(=O)CCC1=O ZDVWPPFTKCGYBB-UHFFFAOYSA-N 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 238000010241 blood sampling Methods 0.000 description 2
- 239000012888 bovine serum Substances 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 230000001186 cumulative effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- IJKVHSBPTUYDLN-UHFFFAOYSA-N dihydroxy(oxo)silane Chemical compound O[Si](O)=O IJKVHSBPTUYDLN-UHFFFAOYSA-N 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 229940093916 potassium phosphate Drugs 0.000 description 2
- 229910000160 potassium phosphate Inorganic materials 0.000 description 2
- 235000011009 potassium phosphates Nutrition 0.000 description 2
- 230000000861 pro-apoptotic effect Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- BFCDFTHTSVTWOG-PXNSSMCTSA-N (1r,2s)-2-(octylamino)-1-(4-propan-2-ylsulfanylphenyl)propan-1-ol Chemical compound CCCCCCCCN[C@@H](C)[C@H](O)C1=CC=C(SC(C)C)C=C1 BFCDFTHTSVTWOG-PXNSSMCTSA-N 0.000 description 1
- QDZOEBFLNHCSSF-PFFBOGFISA-N (2S)-2-[[(2R)-2-[[(2S)-1-[(2S)-6-amino-2-[[(2S)-1-[(2R)-2-amino-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]-N-[(2R)-1-[[(2S)-1-[[(2R)-1-[[(2S)-1-[[(2S)-1-amino-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]pentanediamide Chemical compound C([C@@H](C(=O)N[C@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](N)CCCNC(N)=N)C1=CC=CC=C1 QDZOEBFLNHCSSF-PFFBOGFISA-N 0.000 description 1
- NVWLPCPCSZOUCO-XDIGFQIYSA-N (2s)-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[2-[[2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]acetyl]amino]-3-phenylpropanoyl]amino]-4-methylsulfanylbutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]acetyl]amino]-4-methylpentanoic Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCN=C(N)N)C(=O)NCC(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 NVWLPCPCSZOUCO-XDIGFQIYSA-N 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 108700017587 Arg(6)-Gly(7)-Leu(8)- enkephalin-Met Proteins 0.000 description 1
- 108700026277 Arg(6)-Phe(7)- enkephalin-Met Proteins 0.000 description 1
- 241000532370 Atla Species 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 102400000060 Copeptin Human genes 0.000 description 1
- 101800000115 Copeptin Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102000015779 HDL Lipoproteins Human genes 0.000 description 1
- 108010010234 HDL Lipoproteins Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- 102400001101 Large neuromedin N Human genes 0.000 description 1
- GDBQQVLCIARPGH-UHFFFAOYSA-N Leupeptin Natural products CC(C)CC(NC(C)=O)C(=O)NC(CC(C)C)C(=O)NC(C=O)CCCN=C(N)N GDBQQVLCIARPGH-UHFFFAOYSA-N 0.000 description 1
- 102400000992 Met-enkephalin-Arg-Gly-Leu Human genes 0.000 description 1
- 101800000700 Met-enkephalin-Arg-Gly-Leu Proteins 0.000 description 1
- 102400000987 Met-enkephalin-Arg-Phe Human genes 0.000 description 1
- 101800000666 Met-enkephalin-Arg-Phe Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 102400001104 Neuromedin N Human genes 0.000 description 1
- 101800001607 Neuromedin N Proteins 0.000 description 1
- 101800001814 Neurotensin Proteins 0.000 description 1
- 102400001103 Neurotensin Human genes 0.000 description 1
- 102000003840 Opioid Receptors Human genes 0.000 description 1
- 108090000137 Opioid Receptors Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 102000012582 Proenkephalin A Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102400000096 Substance P Human genes 0.000 description 1
- 101800003906 Substance P Proteins 0.000 description 1
- 102400000989 Synenkephalin Human genes 0.000 description 1
- 101800002423 Synenkephalin Proteins 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 108010052590 amastatin Proteins 0.000 description 1
- QFAADIRHLBXJJS-ZAZJUGBXSA-N amastatin Chemical compound CC(C)C[C@@H](N)[C@H](O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC(O)=O QFAADIRHLBXJJS-ZAZJUGBXSA-N 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000009227 antibody-mediated cytotoxicity Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000035487 diastolic blood pressure Effects 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Substances N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- XMBWDFGMSWQBCA-RNFDNDRNSA-M iodine-131(1-) Chemical compound [131I-] XMBWDFGMSWQBCA-RNFDNDRNSA-M 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- GDBQQVLCIARPGH-ULQDDVLXSA-N leupeptin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C=O)CCCN=C(N)N GDBQQVLCIARPGH-ULQDDVLXSA-N 0.000 description 1
- 108010052968 leupeptin Proteins 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000010125 myocardial infarction Diseases 0.000 description 1
- 108010041345 neuromedin N-125 Proteins 0.000 description 1
- RZMLVIHXZGQADB-YLUGYNJDSA-N neuromedin n Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C1=CC=C(O)C=C1 RZMLVIHXZGQADB-YLUGYNJDSA-N 0.000 description 1
- PCJGZPGTCUMMOT-ISULXFBGSA-N neurotensin Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 PCJGZPGTCUMMOT-ISULXFBGSA-N 0.000 description 1
- 229920002113 octoxynol Polymers 0.000 description 1
- 230000008050 pain signaling Effects 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 108010074732 preproenkephalin Proteins 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000013558 reference substance Substances 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000035488 systolic blood pressure Effects 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 230000002227 vasoactive effect Effects 0.000 description 1
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57415—Specifically defined cancers of breast
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57423—Specifically defined cancers of lung
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/665—Assays involving proteins derived from pro-opiomelanocortin, pro-enkephalin or pro-dynorphin
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/50—Determining the risk of developing a disease
Definitions
- Subject matter of the present invention is a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising:
- Met-Enkephalin a 5 amino acid peptide derived from the Enkephalin precursor (PreProEnkephalin), also named “Opioid Growth Factor” (OGF) is released together with ProEnkephalin-fragments.
- the mature peptide binds to different opioid receptors (Koneru et al., 2009).
- Enkephalin (OGF) was found to have a number of physiological functions. In the CNS it down regulates Substance P associated pain signalling, it plays roles as cytokine (Plotnikoff et al., 1997).
- Proenkephalin related peptides exhibiting antibiotic actions (Goumon et al., 1998).
- Proenkephalin and Enkephalin exhibits anti tumor action and acting as pro-apoptotic agents (Tavish et al., 2007, Donahue et al., 2011, Zagon et al., 2009).
- vasoactive peptides for prediction of cancer risks in males has been reported by Belting et al., Cancer, Epidemiology, Biomarkes & Prevention.
- MR-pro-ANP, MR-pro-ADM and copeptin was measured in the fasting plasma from participants of the Malmö Diet and Cancer Study that were free from cancer prior to the baseline exam in 1991 to 1994 (1768 males and 2293 females). The authors stated that among females, there was no relationship between biomarkers and cancer incidence.
- a subject of the present invention was to investigate the prognostic and diagnostic power of PENK for the prediction of cancer incidence and the prediction of the risk of reoccurrence of cancer.
- stable fragments of Pro-Enkephalin (Ernst et al., 2006) in fasting plasma were measured in said Swedish prospective cohort study (Malmo Diet and Cancer Study) and related baseline level of this biomarker to breast-cancer incidence during 15 years of follow-up.
- Pro-Enkephalin is a powerful and highly significant biomarker for woman for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject.
- subject matter of the present invention is a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising:
- cancers may be selected from the group comprising breast cancer, lung cancer, pancreatic cancer and colon cancer.
- fragments of Pro-Enkephalin also include Leu-Enkephalin and Met-Enkephalin.
- said cancer is breast cancer. In another specific embodiment of the invention said cancer is lung cancer.
- subject matter of the present invention is the determination of susceptibility of a woman to aquire cancer, e.g. breast cancer, lung cancer etc
- Data obtained in the present study revealed also a correlation between the risk of getting cancer in male subjects with the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said male subject; this correlation however, was not that statistically significant for the present data set although there was a clear trend for an increased cancer risk at reduced levels of PENK also in males.
- the method according to the invention also for male subjects but in the present study the observed effect was not as strong for males as compared to females. This may be primarily due to the low number of cancer incidents in the male population.
- subject refers to a living human or non-human organism.
- the subject is a human subject.
- reduced level means a level below a certain threshold level.
- a bodily fluid may be selected from the group comprising blood, serum, plasma, urine, cerebro spinal liquid (csf), and saliva.
- said female subject has never had a diagnosed cancer at the time the sample of bodily fluid is taken from said female subject.
- said female subject has been diagnosed before with having cancer and has been cured at the time the sample of bodily fluid is taken from said female subject and the risk of reoccurrence of getting cancer is determined or alternatively the re-occurrence of cancer is predicted.
- Pro-Enkephalin has the following sequence:
- Fragments of Pro-Enkephalin that may be determined in a bodily fluid may be e.g. selected from the group of the following fragments:
- Determining the level of Pro-Enkephalin including Leu-Enkephalin and Met-Enkephalin or fragments thereof may mean that the immunoreactivity towards Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin is determined.
- a binder used for determination of Pro-Enkephalin including Leu-Enkephalin and Met-Enkephalin or fragments thereof depending of the region of binding may bind to more than one of the above displayed molecules. This is clear to a person skilled in the art.
- the level of immunoreactive analyte by using at least one binder that binds to a region within the amino acid sequence of any of the above peptide and peptide fragments, is determined in a bodily fluid obtained from said subject; and correlated to the specific embodiments of clinical relevance.
- a binder that binds to a region within the amino acid sequence of any of the above peptide and peptide fragments i.e. Pro-Enkephalin (PENK) and fragments according to any of the sequences 1 to 12
- the level of MRPENK is determined (SEQ ID NO. 6: Pro-Enkephalin 119-159, Mid regional Pro-Enkephalin-fragment, MRPENK).
- the level of immunoreactive analyte by using at least one binder that binds to MR-PENK is determined and is correlated to the specific embodiments of clinical relevance according to the invention.
- Determining the level of Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin or fragments thereof may mean that the immunoreactivity towards Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin is determined.
- a binder used for determination of Pro-Enkephalin including Leu-Enkephalin and Met-Enkephalin or fragments thereof depending of the region of binding may bind to more than one of the above displayed molecules. This is clear to a person skilled in the art.
- the fragment is not Leu-Enkephalin or Met-Enkephalin
- the immunoreactivity towards Pro-Enkephalin or fragments thereof not including Leu-Enkephalin and Met-Enkephalin is determined.
- the level of MRPENK. (SEQ ID NO. 6 (Pro Enkephalin 119-159, Mid regional Pro-Enkephalin-fragment, MRPENK, DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVS) is determined.
- the level of any of the above analytes may be determined by other analytical methods e.g. mass spectroscopy.
- the level of Pro-Enkephalin or fragments thereof are measured with an immunoassay using antibodies or fragments of antibodies binding to Pro-Enkephalin or fragments thereof.
- An immunoassay that may be useful for determining the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids may comprise the steps as outlined in Example 2. All thresholds and values have to be seen in correlation to the test and the calibration used according to Example 2. A person skilled in the art may know that the absolute value of a threshold might be influenced by the calibration used. This means that all values and thresholds given herein are to be understood in context of the calibration used in herein (Example 2).
- the diagnostic binder to Pro-Enkephalin is selected from the group consisting of antibodies e.g. IgG, a typical full-length immunoglobulin, or antibody fragments containing at least the F-variable domain of heavy and/or light chain as e.g. chemically coupled antibodies (fragment antigen binding) including but not limited to Fab-fragments including Fab minibodies, single chain Fab antibody, monovalent Fab antibody with epitope tags, e.g. Fab-V5Sx2; bivalent Fab (mini-antibody) dimerized with the CH3 domain; bivalent Fab or multivalent Fab, e.g. formed via multimerization with the aid of a heterologous domain, e.g.
- antibodies e.g. IgG, a typical full-length immunoglobulin, or antibody fragments containing at least the F-variable domain of heavy and/or light chain as e.g. chemically coupled antibodies (fragment antigen binding) including but not limited to Fab-fragments including
- dHLX domains e.g. Fab-dHLX-FSx2; F(ab′)2-fragments, scFv-fragments, multimerized multivalent or/and multispecific scFv-fragments, bivalent and/or bispecific diabodies, BITE® (bispecific T-cell engager), trifunctional antibodies, polyvalent antibodies, e.g. from a different class than G; single-domain antibodies, e.g. nanobodies derived from camelid or fish immunoglobulines.
- the level of Pro-Enkephalin or fragments thereof are measured with an assay using binders selected from the group comprising aptamers, non-Ig scaffolds as described in greater detail below binding to Pro-Enkephalin or fragments thereof.
- Binder that may be used for determining the level of Pro-Enkephalin or fragments thereof exhibit an affinity constant to Pro-Enkephalin of at least 10 7 M ⁇ 1 , preferred 10 8 M ⁇ 1 , preferred affinity constant is greater than 10 9 M ⁇ 1 , most preferred greater than 10 10 M ⁇ 1 .
- Binding affinity may be determined using the Biacore method, offered as service analysis e.g. at Biaffin, Kassel, Germany (http://www.biaffin.com/de/).
- a human Pro-Enkephalin-control sample is available by ICI-Diagnostics, Berlin, Germany http://www.ici-diagnostics.com/.
- the assay may also be calibrated by synthetic (for our experiments we used synthetic MRPENK, SEQ ID NO. 6) or recombinant Pro-Enkephalin or fragments thereof.
- the threshold for determining the risk of getting breast cancer in a female subject or diagnosing breast cancer in a female subject according to the methods of the present invention is below 100 pmol/l PENK, preferred below 50 pmol/l, more preferred below 40.4 pmol/l. In a specific embodiment said threshold is about 40.4 pmol/l. These thresholds are related to the above mentioned calibration method. A PENK value below said threshold means that the subject has an enhanced risk of getting cancer or has already cancer.
- said method is performed more than once in order to monitor the risk of getting breast cancer in a female subject or in order to monitor the course of treatment. In one specific embodiment said monitoring is performed in order to evaluate the response of said female subject to preventive and/or therapeutic measures taken.
- the method is used in order to stratify said female subjects into risk groups.
- Subject of the present invention is also a method for predicting the risk of getting cancer in a female or identifying a female subject having an enhanced risk for getting cancer according to any of the preceding embodiments, wherein the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject either alone or in conjunction with other prognostically useful laboratory or clinical parameters is used for the prediction of a subject's risk for getting an adverse event by a method which may be selected from the following alternatives:
- subject of the present invention is also a method for predicting the risk of getting cancer in a female or identifying a female subject having an enhanced risk for getting cancer according to any of the preceding embodiments, wherein the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject either alone or in conjunction with other prognostically useful biomarker.
- a useful biomarker may be Pro-Neurotensin and fragments thereof of at least 5 amino acids.
- the level of Pro-Neurotensin 1-117 is determined in addition to the determination of Pro-Enkephalin an fragments thereof.
- subject matter of the present invention is also a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising:
- SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVI (Pro-Neurotensin 1-132)
- SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVIKRK IPYILKRQLY EN (Pro-Neurotensin 120-140) SEQ ID NO.
- the level of Pro-Neurotensin is measured with an immunoassay. More specifically an immunoassay is used as described in Ernst et al. (Peptides (2006), (27) 1787-1793).
- An immunoassay that may be useful for determining the level of Pro-Neurotensin or fragments thereof of at least 5 amino acids may comprise the steps as outlined in Example 2. All thresholds and values have to be seen in correlation to the test and the calibration used according to Example 2. A person skilled in the art may know that the absolute value of a threshold might be influenced by the calibration used. This means that all values and thresholds given herein are to be understood in context of the calibration used in herein (Example 2).
- a human Pro-Neurotensin-calibrator is available by ICI-Diagnostics, Berlin, Germany.
- the assay may also be calibrated by synthetic or recombinant P-NT 1-117 or fragments thereof (see also Ernst et al, 2006).
- Binder that may be used for determining the level of Pro-Neurotensin or fragments thereof exhibit an affinity constant to Pro-Neurotensin of at least 10 7 M ⁇ 1 , preferred 10 8 M ⁇ 1 , preferred affinity constant is greater than 10 9 M ⁇ 1 , most preferred greater than 10 10 M ⁇ 1 .
- Binding affinity may be determined using the Biacore method, offered as service analysis e.g.
- the threshold for determining the risk of getting breast cancer in a female subject or diagnosing breast cancer in a female subject according to the methods of the present invention is above 78 pmol/l PNT, preferred 100 pmol/l, more preferred 150 pmol/l. In a specific embodiment said threshold is about 100 pmol/l. These thresholds are related to the above mentioned calibration method. A P-NT value above said threshold means that the subject has an enhanced risk of getting cancer or has already cancer.
- said method is performed more than once in order to monitor the risk of getting breast cancer in a female subject or in order to monitor the course of treatment. In one specific embodiment said monitoring is performed in order to evaluate the response of said female subject to preventive and/or therapeutic measures taken.
- the method is used in order to stratify said female subjects into risk groups.
- the cancer is selected from the group comprising breast cancer, and lung cancer.
- Subject matter of the invention is further an assay for determining Pro-Enkephalin and Pro-Enkephalin fragments in a sample comprising two binders that bind to two different regions within the region of Pro-Enkephalin that is aminoacid 133-140 (LKELLETG, SEQ ID NO. 22) and aminoacid 152-159 (SDNEEEVS, SEQ ID NO. 23) wherein each of said regions comprises at least 4 or 5 amino acids.
- the assay sensitivity of said assay is able to quantify the Pro-Enkephalin or Pro-Enkephalin fragments of healthy subjects and is ⁇ 15 pmol/, preferably ⁇ 10 pmol/l and more preferably L ⁇ 6 pmol/L.
- said binder exhibits an binding affinity to its binding partner of at least 10 7 M ⁇ 1 , preferred 10 8 M ⁇ 1 , preferred affinity constant is lower than 10 9 M ⁇ 1 , most preferred lower than 10 10 M ⁇ 1 .
- a person skilled [K1] in the art knows that it may be considered to compensate lower affinity by applying a higher dose of compounds and this measure would not lead out-of-the-scope of the invention binding affinity may be determined as described above.
- such assay is a sandwich assay, preferably a fully automated assay. It may be an ELISA fully automated or manual. It may be a so-called POC-test (point-of-care).
- Examples of automated or fully automated assay comprise assays that may be used for one of the following systems: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®. Examples of test formats are provided above.
- At least one of said two binders is labeled in order to be detected. Examples of labels are provided above.
- At least one of said two binders is bound to a solid phase.
- solid phases are provided above.
- said label is selected from the group comprising chemiluminescent label, enzyme label, fluorescence label, radioiodine label.
- a further subject of the present invention is a kit comprising an assay according to the present invention wherein the components of said assay may be comprised in one or more container.
- Peptides for immunization were synthesized (JPT Technologies, Berlin, Germany) with an additional N-terminal Cystein residue for conjugation of the peptides to bovine serum albumin (BSA).
- BSA bovine serum albumin
- the peptides were covalently linked to BSA by using Sulfo-SMCC (Perbio-science, Bonn, Germany). The coupling procedure was performed according to the manual of Perbio.
- the antibodies were generated according to the following method:
- a BALB/c mouse was immunized with 100 ⁇ g peptide-BSA-conjugate at day 0 and 14 (emulsified in 100 ⁇ l complete Freund's adjuvant) and 50 ⁇ g at day 21 and 28 (in 100 ⁇ l incomplete Freund's adjuvant).
- the animal received 50 ⁇ g of the conjugate dissolved in 100 ⁇ l saline, given as one intraperitonal and one intravenous injection.
- Spenocytes from the immunized mouse and cells of the myeloma cell line SP2/0 were fused with 1 ml 50% polyethylene glycol for 30 s at 37° C. After washing, the cells were seeded in 96-well cell culture plates. Hybrid clones were selected by growing in HAT medium [RPMI 1640 culture medium supplemented with 20% fetal calf serum and HAT-supplement]. After two weeks the HAT medium is replaced with HT Medium for three passages followed by returning to the normal cell culture medium.
- the cell culture supernatants were primary screened for antigen specific IgG antibodies three weeks after fusion.
- the positive tested microcultures were transferred into 24-well plates for propagation. After retesting the selected cultures were cloned and recloned using the limiting-dilution technique and the isotypes were determined.
- Antibodies were produced via standard antibody production methods (Marx et al., Monoclonal Antibody Production (1997), ATLA 25, 121) and purified via Protein A-chromatography. The antibody purities were >95% based on SDS gel electrophoresis analysis.
- Labelled compound (tracer) 100 ⁇ g (100 ⁇ l) antibody (1 mg/ml in PBS, pH 7.4, was mixed with 10 ⁇ l Acridinium NHS-ester (1 mg/ml in acetonitrile, InVent GmbH, Germany) (EP 0353971) and incubated for 20 min at room temperature. Labelled antibody was purified by gel-filtration HPLC on Bio-Sil SEC 400-5 (Bio-Rad Laboratories, Inc., USA) The purified labelled antibody was diluted in (300 mmol/l potassiumphosphate, 100 mmol/l NaCl, 10 mmol/l Na-EDTA, 5 g/l bovine serum albumin, pH 7.0). The final concentration was approx.
- RLU relative light units
- Solid phase Polystyrene tubes (Greiner Bio-One International AG, Austria) were coated (18 h at room temperature) with antibody (1.5 ⁇ g antibody/0.3 ml 100 mmol/l NaCl, 50 mmol/l Tris/HCl, pH 7.8). After blocking with 5% bovine serum albumine, the tubes were washed with PBS, pH 7.4 and vacuum dried.
- Antibody cross-reactivities were determined as follows:
- sample 50 ⁇ l of sample (or calibrator) was pipetted into coated tubes, after adding labeled antibody (200 ul), the tubes were incubated for 2 h at 18-25° C. Unbound tracer was removed by washing 5 times (each 1 ml) with washing solution (20 mmol/l PBS, pH 7.4, 0.1% Triton X-100). Tube-bound labelled antibody was measured by using the Luminumeter LB 953 and a fixed concentration of 1000 pmol/l of MRPENK. The signal (RLU at 1000 pmol MRPENK/l) to noise (RLU without MRPENK) ratio of different antibody combinations is given in table 4. All antibodies were able to generate a sandwich complex with any other antibody.
- the assay was calibrated, using dilutions of synthetic MRPENK, diluted in 20 mM K2PO4, 6 mM EDTA, 0.5% BSA, 50 ⁇ M Amastatin, 100 ⁇ M Leupeptin, pH 8.0.
- Pro-Enkephalin control plasma is available at ICI-diagnostics, Berlin, Germany.
- FIG. 1 shows a typical Pro-Enkephalin dose/signal curve. Standard curve Pro-Enkephalin.
- the assay sensitivity was 20 determinations of 0-calibrator (no addition of MRPENK)+2 SD) 5.5 pmol/L.
- FIG. 2 frequence distribution of Pro Enkephalin in the females population:
- the x axis is the Logarithmus Naturalis (LN) of the PENK concentration. All results were within the measurement of the assay, the lowest PENK concentration was 9 pmol/L. These results indicating the suitability of the used assay (assay sensitivity 5.5 pmol/L).
- FIG. 3 Kaplan Meier graphs, illustrating the cumulative breast cancer diagnosis in women Quartile (Q) 1 (below 40.4 pmol/l) quartile 2 (40.4-47.1 pmol/l), quartile 3 (47.2-54.1 pmol/l), quartile 4 (above 54.1 pmol/l).
- Q Quartile
- quartile 2 40.4-47.1 pmol/l
- quartile 3 47.2-54.1 pmol/l
- quartile 4 above 54.1 pmol/l.
- Decreased PENK indicates a long term increased risk of breast cancer development. Since any women with cancer history at day of baseline (blood sampling) were excluded, Pro-Enkephalin is highly predictive for future breast cancer development. Over all, women from Q 1 have a 3.6 times higher risk to develop breast cancer than women from Q 4.
- Antibodies were generated as described above.
- the antibody for labelling (LA) was generated against P-NT 1-19 (H-CSDSEEEMKALEADFLTNMH (SEQ ID NO: 24)) and the solid phase antibody (SPA) was generated against peptide P-NT 44-62 (CNLNSPAEETGEVHEEELVA (SEQ ID NO: 25)).
- the technology used was a sandwich coated tube luminescence immunoassay, based on Acridinium ester labelling.
- RLU relative light units
- Solid phase Polystyrene tubes (Greiner Bio-One International AG, Austria) were coated (18 h at room temperature) with SPA (1.5 ⁇ g SPA/0.3 ml 100 mmol/l NaCl, 50 mmol/l Tris/HCl, pH 7.8). After blocking with 5% bovine serum albumine, the tubes were washed with PBS, pH 7.4 and vakuum dried.
- SPA 1.5 ⁇ g SPA/0.3 ml 100 mmol/l NaCl, 50 mmol/l Tris/HCl, pH 7.8. After blocking with 5% bovine serum albumine, the tubes were washed with PBS, pH 7.4 and vakuum dried.
- the assay was calibrated, using dilutions of Pro-Neurotensin containing human serum.
- a pool of human sera with high Pro-Neurotensin immunoreactivity (InVent Diagostika, Hennigsdorf, Germany) was diluted with horse serum (Biochrom AG, Germany) (assay standards).
- the standards were calibrated by use of the human Pro-Neurotensin-calibrator (ICI-Diagnostics, Berlin, Germany).
- the assay may be calibrated by synthetic or recombinant P-NT 1-117 or fragments thereof (see also Ernst et al., 2006).
- FIG. 4 Illustration example of combined analysis of Pro-Enkephalin for breast cancer prediction:
- Group 2 is a combination of women with 3 nd quartile of Pro-Neurotensin and 2 nd quartile of Pro-Enkephalin plus 2 nd quartile of Pro-Neurotensin and 3th quartile of Pro-Enkephalin. Within that medium risk group about 7.48% of women developed breast cancer within the following 15 years.
- Group 1 is a combination of women with 1 st quartile of Pro-Neurotensin and 4 th quartile of Pro-Enkephalin. Within that low risk group about 3.08% of women developed breast cancer within the following 15 years. The Hazard risk between group 1 and group 3 is about 6.17.
- Pro-Enkephalin also predicts lung cancer in females.
- FIG. 1 shows a typical Pro-Enkephalin dose/signal curve. Standard curve Pro-Enkephalin.
- FIG. 2 frequence distribution of Pro-Enkephalin in the females population:
- FIG. 3 Kaplan Meier graphs, illustrating the cumulative breast cancer diagnosis in women quartile (Q) 1 (below 40.4 pmol/l) quartile 2 (40.4-47.1 pmol/l), quartile 3 (47.2-54.1 pmol/l), quartile 4 (above 54.1 pmol/l).
- Q quartile
- quartile 2 40.4-47.1 pmol/l
- quartile 3 47.2-54.1 pmol/l
- quartile 4 above 54.1 pmol/l.
- Decreased PENK indicates a long term increased risk of breast cancer development. Since any women with cancer history at day of baseline (blood sampling) were excluded, Pro-Enkephalin is highly predictive for future breast cancer development. Over all, women from Q 1 have a 3.6 times higher risk to develop breast cancer than women from Q 4.
- FIG. 4 Illustration example of combined analysis of Pro-Enkephalin for breast cancer prediction:
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Hospice & Palliative Care (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
-
- determining the level of Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin of at least 5 amino acids in a bodily fluid obtained from said female subject; and
- correlating said level of Pro-Enkephalin or fragments thereof with a risk for getting cancer, wherein a reduced level is predictive for an enhanced risk of getting cancer or alternatively diagnosing cancer wherein an reduced level is correlated with the diagnosis of cancer.
Description
- Subject matter of the present invention is a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising:
-
- determining the level of Pro-Enkephalin (PENK) or fragments thereof including Leu-Enkephalin and Met-Enkephalin of at least 5 amino acids in a bodily fluid obtained from said female subject; and
- correlating said level of Pro-Enkephalin or fragments thereof with a risk for getting cancer, wherein a reduced level is predictive for an enhanced risk of getting cancer or alternatively diagnosing cancer wherein an reduced level is correlated with the diagnosis of cancer.
- Met-Enkephalin, a 5 amino acid peptide derived from the Enkephalin precursor (PreProEnkephalin), also named “Opioid Growth Factor” (OGF) is released together with ProEnkephalin-fragments. The mature peptide binds to different opioid receptors (Koneru et al., 2009). Enkephalin (OGF) was found to have a number of physiological functions. In the CNS it down regulates Substance P associated pain signalling, it plays roles as cytokine (Plotnikoff et al., 1997). Proenkephalin related peptides exhibiting antibiotic actions (Goumon et al., 1998). Proenkephalin and Enkephalin exhibits anti tumor action and acting as pro-apoptotic agents (Tavish et al., 2007, Donahue et al., 2011, Zagon et al., 2009).
- The use of vasoactive peptides for prediction of cancer risks in males has been reported by Belting et al., Cancer, Epidemiology, Biomarkes & Prevention. MR-pro-ANP, MR-pro-ADM and copeptin was measured in the fasting plasma from participants of the Malmö Diet and Cancer Study that were free from cancer prior to the baseline exam in 1991 to 1994 (1768 males and 2293 females). The authors stated that among females, there was no relationship between biomarkers and cancer incidence.
- A subject of the present invention was to investigate the prognostic and diagnostic power of PENK for the prediction of cancer incidence and the prediction of the risk of reoccurrence of cancer. To address this issue, stable fragments of Pro-Enkephalin (Ernst et al., 2006) in fasting plasma were measured in said Swedish prospective cohort study (Malmo Diet and Cancer Study) and related baseline level of this biomarker to breast-cancer incidence during 15 years of follow-up.
- Surprisingly, it has been shown that Pro-Enkephalin is a powerful and highly significant biomarker for woman for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject.
- Thus, subject matter of the present invention is a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising:
-
- determining the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject; and
- correlating said level of Pro-Enkephalin or fragments thereof with a risk for getting cancer, wherein an reduced level is predictive for an enhanced risk of getting cancer or alternatively diagnosing cancer wherein an reduced level is correlated with the diagnosis of cancer.
- Examples of cancers may be selected from the group comprising breast cancer, lung cancer, pancreatic cancer and colon cancer.
- Throughout the specification it should be understood that the term fragments of Pro-Enkephalin also include Leu-Enkephalin and Met-Enkephalin.
- In a specific embodiment of the invention said cancer is breast cancer. In another specific embodiment of the invention said cancer is lung cancer.
- Thus, subject matter of the present invention is the determination of susceptibility of a woman to aquire cancer, e.g. breast cancer, lung cancer etc
- Data obtained in the present study revealed also a correlation between the risk of getting cancer in male subjects with the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said male subject; this correlation however, was not that statistically significant for the present data set although there was a clear trend for an increased cancer risk at reduced levels of PENK also in males. Thus, there is a value for the method according to the invention also for male subjects but in the present study the observed effect was not as strong for males as compared to females. This may be primarily due to the low number of cancer incidents in the male population.
- Further, data obtained in the present study revealed also a correlation between the risk of getting cancer in female subjects with the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject, wherein said cancer was not lung cancer or breast cancer. Due to the small number of incidents in this particular population this correlation however, was not that statistically significant for the present data set. Although it was not significant there was a clear trend. It is furthermore credible that the present data suggest such a correlation also in other cancers due to the known proapoptotic effect of Enkephalin, a fragment of PENK. Starting from the prior art it is surprising that Pro-Enkephalin or fragments thereof may be predictive for cancer. Starting from the present data that are statistically highly relevant for breast cancer and lung cancer it is to be expected and credible that it may be prognostic for other types of cancer as well.
- The term “subject” as used herein refers to a living human or non-human organism. Preferably herein the subject is a human subject.
- The term “reduced level” means a level below a certain threshold level.
- A bodily fluid may be selected from the group comprising blood, serum, plasma, urine, cerebro spinal liquid (csf), and saliva.
- In one embodiment of the invention said female subject has never had a diagnosed cancer at the time the sample of bodily fluid is taken from said female subject.
- In another embodiment said female subject has been diagnosed before with having cancer and has been cured at the time the sample of bodily fluid is taken from said female subject and the risk of reoccurrence of getting cancer is determined or alternatively the re-occurrence of cancer is predicted.
- Pro-Enkephalin has the following sequence:
-
(Pro-Enkephalin (1-243) SEQ ID NO. 1 ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKP ELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEE EANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQD GSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWM DYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF - Fragments of Pro-Enkephalin that may be determined in a bodily fluid may be e.g. selected from the group of the following fragments:
-
(Synenkephalin, Pro-Enkephalin 1-73) SEQ ID NO. 2 ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKP ELPQDGTSTLRENSKPEESHLLA (Met-Enkephalin) SEQ ID NO. 3 YGGFM (Leu-Enkephalin) SEQ ID NO. 4 YGGFL (ProEnkephalin 90-109) SEQ ID NO. 5 MDELYPMEPEEEANGSEILA (Pro Enkephalin 119-159, Mid regional Pro- Enkephalin-fragment, MRPENK) SEQ ID NO. 6 DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVS (Met-Enkephalin-Arg-Gly-Leu) SEQ ID NO. 7 YGGFMRGL (Pro-Enkephalin 172-183) SEQ ID NO. 8 SPQLEDEAKELQ (Pro-Enkephalin 193-203) SEQ ID NO. 9 VGRPEWWMDYQ (Pro-Enkephalin 213-234) SEQ ID NO. 10 FAEALPSDEEGESYSKEVPEME (Pro-Enkephalin 213-241) SEQ ID NO. 11 FAEALPSDEEGESYSKEVPEMEKRYGGFM (Met-Enkephalin-Arg-Phe) SEQ ID NO. 12 YGGFMRF - Determining the level of Pro-Enkephalin including Leu-Enkephalin and Met-Enkephalin or fragments thereof may mean that the immunoreactivity towards Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin is determined. A binder used for determination of Pro-Enkephalin including Leu-Enkephalin and Met-Enkephalin or fragments thereof depending of the region of binding may bind to more than one of the above displayed molecules. This is clear to a person skilled in the art.
- Thus, according to the present invention the level of immunoreactive analyte by using at least one binder that binds to a region within the amino acid sequence of any of the above peptide and peptide fragments, (i.e. Pro-Enkephalin (PENK) and fragments according to any of the
sequences 1 to 12), is determined in a bodily fluid obtained from said subject; and correlated to the specific embodiments of clinical relevance. - In a more specific embodiment of the method according to the present invention the level of MRPENK is determined (SEQ ID NO. 6: Pro-Enkephalin 119-159, Mid regional Pro-Enkephalin-fragment, MRPENK). In a more specific embodiment the level of immunoreactive analyte by using at least one binder that binds to MR-PENK is determined and is correlated to the specific embodiments of clinical relevance according to the invention.
- Determining the level of Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin or fragments thereof may mean that the immunoreactivity towards Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin is determined. A binder used for determination of Pro-Enkephalin including Leu-Enkephalin and Met-Enkephalin or fragments thereof depending of the region of binding may bind to more than one of the above displayed molecules. This is clear to a person skilled in the art. In another embodiment of the invention the fragment is not Leu-Enkephalin or Met-Enkephalin, In another embodiment of the invention the immunoreactivity towards Pro-Enkephalin or fragments thereof not including Leu-Enkephalin and Met-Enkephalin is determined.
- In a more specific embodiment of the method according to the present invention the level of MRPENK. (SEQ ID NO. 6 (Pro Enkephalin 119-159, Mid regional Pro-Enkephalin-fragment, MRPENK, DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVS) is determined.
- Alternatively the level of any of the above analytes may be determined by other analytical methods e.g. mass spectroscopy.
- In a specific embodiment the level of Pro-Enkephalin or fragments thereof are measured with an immunoassay using antibodies or fragments of antibodies binding to Pro-Enkephalin or fragments thereof. An immunoassay that may be useful for determining the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids may comprise the steps as outlined in Example 2. All thresholds and values have to be seen in correlation to the test and the calibration used according to Example 2. A person skilled in the art may know that the absolute value of a threshold might be influenced by the calibration used. This means that all values and thresholds given herein are to be understood in context of the calibration used in herein (Example 2).
- According to the invention the diagnostic binder to Pro-Enkephalin is selected from the group consisting of antibodies e.g. IgG, a typical full-length immunoglobulin, or antibody fragments containing at least the F-variable domain of heavy and/or light chain as e.g. chemically coupled antibodies (fragment antigen binding) including but not limited to Fab-fragments including Fab minibodies, single chain Fab antibody, monovalent Fab antibody with epitope tags, e.g. Fab-V5Sx2; bivalent Fab (mini-antibody) dimerized with the CH3 domain; bivalent Fab or multivalent Fab, e.g. formed via multimerization with the aid of a heterologous domain, e.g. via dimerization of dHLX domains, e.g. Fab-dHLX-FSx2; F(ab′)2-fragments, scFv-fragments, multimerized multivalent or/and multispecific scFv-fragments, bivalent and/or bispecific diabodies, BITE® (bispecific T-cell engager), trifunctional antibodies, polyvalent antibodies, e.g. from a different class than G; single-domain antibodies, e.g. nanobodies derived from camelid or fish immunoglobulines.
- In a specific embodiment the level of Pro-Enkephalin or fragments thereof are measured with an assay using binders selected from the group comprising aptamers, non-Ig scaffolds as described in greater detail below binding to Pro-Enkephalin or fragments thereof.
- Binder that may be used for determining the level of Pro-Enkephalin or fragments thereof exhibit an affinity constant to Pro-Enkephalin of at least 107 M−1, preferred 108 M−1, preferred affinity constant is greater than 109 M−1, most preferred greater than 1010 M−1. A person skilled in the art knows that it may be considered to compensate lower affinity by applying a higher dose of compounds and this measure would not lead out-of-the-scope of the invention. Binding affinity may be determined using the Biacore method, offered as service analysis e.g. at Biaffin, Kassel, Germany (http://www.biaffin.com/de/).
- A human Pro-Enkephalin-control sample is available by ICI-Diagnostics, Berlin, Germany http://www.ici-diagnostics.com/. The assay may also be calibrated by synthetic (for our experiments we used synthetic MRPENK, SEQ ID NO. 6) or recombinant Pro-Enkephalin or fragments thereof.
- The threshold for determining the risk of getting breast cancer in a female subject or diagnosing breast cancer in a female subject according to the methods of the present invention is below 100 pmol/l PENK, preferred below 50 pmol/l, more preferred below 40.4 pmol/l. In a specific embodiment said threshold is about 40.4 pmol/l. These thresholds are related to the above mentioned calibration method. A PENK value below said threshold means that the subject has an enhanced risk of getting cancer or has already cancer.
- In one embodiment of the invention said method is performed more than once in order to monitor the risk of getting breast cancer in a female subject or in order to monitor the course of treatment. In one specific embodiment said monitoring is performed in order to evaluate the response of said female subject to preventive and/or therapeutic measures taken.
- In one embodiment of the invention the method is used in order to stratify said female subjects into risk groups.
- Subject of the present invention is also a method for predicting the risk of getting cancer in a female or identifying a female subject having an enhanced risk for getting cancer according to any of the preceding embodiments, wherein the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject either alone or in conjunction with other prognostically useful laboratory or clinical parameters is used for the prediction of a subject's risk for getting an adverse event by a method which may be selected from the following alternatives:
-
- Comparison with the median of the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject in an ensemble of pre-determined samples in a population of “healthy” or “apparently healthy” subjects,
- Comparison with a quantile of the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject in an ensemble of pre-determined samples in a population of “healthy” or “apparently healthy” subjects,
- Calculation based on Cox Proportional Hazards analysis or by using Risk index calculations such as the NRI (Net Reclassification Index) or the IDI (Integrated Discrimination Index).
- In one embodiment of the invention subject of the present invention is also a method for predicting the risk of getting cancer in a female or identifying a female subject having an enhanced risk for getting cancer according to any of the preceding embodiments, wherein the level of Pro-Enkephalin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject either alone or in conjunction with other prognostically useful biomarker. Such a useful biomarker may be Pro-Neurotensin and fragments thereof of at least 5 amino acids.
- In a more specific embodiment of the method according to the present invention the level of Pro-Neurotensin 1-117 is determined in addition to the determination of Pro-Enkephalin an fragments thereof.
- Thus, subject matter of the present invention is also a method for predicting the risk of getting cancer in a female subject that does not suffer from cancer or alternatively diagnosing cancer in a female subject comprising:
-
- determining the level of Pro-Enkephalin or fragments thereof including Leu-Enkephalin and Met-Enkephalin of at least 5 amino acids in a bodily fluid obtained from said female subject; and
- determining the level of Pro-Neurotensin or fragments thereof of at least 5 amino acids in a bodily fluid obtained from said female subject; and
- correlating said level of Pro-Enkephalin or fragments thereof and Pro-Neurotensin or fragments thereof of at least 5 amino acids with a risk for getting cancer, wherein an reduced level of Pro-Enkephalin is predictive for an enhanced risk of getting cancer or alternatively diagnosing cancer wherein an reduced level is correlated with the diagnosis of cancer and wherein an increased level of Pro-Neurotensin is predictive for an enhanced risk of getting cancer or alternatively diagnosing cancer wherein an increased level is correlated with the diagnosis of cancer.
-
(Pro-Neurotensin 1-147) SEQ ID NO. 13 SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVIKRK IPYILKRQLY ENKPRRPYIL KRDSYYY (Pro-Neurotensin 1-125 (large neuromedin N)) SEQ ID NO. 14 SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVIKR KIPYIL (neuromedin N) SEQ ID NO. 15 KIPYIL (neurotensin) SEQ ID NO. 16 pyroQLYENKPRRP YIL (Pro-Neurotensin 1-117) SEQ ID NO. 17 SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVI (Pro-Neurotensin 1-132) SEQ ID NO. 18 SDSEEEMKAL EADFLTNMHT SKISKAHVPS WKMTLLNVCS LVNNLNSPAE ETGEVHEEEL VARRKLPTAL DGFSLEAMLT IYQLHKICHS RAFQHWELIQ EDILDTGNDK NGKEEVIKRK IPYILKRQLY EN (Pro-Neurotensin 120-140) SEQ ID NO. 19 KIPYILKRQL YENKPRRPYI L (Pro-Neurotensin 120-147) SEQ ID NO. 20 KIPYILKRQL YENKPRRPYIL KRDSYYY (Pro-Neurotensin 128-147) SEQ ID NO. 21 QLYENKPRRP YILKRDSYYY - In a specific embodiment the level of Pro-Neurotensin is measured with an immunoassay. More specifically an immunoassay is used as described in Ernst et al. (Peptides (2006), (27) 1787-1793). An immunoassay that may be useful for determining the level of Pro-Neurotensin or fragments thereof of at least 5 amino acids may comprise the steps as outlined in Example 2. All thresholds and values have to be seen in correlation to the test and the calibration used according to Example 2. A person skilled in the art may know that the absolute value of a threshold might be influenced by the calibration used. This means that all values and thresholds given herein are to be understood in context of the calibration used in herein (Example 2). A human Pro-Neurotensin-calibrator is available by ICI-Diagnostics, Berlin, Germany. Alternatively, the assay may also be calibrated by synthetic or recombinant P-NT 1-117 or fragments thereof (see also Ernst et al, 2006).
- Binder that may be used for determining the level of Pro-Neurotensin or fragments thereof exhibit an affinity constant to Pro-Neurotensin of at least 107 M−1, preferred 108 M−1, preferred affinity constant is greater than 109 M−1, most preferred greater than 1010 M−1. A person skilled in the art knows that it may be considered to compensate lower affinity by applying a higher dose of compounds and this measure would not lead out-of-the-scope of the invention. Binding affinity may be determined using the Biacore method, offered as service analysis e.g. at Biaffin, Kassel, Germany (http://www.biaffin.com/de/).The threshold for determining the risk of getting breast cancer in a female subject or diagnosing breast cancer in a female subject according to the methods of the present invention is above 78 pmol/l PNT, preferred 100 pmol/l, more preferred 150 pmol/l. In a specific embodiment said threshold is about 100 pmol/l. These thresholds are related to the above mentioned calibration method. A P-NT value above said threshold means that the subject has an enhanced risk of getting cancer or has already cancer.
- In one embodiment of the invention said method is performed more than once in order to monitor the risk of getting breast cancer in a female subject or in order to monitor the course of treatment. In one specific embodiment said monitoring is performed in order to evaluate the response of said female subject to preventive and/or therapeutic measures taken.
- In one embodiment of the invention the method is used in order to stratify said female subjects into risk groups.
- In one embodiment of the invention the cancer is selected from the group comprising breast cancer, and lung cancer.
- Subject matter of the invention is further an assay for determining Pro-Enkephalin and Pro-Enkephalin fragments in a sample comprising two binders that bind to two different regions within the region of Pro-Enkephalin that is aminoacid 133-140 (LKELLETG, SEQ ID NO. 22) and aminoacid 152-159 (SDNEEEVS, SEQ ID NO. 23) wherein each of said regions comprises at least 4 or 5 amino acids.
- In one embodiment of the assays for determining Pro-Enkephalin or Pro-Enkephalin fragments in a sample according to the present invention the assay sensitivity of said assay is able to quantify the Pro-Enkephalin or Pro-Enkephalin fragments of healthy subjects and is <15 pmol/, preferably <10 pmol/l and more preferably L<6 pmol/L.
- In one embodiment of the assays for determining Pro-Enkephalin or Pro-Enkephalin fragments in a sample according to the present invention said binder exhibits an binding affinity to its binding partner of at least 107 M−1, preferred 108 M−1, preferred affinity constant is lower than 109 M−1, most preferred lower than 1010 M−1. A person skilled [K1] in the art knows that it may be considered to compensate lower affinity by applying a higher dose of compounds and this measure would not lead out-of-the-scope of the invention binding affinity may be determined as described above.
- In one embodiment of the assays for determining Pro-Enkephalin or Pro-Enkephalin fragments in a sample according to the present invention such assay is a sandwich assay, preferably a fully automated assay. It may be an ELISA fully automated or manual. It may be a so-called POC-test (point-of-care). Examples of automated or fully automated assay comprise assays that may be used for one of the following systems: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, Biomerieux Vidas®, Alere Triage®. Examples of test formats are provided above.
- In one embodiment of the assays for determining Pro-Enkephalin or Pro-Enkephalin fragments in a sample according to the present invention at least one of said two binders is labeled in order to be detected. Examples of labels are provided above.
- In one embodiment of the assays for determining Pro-Enkephalin or Pro-Enkephalin fragments in a sample according to the present invention at least one of said two binders is bound to a solid phase. Examples of solid phases are provided above.
- In one embodiment of the assays for determining Pro-Enkephalin or Pro-Enkephalin fragments in a sample according to the present invention said label is selected from the group comprising chemiluminescent label, enzyme label, fluorescence label, radioiodine label.
- A further subject of the present invention is a kit comprising an assay according to the present invention wherein the components of said assay may be comprised in one or more container.
- Development of Antibodies
- Peptides
- Peptides were synthesized (JPT Technologies, Berlin, Germany).
- Peptides/Conjugates for Immunization:
- Peptides for immunization were synthesized (JPT Technologies, Berlin, Germany) with an additional N-terminal Cystein residue for conjugation of the peptides to bovine serum albumin (BSA). The peptides were covalently linked to BSA by using Sulfo-SMCC (Perbio-science, Bonn, Germany). The coupling procedure was performed according to the manual of Perbio.
-
TABLE 1 Peptide for immunization Pro-Enkephalin sequence (C)DAEEDD 119-125 (C)EEDDSLANSSDLLK 121-134 (C)LKELLETG 133-140 (C)TGDNRERSHHQDGSDNE 139-155 (C)SDNEEEVS 152-159 - The antibodies were generated according to the following method:
- A BALB/c mouse was immunized with 100 μg peptide-BSA-conjugate at
day 0 and 14 (emulsified in 100 μl complete Freund's adjuvant) and 50 μg at day 21 and 28 (in 100 μl incomplete Freund's adjuvant). Three days before the fusion experiment was performed, the animal received 50 μg of the conjugate dissolved in 100 μl saline, given as one intraperitonal and one intravenous injection. - Spenocytes from the immunized mouse and cells of the myeloma cell line SP2/0 were fused with 1 ml 50% polyethylene glycol for 30 s at 37° C. After washing, the cells were seeded in 96-well cell culture plates. Hybrid clones were selected by growing in HAT medium [RPMI 1640 culture medium supplemented with 20% fetal calf serum and HAT-supplement]. After two weeks the HAT medium is replaced with HT Medium for three passages followed by returning to the normal cell culture medium.
- The cell culture supernatants were primary screened for antigen specific IgG antibodies three weeks after fusion. The positive tested microcultures were transferred into 24-well plates for propagation. After retesting the selected cultures were cloned and recloned using the limiting-dilution technique and the isotypes were determined.
- (Lane, R. D. “A short-duration polyethylene glycol fusiontechnique for increasing production of monoclonal antibody-secreting hybridomas”, J. Immunol. Meth. 81: 223-228; (1985), Ziegler, B. et al. “Glutamate decarboxylase (GAD) is not detectable on the surface of rat islet cells examined by cytofluorometry and complement-dependent antibody-mediated cytotoxicity of monoclonal GAD antibodies”, Horm. Metab. Res. 28: 11-15, (1996)).
- Monoclonal Antibody Production
- Antibodies were produced via standard antibody production methods (Marx et al., Monoclonal Antibody Production (1997), ATLA 25, 121) and purified via Protein A-chromatography. The antibody purities were >95% based on SDS gel electrophoresis analysis.
- Labelling and Coating of Antibodies.
- All antibodies were labelled with acridinium ester according the following procedure:
- Labelled compound (tracer): 100 μg (100 μl) antibody (1 mg/ml in PBS, pH 7.4, was mixed with 10 μl Acridinium NHS-ester (1 mg/ml in acetonitrile, InVent GmbH, Germany) (EP 0353971) and incubated for 20 min at room temperature. Labelled antibody was purified by gel-filtration HPLC on Bio-Sil SEC 400-5 (Bio-Rad Laboratories, Inc., USA) The purified labelled antibody was diluted in (300 mmol/l potassiumphosphate, 100 mmol/l NaCl, 10 mmol/l Na-EDTA, 5 g/l bovine serum albumin, pH 7.0). The final concentration was approx. 800.000 relative light units (RLU) of labelled compound (approx. 20 ng labeled antibody) per 200 μl. Acridiniumester chemiluminescence was measured by using an AutoLumat LB 953 (Berthold Technologies GmbH & Co. KG).
- Solid Phase Antibody (Coated Antibody):
- Solid phase: Polystyrene tubes (Greiner Bio-One International AG, Austria) were coated (18 h at room temperature) with antibody (1.5 μg antibody/0.3
ml 100 mmol/l NaCl, 50 mmol/l Tris/HCl, pH 7.8). After blocking with 5% bovine serum albumine, the tubes were washed with PBS, pH 7.4 and vacuum dried. - Antibody Specificity:
- The crossreactivities of the different antibodies are listed in table 2.
-
TABLE 2 Pre-Pro- Peptide for Enkephalin- Antibody immunization sequence name (C)DAEEDD 119-125 NT-MRPENK (C)EEDDSLANSSDLLK 121-134 NM-MRPENK (C)LKELLETG 133-140 MR-MRPENK (C)TGDNRERSHHQDGSDNE 139-155 MC-MRPENK (C)SDNEEEVS 152-159 CT-MRPENK - Antibody cross-reactivities were determined as follows:
- 1 ug peptide in 300 μl PBS, pH 7.4 was pipetted into Polystyrene tubes and incubated for 1 h at room temperature. After incubation the tubes were washed 5 times (each 1 ml) using 5% BSA in PBS, pH 7.4. Each of the labelled antibodies were added (300 μl in PBS, pH 7.4, 800.000 RLU/300 μl) an incubated for 2h at room temperature. After washing 5 times (each 1 ml of washing solution (20 mmol/l PBS, pH 7.4, 0.1% Triton X 100), the remaining luminescence (labelled antibody) was quantified using the AutoLumat LB 953. MRPENK-peptide was used as reference substance (100%).
-
TABLE 3 MRPENK antibody EEDDSLANSSD TGDNRERSH (SEQ ID peptide DAEEDD LLK LKELLETG HQDGSDNE SDNEEEVS NO. 6) NT- 121 10 <1 <1 <1 100 MRPENK NM- <1 98 <1 <1 <1 100 MRPENK MR- <1 <1 105 <1 <1 100 MRPENK MC- <1 <1 <1 115 <1 100 MRPENK CT- <1 <1 <1 <1 95 100 MRPENK - All antibodies bound the MRPENK peptide, compareable to the peptides which were used for immunization. Except for NT-MRPENK-antibody (10% cross reaction with EEDDSLANSSDLLK) no antibody showed a cross reaction with MR-PENK peptides not used for immunization of the antibody.
- Pro-Enkephalin Immunoassay:
- 50 μl of sample (or calibrator) was pipetted into coated tubes, after adding labeled antibody (200 ul), the tubes were incubated for 2 h at 18-25° C. Unbound tracer was removed by washing 5 times (each 1 ml) with washing solution (20 mmol/l PBS, pH 7.4, 0.1% Triton X-100). Tube-bound labelled antibody was measured by using the Luminumeter LB 953 and a fixed concentration of 1000 pmol/l of MRPENK. The signal (RLU at 1000 pmol MRPENK/l) to noise (RLU without MRPENK) ratio of different antibody combinations is given in table 4. All antibodies were able to generate a sandwich complex with any other antibody. Surprisingly, the strongest signal to noise ratio (best sensitivity) was generated by combining the MR-MRPENK- and CT-MRPENK antibody. Subsequently, we used this antibody combination to perform the MRPENK-immunoassay for further investigations. MR-MRPENK antibody was used as coated tube antibody and CT-MRPENK antibody was used as labelled antibody.
-
TABLE 4 Solid Labelled phase NT- NM- MR- CT- antibody antibody MRPENK MRPENK MRPENK MC-MRPENK MRPENK NT- / 27 212 232 <1 MRPENK NM- 36 / 451 487 <1 MRPENK MR- 175 306 / 536 1050 MRPENK MC- 329 577 542 / <1 MRPENK CT- <1 615 1117 516 / MRPENK - Calibration:
- The assay was calibrated, using dilutions of synthetic MRPENK, diluted in 20 mM K2PO4, 6 mM EDTA, 0.5% BSA, 50 μM Amastatin, 100 μM Leupeptin, pH 8.0. Pro-Enkephalin control plasma is available at ICI-diagnostics, Berlin, Germany.
-
FIG. 1 shows a typical Pro-Enkephalin dose/signal curve. Standard curve Pro-Enkephalin. - The assay sensitivity was 20 determinations of 0-calibrator (no addition of MRPENK)+2 SD) 5.5 pmol/L.
- Population Study
- Methods
- We measured Pro-Enkephalin in fasting plasma from 2559 female participants of the population based Malmo Diet and Cancer Study baseline exam in 1991-1994 (age 58±6 years and 59% females). We used multivariable adjusted (all traditional cardiovascular risk factors, diabetes risk factors and in analyses of cancer also heredity for cancer) Cox proportional hazards models to relate baseline PENK (hazard ratio per each standard deviation increase of log-transformed PENK) to the time to the first event of each of the studied endpoints during a median follow-up time of more than 12 years. Endpoints were retrieved through the Swedish National Hospital Discharge Registry, the Swedish Myocardial Infarction Registry, the Stroke in Malmö Registry and the Swedish Cancer Registry. Retrieval of endpoints through these registries has been validated and found to be accurate (see also Belting et al. Cancer Epidemiol Biomarkers Prey; 1-10. 2012 AACR).
- Clinical Characteristics of Females in the Study
-
TABLE 5 Descriptive Statistics N Mean Std. Deviation Age at MDCS screening 2559 57.554 5.9403 Systolic blood pressure (mmHg) 2559 140.50 19.311 Diastolic blood pressure (mmHg) 2559 85.65 9.117 body-mass-index (weight/kg × kg) 2559 25.5196 4.19083 WAIST (cm) 2559 76.99 10.245 Glucose (mmol/l) 2559 5.0418 1.21798 Triglycerides (mmol/l) 2559 1.2245 .58404 High density lipoprotein (mmol/l) 2559 1.5123 .36949 Low density lipoprotein (mmol/l) 2559 4.2016 1.04762 P-INSULIN 2512 7.223 5.4223 -
FIG. 2 : frequence distribution of Pro Enkephalin in the females population: - The mean value was 47.2 pmol/L, standard deviation=1.2 pmol/L. The x axis is the Logarithmus Naturalis (LN) of the PENK concentration. All results were within the measurement of the assay, the lowest PENK concentration was 9 pmol/L. These results indicating the suitability of the used assay (assay sensitivity 5.5 pmol/L).
- PENK and Prediction of Breast Cancer
- We assessed the relationship between Pro-Enkephalin and breast cancer (Table 6). There was a strong relationship between Pro-Enkephalin and breast cancer in females. In a fully adjusted model each SD increase of Pro-Enkephalin was associated with a 28.6% risk reduction or each SD of decrease of Pro-Enkephalin (revPENK) was associated with a 40% increased risk of future breast cancer (table 5) and the top versus bottom quartile of Pro-Enkephalin identified a more than 3-fold difference in risk of breast cancer (see table 7 and
FIG. 3 ). -
TABLE 6 Variables in the EquationD 95.0% CI for Exp(B) B SE Wald df Sig. Exp(B) Lower Upper AGE .007 .016 .228 1 .633 1.007 .977 1.039 SEX 0a BMI_B .026 .025 1.139 1 .286 1.027 .978 1.077 DM_B −.242 .407 .352 1 .553 .785 .354 1.744 HDL_B .044 .252 .031 1 .860 1.045 .638 1.714 LDL_B −.001 .090 .000 1 .988 .999 .837 1.191 current_smoker .330 .195 2.886 1 .089 1.392 .950 2.037 HER_CANCER_0 .034 .176 .038 1 .846 1.035 .733 1.461 LNINS −.288 .197 2.127 1 .145 .750 .509 1.104 ZscoreLNPENK— −.337 .082 16.858 1 .000 .714 .608 .839 females_noCa -
TABLE 7 BREAST CANCER HR per P- Quar- Quar- Quar- Quar- P for 1 SD value tile 4 tile 3tile 2tile 1trend Women 1.40 <0.001 1.0 1.50 2.7 3.6 <0.001 (2140/ (13- (ref) (0.81- (1.7- (2.7- 135) 1.6) 2.1) 3.4) 4.9) Multivariate Cox proportional Hazards models for baseline Pro-Enkephalin versus incidence of breast cancer. -
FIG. 3 : Kaplan Meier graphs, illustrating the cumulative breast cancer diagnosis in women Quartile (Q) 1 (below 40.4 pmol/l) quartile 2 (40.4-47.1 pmol/l), quartile 3 (47.2-54.1 pmol/l), quartile 4 (above 54.1 pmol/l). Decreased PENK indicates a long term increased risk of breast cancer development. Since any women with cancer history at day of baseline (blood sampling) were excluded, Pro-Enkephalin is highly predictive for future breast cancer development. Over all, women fromQ 1 have a 3.6 times higher risk to develop breast cancer than women fromQ 4. - Combination Pro Enkephalin and Pro Neurotensin
- Since increasing Pro-Neurotensin recently was shown to be highly predictive for breast cancer, we combined both biomarkers for breast cancer prediction.
- Pro-Neurotensin Assay
- Antibodies were generated as described above. The antibody for labelling (LA) was generated against P-NT 1-19 (H-CSDSEEEMKALEADFLTNMH (SEQ ID NO: 24)) and the solid phase antibody (SPA) was generated against peptide P-NT 44-62 (CNLNSPAEETGEVHEEELVA (SEQ ID NO: 25)).
- Immunoassay for the Quantification of Human Pro-Neurotensin
- The technology used was a sandwich coated tube luminescence immunoassay, based on Acridinium ester labelling.
- Labelled compound (tracer): 100 μg (100 μl) LA (1 mg/ml in PBS, pH 7.4, was mixed with 10 μl Acridinium NHS-ester (1 mg/ml in acetonitrile, InVent GmbH, Germany) (EP 0353971) and incubated for 20 min at room temperature. Labelled LA was purified by gel-filtration HPLC on Bio-Sil SEC 400-5 (Bio-Rad Laboratories, Inc., USA) The purified LA was diluted in (300 mmol/l potassiumphosphate, 100 mmol/l NaCl, 10 mmol/l Na-EDTA, 5 g/l bovine serum albumin, pH 7.0). The final concentration was approx. 800.000 relative light units (RLU) of labelled compound (approx. 20 ng labeled antibody) per 200 μl. Acridiniumester chemiluminescence was measured by using an AutoLumat LB 953 (Berthold Technologies GmbH & Co. KG).
- Solid phase: Polystyrene tubes (Greiner Bio-One International AG, Austria) were coated (18 h at room temperature) with SPA (1.5 μg SPA/0.3
ml 100 mmol/l NaCl, 50 mmol/l Tris/HCl, pH 7.8). After blocking with 5% bovine serum albumine, the tubes were washed with PBS, pH 7.4 and vakuum dried. - Calibration:
- The assay was calibrated, using dilutions of Pro-Neurotensin containing human serum. A pool of human sera with high Pro-Neurotensin immunoreactivity (InVent Diagostika, Hennigsdorf, Germany) was diluted with horse serum (Biochrom AG, Deutschland) (assay standards).
- The standards were calibrated by use of the human Pro-Neurotensin-calibrator (ICI-Diagnostics, Berlin, Germany). Alternatively, the assay may be calibrated by synthetic or recombinant P-NT 1-117 or fragments thereof (see also Ernst et al., 2006).
- ProNT Immunoassay:
- 50 μl of sample (or calibrator) was pipetted into SPA coated tubes, after adding labeleld LA (200 ul), the tubes were incubated for 16-22 h at 18-25° C. Unbound tracer was removed by washing 5 times (each 1 ml) with washing solution (20 mmol/l PBS, pH 7.4, 0.1% Triton X-100). Tube-bound LA was measured by using the Luminumeter LB 953. Results were calculated from the calibration curve.
- Combined analysis of Pro-Enkephalin and PNT in the Female Population:
- There was no significant correlation between Pro-Enkephalin and Pro-Neurotensin (p=0.56). In a combined model using both biomarkers, we found them both independent in breast cancer prediction.
- In a fully adjusted model each SD increase of PNT was associated with a 49.9% risk increase of future breast cancer. Surprisingly, after adding PNT to the equation, PENK was even stronger than without PNT and showed for each SD increase of Pro-Enkephalin a 30.8% risk reduction or each SD of decrease of Pro-Enkephalin (revPENK) was associated with a 44.5% increased risk of future breast cancer (table 8).
-
TABLE 8 Table 8: combined analysis of PNT and PENK for breast cancer prediction. Variables in the Equation 95.0% CI for Exp(B) B SE Wald df Sig. Exp(B) Lower Upper AGE −.003 .019 .020 1 .888 .997 .960 1.036 current_smoker0 .434 .204 4.505 1 .034 1.543 1.034 2.304 BMI_B .001 .027 .001 1 .979 1.001 .948 1.056 GFR_CG_BSAcorr −.005 .008 .357 1 .550 .995 .979 1.011 hrt_curr .730 .201 13.146 1 .000 2.075 1.399 3.079 PNT .405 .091 19.731 1 .000 1.499 1.254 1.793 PENK −.368 .088 17.416 1 .000 .692 .582 .823 - Highest vs. lowest quartile PNT indicated a 2.56 fold risk for breast cancer development and Pro Enkephalin on top of PNT lowest vs highest quartile (rev=reversed quartiles Q1=Q4, Q2=Q3, Q3=Q2, Q4=Q1)) an independent 3.6 fold risk (table 9).
- Combining highest quartile of PNT and lowest Pro-Enkephalin quartile vs. lowest PNT- and highest Pro -Enkephalin quartile showed a combined risk of 6.17 (see
FIG. 3 ). -
TABLE 9 Table 9: combined analysis of PNT and PENK for breast cancer prediction. Variables in the Equation 95.0% CI B SE Wald df Sig. Exp(B) Lower AGE −.022 .018 1.468 1 .226 .978 .943 current_smoker0 .391 .200 3.808 1 .051 1.478 .998 hrt_curr .652 .195 11.145 1 .001 1.920 1.309 BMI_B .012 .025 .247 1 .619 1.012 .964 GFR_CG_BSAcorr −.012 .008 2.279 1 .131 .988 .972 NLN_PNT 13.898 3 .003 NLN_PNT(1) .353 .301 1.378 1 .241 1.424 .789 NLN_PNT(2) .604 .286 4.452 1 .035 1.830 1.044 NLN_PNT(3) .942 .269 12.260 1 .000 2.566 1.514 Q_PENK_rev 23.361 3 .000 Q_PENK_rev(1) .410 .331 1.534 1 .215 1.507 .787 Q_PENK_rev(2) .979 .305 10.299 1 .001 2.663 1.464 Q_PENK_rev(3) 1.284 .300 18.315 1 .000 3.610 2.005 -
FIG. 4 : Illustration example of combined analysis of Pro-Enkephalin for breast cancer prediction: - We combined the women with lowest Pro-Enkephalin (1st) quartile and highest (4th) Pro-Neurotensin quartile (group 3). Within that high risk group about 19.02% of women developed breast cancer within the following 15 years.
-
Group 2 is a combination of women with 3nd quartile of Pro-Neurotensin and 2nd quartile ofPro-Enkephalin plus 2nd quartile of Pro-Neurotensin and 3th quartile of Pro-Enkephalin. Within that medium risk group about 7.48% of women developed breast cancer within the following 15 years. -
Group 1 is a combination of women with 1st quartile of Pro-Neurotensin and 4th quartile of Pro-Enkephalin. Within that low risk group about 3.08% of women developed breast cancer within the following 15 years. The Hazard risk betweengroup 1 andgroup 3 is about 6.17. - Lung Cancer
- Pro-Enkephalin also predicts lung cancer in females.
- 40 women developed lung cancer during the observation period. Pro-Enkephalin is not different in smoking and not smoking women (p=0.44). As expected, smoking is a strong risk prediction marker for lung cancer (p<0.0001). Surprisingly, although smoking is part of the equation, low Pro-Enkephalin indicated a 3.2 fold risk of developing lung cancer (table 10 a and 10 b).
- Table 10 a and 10 b: PENK in the prediction of lung cancer in females. The women were grouped in tertiles (see table 10 a) and than analyzed for lung cancer development (see table 10 b). rev=highest tertile (tertile 3), rev (1)=
tertile 2 and rev(2)=lowest tertile (tertile 1). -
TABLE 10a PENK [pmol/L] Percentile Group of PENKpmolL Median Minimum Maximum 1 37,80000 9,000 42,800 2 47,20000 42,900 51,300 3 58,30000 51,400 518,100 Total 47,25000 9,000 518,100 -
TABLE 10 b Variables in the Equation B SE Wald df Sig. Exp(B) AGE .045 .040 1.251 1 .263 1.046 current_smoker0 1.897 .427 19.761 1 .000 6.667 BMI_B −.034 .063 .287 1 .592 .967 GFR_CG_BSAcorr −.024 .019 1.592 1 .207 .976 T_PENK_females_rev 6.698 2 .035 T_PENK_females_rev(1) .208 .580 .128 1 .721 1.231 T_PENK_females_rev(2) 1.168 .511 5.220 1 .022 3.214 -
FIG. 1 : shows a typical Pro-Enkephalin dose/signal curve. Standard curve Pro-Enkephalin. -
FIG. 2 : frequence distribution of Pro-Enkephalin in the females population: -
FIG. 3 : Kaplan Meier graphs, illustrating the cumulative breast cancer diagnosis in women quartile (Q) 1 (below 40.4 pmol/l) quartile 2 (40.4-47.1 pmol/l), quartile 3 (47.2-54.1 pmol/l), quartile 4 (above 54.1 pmol/l). Decreased PENK indicates a long term increased risk of breast cancer development. Since any women with cancer history at day of baseline (blood sampling) were excluded, Pro-Enkephalin is highly predictive for future breast cancer development. Over all, women fromQ 1 have a 3.6 times higher risk to develop breast cancer than women fromQ 4. -
FIG. 4 : Illustration example of combined analysis of Pro-Enkephalin for breast cancer prediction:
Claims (34)
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US15/641,436 US20170307618A1 (en) | 2012-10-02 | 2017-07-05 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
US17/955,765 US20230147663A1 (en) | 2012-10-02 | 2022-09-29 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP12187050 | 2012-10-02 | ||
EP12187050.5 | 2012-10-02 | ||
PCT/EP2013/070471 WO2014053502A1 (en) | 2012-10-02 | 2013-10-01 | A method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
US14/432,808 US9702876B2 (en) | 2012-10-02 | 2013-10-01 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
US15/641,436 US20170307618A1 (en) | 2012-10-02 | 2017-07-05 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/432,808 Continuation US9702876B2 (en) | 2012-10-02 | 2013-10-01 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
PCT/EP2013/070471 Continuation WO2014053502A1 (en) | 2012-10-02 | 2013-10-01 | A method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/955,765 Continuation US20230147663A1 (en) | 2012-10-02 | 2022-09-29 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Publications (1)
Publication Number | Publication Date |
---|---|
US20170307618A1 true US20170307618A1 (en) | 2017-10-26 |
Family
ID=46940411
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/432,808 Active US9702876B2 (en) | 2012-10-02 | 2013-10-01 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
US15/641,436 Pending US20170307618A1 (en) | 2012-10-02 | 2017-07-05 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
US17/955,765 Pending US20230147663A1 (en) | 2012-10-02 | 2022-09-29 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/432,808 Active US9702876B2 (en) | 2012-10-02 | 2013-10-01 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US17/955,765 Pending US20230147663A1 (en) | 2012-10-02 | 2022-09-29 | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject |
Country Status (12)
Country | Link |
---|---|
US (3) | US9702876B2 (en) |
EP (1) | EP2904398B1 (en) |
JP (1) | JP6392762B2 (en) |
CN (2) | CN104781672B (en) |
CA (1) | CA2886814C (en) |
DK (1) | DK2904398T3 (en) |
ES (1) | ES2676737T3 (en) |
HK (1) | HK1212762A1 (en) |
PL (1) | PL2904398T3 (en) |
RU (3) | RU2707755C2 (en) |
TR (1) | TR201809183T4 (en) |
WO (1) | WO2014053502A1 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
TR201901828T4 (en) * | 2013-01-08 | 2019-03-21 | Sphingotec Gmbh | A method for predicting the risk of getting cancer or being diagnosed with cancer in a person. |
US20160097781A1 (en) * | 2014-10-01 | 2016-04-07 | Sphingotec Gmbh | Method for stratifying a female subject for hormone replacement therapy |
RU2021107639A (en) * | 2015-02-27 | 2021-04-22 | Сфинготек Гмбх | METHOD FOR PREDICTING THE RISK OF OBESITY DEVELOPMENT IN A SUBJECT |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030109420A1 (en) * | 2001-05-04 | 2003-06-12 | Biosite, Inc. | Diagnostic markers of acute coronary syndrome and methods of use thereof |
US7713705B2 (en) * | 2002-12-24 | 2010-05-11 | Biosite, Inc. | Markers for differential diagnosis and methods of use thereof |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU634716B2 (en) | 1988-08-01 | 1993-03-04 | Ciba Corning Diagnostics Corp. | Method for detection of an analyte using acridinium esters and liposomes |
WO2004063355A2 (en) * | 2003-01-10 | 2004-07-29 | Protein Design Labs, Inc. | Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of matastatic cancer |
ES2363156T3 (en) * | 2004-05-13 | 2011-07-22 | B.R.A.H.M.S Gmbh | USE OF ENCEPHALINE PRECURSORS AND / OR ITS FRAGMENTS IN MEDICAL DIAGNOSIS. |
JP2008529495A (en) * | 2005-02-04 | 2008-08-07 | グラクソ グループ リミテッド | Optimization of heterologous polypeptide expression |
US20080160557A1 (en) | 2006-09-28 | 2008-07-03 | Cady Roger K | Diagnostic Test for Head and Facial Pain |
WO2009044561A1 (en) * | 2007-10-03 | 2009-04-09 | Shizuoka Prefecture | ANTI-proNT/NMN MONOCLONAL ANTIBODY |
ES2538002T3 (en) * | 2009-01-07 | 2015-06-16 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Methods for treatment, prognostic evaluation and breast cancer detection |
EP2233590A1 (en) * | 2009-01-28 | 2010-09-29 | AIT Austrian Institute of Technology GmbH | Methylation assay |
EP2427764B1 (en) * | 2009-05-05 | 2017-07-26 | B.R.A.H.M.S GmbH | Vasoactive hormone-based stratification of patients suffering from diseases related to endothelial function/dysfunction |
EP2438193B1 (en) * | 2009-06-01 | 2015-07-22 | Genetic Technologies Limited | Methods for breast cancer risk assessment |
WO2011020052A1 (en) * | 2009-08-14 | 2011-02-17 | Allergan, Inc. | Methods of treating cancer using opioid retargeted endpeptidases |
-
2013
- 2013-10-01 TR TR2018/09183T patent/TR201809183T4/en unknown
- 2013-10-01 EP EP13779755.1A patent/EP2904398B1/en active Active
- 2013-10-01 JP JP2015534992A patent/JP6392762B2/en active Active
- 2013-10-01 US US14/432,808 patent/US9702876B2/en active Active
- 2013-10-01 DK DK13779755.1T patent/DK2904398T3/en active
- 2013-10-01 CA CA2886814A patent/CA2886814C/en active Active
- 2013-10-01 CN CN201380051613.1A patent/CN104781672B/en active Active
- 2013-10-01 RU RU2018138055A patent/RU2707755C2/en active
- 2013-10-01 RU RU2015116675A patent/RU2671578C2/en active
- 2013-10-01 CN CN201910496671.4A patent/CN110221071A/en active Pending
- 2013-10-01 PL PL13779755T patent/PL2904398T3/en unknown
- 2013-10-01 ES ES13779755.1T patent/ES2676737T3/en active Active
- 2013-10-01 WO PCT/EP2013/070471 patent/WO2014053502A1/en active Application Filing
-
2016
- 2016-01-14 HK HK16100382.8A patent/HK1212762A1/en unknown
-
2017
- 2017-07-05 US US15/641,436 patent/US20170307618A1/en active Pending
-
2019
- 2019-11-22 RU RU2019137669A patent/RU2019137669A/en unknown
-
2022
- 2022-09-29 US US17/955,765 patent/US20230147663A1/en active Pending
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030109420A1 (en) * | 2001-05-04 | 2003-06-12 | Biosite, Inc. | Diagnostic markers of acute coronary syndrome and methods of use thereof |
US7713705B2 (en) * | 2002-12-24 | 2010-05-11 | Biosite, Inc. | Markers for differential diagnosis and methods of use thereof |
Non-Patent Citations (5)
Title |
---|
Edwards et al., "The remarkable flexibility of the human antibody repertoire; isolation of over one thousand different antibodies to a single protein, BLyS"" J. Mol. Biol. (2003) 334, 103-118, DOI: 10.1016/).jmb.2003.09.054 (Year: 2003) * |
Harlow & Lane, Antibodies, A Laboratory Manual, Cold Spring Harbor laboratory, 1988, pages 25-26 and 37-59 (Year: 1988) * |
Johnson et al., Diabetes, Insulin Use, and Cancer Risk: Are Observational Studies Part of the Solution- or Part of the Problem?, Diabetes Journals, 59, (2010), p. 1129-1131. (Year: 2010) * |
Lloyd et al., "Modelling the human immune response: performance of a 10e11 human antibody repertoire against a broad panel of therapeutically relevant antigens", Protein Engineering, Design and Selection, Volume 22, Issue 3, 1 March 2009, Pages 159-168, https://doi.org/10.1093/protein/gzn058 (Year: 2009) * |
Meyers et al., "New Insights in Type I and II CD20 Antibody Mechanisms-Of-Action With a Panel of Novel CD20 Antibodies", British Journal of Haematology, 2018, 180, 808-820, |https://doi.org/10.1111/bjh.15132 (Year: 2018) * |
Also Published As
Publication number | Publication date |
---|---|
DK2904398T3 (en) | 2018-07-23 |
JP6392762B2 (en) | 2018-09-19 |
US20150268240A1 (en) | 2015-09-24 |
RU2671578C2 (en) | 2018-11-02 |
RU2019137669A3 (en) | 2021-05-24 |
RU2019137669A (en) | 2021-05-24 |
RU2018138055A3 (en) | 2019-06-10 |
WO2014053502A1 (en) | 2014-04-10 |
EP2904398A1 (en) | 2015-08-12 |
ES2676737T3 (en) | 2018-07-24 |
RU2018138055A (en) | 2018-11-14 |
CA2886814C (en) | 2021-09-07 |
TR201809183T4 (en) | 2018-07-23 |
PL2904398T3 (en) | 2018-11-30 |
JP2015532423A (en) | 2015-11-09 |
RU2707755C2 (en) | 2019-11-29 |
US20230147663A1 (en) | 2023-05-11 |
CA2886814A1 (en) | 2014-04-10 |
RU2015116675A (en) | 2016-11-27 |
EP2904398B1 (en) | 2018-04-11 |
CN104781672A (en) | 2015-07-15 |
US9702876B2 (en) | 2017-07-11 |
HK1212762A1 (en) | 2016-06-17 |
CN110221071A (en) | 2019-09-10 |
CN104781672B (en) | 2019-07-05 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230147663A1 (en) | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject | |
US20210333292A1 (en) | Method for diagnosing or monitoring kidney function or diagnosing kidney dysfunction | |
US20210109102A1 (en) | Method for predicting the risk of getting cancer or diagnosing cancer in a female subject | |
US20200326350A1 (en) | Method for predicting the risk of a subject for contracting diabetes mellitus and/or metabolic syndrome or for diagnosing metabolic syndrome in a subject | |
US20150118236A1 (en) | Method for Predicting the Risk of Getting a Cardiovascular Event in a Female Subject | |
EA034364B1 (en) | Immunoassay for the detection of chromogranin a | |
US10605812B2 (en) | Method for predicting the risk of getting cancer or diagnosing cancer in a subject |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE AFTER FINAL ACTION FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: ADVISORY ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
STCV | Information on status: appeal procedure |
Free format text: NOTICE OF APPEAL FILED |