US20160265067A1 - Identification of non-responders to her2 inhibitors - Google Patents

Identification of non-responders to her2 inhibitors Download PDF

Info

Publication number
US20160265067A1
US20160265067A1 US15/163,552 US201615163552A US2016265067A1 US 20160265067 A1 US20160265067 A1 US 20160265067A1 US 201615163552 A US201615163552 A US 201615163552A US 2016265067 A1 US2016265067 A1 US 2016265067A1
Authority
US
United States
Prior art keywords
her2
pik3ca
seq
mutation
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/163,552
Inventor
Victoria Brophy
Neil Jones
Astrid Kiermaier
Jayantha Ratnayake
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Roche Molecular Systems Inc
Original Assignee
Roche Molecular Systems Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Roche Molecular Systems Inc filed Critical Roche Molecular Systems Inc
Priority to US15/163,552 priority Critical patent/US20160265067A1/en
Publication of US20160265067A1 publication Critical patent/US20160265067A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3015Breast
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6813Hybridisation assays
    • C12Q1/6827Hybridisation assays for detection of mutation or polymorphism
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/106Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/156Polymorphic or mutational markers

Definitions

  • the present invention relates to means and methods for the identification of non-responders to a HER2 inhibitor, whereby one or more mutations (mutational SNPs) in exon 9 of Phosphoinositol-3 kinase (PIK3CA) indicate non-responsiveness.
  • the HER family of receptor tyrosine kinases are important mediators of cell growth, differentiation and survival.
  • the receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbB1, or HER1), HER2 (ErbB2 or p185 neu ), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
  • EGFR epidermal growth factor receptor
  • HER2 ErbB2 or p185 neu
  • HER3 ErbB3
  • HER4 ErbB4 or tyro2
  • EGFR encoded by the erbB1 gene
  • increased expression of EGFR has been observed in breast, bladder, lung, head, neck and stomach cancer as well as glioblastomas.
  • Increased EGFR receptor expression is often associated with increased production of the EGFR ligand, transforming growth factor alpha (TGF- ⁇ ), by the same tumor cells resulting in receptor activation by an autocrine stimulatory pathway.
  • TGF- ⁇ transforming growth factor alpha
  • Monoclonal antibodies directed against the EGFR or its ligands, TGF- ⁇ and EGF have been evaluated as therapeutic agents in the treatment of such malignancies. See, e.g., Baselga and Mendelsohn., supra; Masui et al. Cancer Research 44:1002-1007 (1984); and Wu et al. J. Clin. Invest. 95:1897-1905 (1995).
  • the second member of the HER family, p185 neu was originally identified as the product of the transforming gene from neuroblastomas of chemically treated rats.
  • the activated form of the neu proto-oncogene results from a point mutation (valine to glutamic acid) in the transmembrane region of the encoded protein.
  • Amplification of the human homolog of neu is observed in breast and ovarian cancers and correlates with a poor prognosis (Slamon et al., Science, 235:177-182 (1987); Slamon et al., Science, 244:707-712 (1989); and U.S. Pat. No. 4,968,603).
  • no point mutation analogous to that in the neu proto-oncogene has been reported for human tumors.
  • HER2 Overexpression of HER2 (frequently but not uniformly due to gene amplification) has also been observed in other carcinomas including carcinomas of the stomach, endometrium, salivary gland, lung, kidney, colon, thyroid, pancreas and bladder. See, among others, King et al., Science, 229:974 (1985); Yokota et al., Lancet: 1:765-767 (1986); Fukushige et al., Mol Cell Biol., 6:955-958 (1986); Guerin et al., Oncogene Res., 3:21-31 (1988); Cohen et al., Oncogene, 4:81-88 (1989); Yonemura et al., Cancer Res., 51:1034 (1991); Borst et al., Gynecol.
  • HER2 may be overexpressed in prostate cancer (Gu et al. Cancer Lett. 99:185-9 (1996); Ross et al. Hum. Pathol. 28:827-33 (1997); Ross et al. Cancer 79:2162-70 (1997); and Sadasivan et al. J. Urol. 150:126-31 (1993)).
  • Hudziak et al., Mol. Cell. Biol. 9(3):1165-1172 (1989) describe the generation of a panel of HER2 antibodies which were characterized using the human breast tumor cell line SK-BR-3. Relative cell proliferation of the SK-BR-3 cells following exposure to the antibodies was determined by crystal violet staining of the monolayers after 72 hours. Using this assay, maximum inhibition was obtained with the antibody called 4D5 which inhibited cellular proliferation by 56%. Other antibodies in the panel reduced cellular proliferation to a lesser extent in this assay. The antibody 4D5 was further found to sensitize HER2-overexpressing breast tumor cell lines to the cytotoxic effects of TNF- ⁇ . See also U.S. Pat. No. 5,677,171 issued Oct.
  • a recombinant humanized version of the murine HER2 antibody 4D5 (huMAb4D5-8, rhuMAh HER2, Trastuzumab or HerceptinTM; U.S. Pat. No. 5,821,337) is clinically active in patients with HER2-overexpressing metastatic breast cancers that have received extensive prior anti-cancer therapy (Baselga et al., J. Clin. Oncol. 14:737-744 (1996)).
  • Trastuzumab received marketing approval from the Food and Drug Administration Sep. 25, 1998 for the treatment of patients with metastatic breast cancer whose tumors overexpress the HER2 protein.
  • HER2 antibodies with various properties have been described in Tagliabue et a. Int. J. Cancer 47:933-937 (1991); McKenzie et al. Oncogene 4:543-548 (1989); Maier et al. Cancer Res. 51:5361-5369 (1991); Bacus et al. Molecular Carcinogenesis 3:350-362 (1990); Stancovski et al. PNAS ( USA ) 88:8691-8695 (1991); Bacus et al. Cancer Research 52:2580-2589 (1992); Xu et al. Int. J. Cancer 53:401-408 (1993); WO94/00136; Kasprzyk et al.
  • HER3 U.S. Pat. Nos. 5,183,884 and 5,480,968 as well as Kraus et al. PNAS ( USA ) 86:9193-9197 (1989)
  • HER4 EP Pat. Appln. No 599,274; Plowman et al., Proc. Natl. Acad. Sci. USA, 90:1746-1750 (1993); and Plowman et al., Nature, 366:473475 (1993)). Both of these receptors display increased expression on at least some breast cancer cell lines.
  • HER receptors are generally found in various combinations in cells and heterodimerization is thought to increase the diversity of cellular responses to a variety of HER ligands (Earp et al. Breast Cancer Research and Treatment 35: 115-132 (1995)).
  • EGFR is bound by six different ligands; epidermal growth factor (EGF), transforming growth factor alpha (TGF- ⁇ ), amphiregulin, heparin binding epidermal growth factor (HB-EGF), betacellulin and epiregulin (Groenen et al. Growth Factors 11:235-257 (1994)).
  • a family of heregulin proteins resulting from alternative splicing of a single gene are ligands for HER3 and HER4.
  • the heregulin family includes alpha, beta and gamma heregulins (Holmes et at, Science, 256:1205-1210 (1992); U.S. Pat. No. 5,641,869; and Schaefer et al. Oncogene 15:1385-1394 (1997)); neu differentiation factors (NDFs), glial growth factors (GGFs); acctylcholinc receptor inducing activity (ARIA); and sensory and motor neuron derived factor (SMDF).
  • NDFs neu differentiation factors
  • GGFs glial growth factors
  • ARIA acctylcholinc receptor inducing activity
  • SMDF sensory and motor neuron derived factor
  • neuregulin-2 (NRG-2) which is reported to bind either HER3 or HER4 (Chang et al. Nature 387 509-512 (1997); and Carraway et al Nature 387:512-516 (1997)); neuregulin-3 which binds HER4 (Zhang et at PNAS (USA) 94(18):9562-7 (1997)); and neuregulin-4 which binds HER4 (Harari et al. Oncogene 18:2681-89 (1999)) HB-EGF, betacellulin and epiregulin also bind to HER4.
  • EGF and TGF ⁇ do not bind HER2, EGF stimulates EGFR and HER2 to form a heterodimer, which activates EGFR and results in transphosphorylation of HER2 in the heterodimer. Dimerization and/or transphosphorylation appears to activate the HER2 tyrosine kinase. See Earp et al., supra.
  • HER3 is co-expressed with HER2, an active signaling complex is formed and antibodies directed against HER2 are capable of disrupting this complex (Sliwkowski et al., J. Biol. Chem., 269(20):14661-14665 (1994)).
  • HER3 for heregulin (HRG) is increased to a higher affinity state when co-expressed with HER2.
  • HRG heregulin
  • HER4 like HER3, forms an active signaling complex with HER2 (Carraway and Cantley, Cell 78:5-8 (1994)).
  • rhuMAb 2C4 (Pertuzumab) was developed as a humanized antibody that inhibits the dimerization of HER2 with other HER receptors, thereby inhibiting ligand-driven phosphorylation and activation, and downstream activation of the RAS and AKT pathways.
  • Pertuzumab As a phase I trial of Pertuzumab as a single agent for treating solid tumors, 3 subjects with advanced ovarian cancer were treated with pertuzumab. One had a durable partial response, and an additional subject had stable disease for 15 weeks. Agus et al. Proc Am Soc Clin Oncol 22: 192, Abstract 771 (2003).
  • U.S. Pat. No. 6,339,142 describes a HER2 antibody composition comprising a mixture of anti-HER2 antibody and one or more acidic variants thereof, wherein the amount of the acidic variant(s) is less than about 25%.
  • Trastuzumab is the exemplified HER2 antibody.
  • Reid et al. Poster presented at Well Characterized Biotech Pharmaceuticals conference (January, 2003) “Effects of Cell Culture Process Changes on Humanized Antibody Characteristics” describes an unnamed, humanized IgG1 antibody composition with N-terminal heterogeneities due to combinations of VHS signal peptide, N-terminal glutamine, and pyroglutamic acid on the heavy chain thereof.
  • Patent publications related to HER antibodies include: U.S. Pat. No. 5,677,171, U.S. Pat. No. 5,720,937, U.S. Pat. No. 5,720,954, U.S. Pat. No. 5,725,856, U.S. Pat. No. 5,770,195, U.S. Pat. No. 5,772,997, U.S. Pat. No. 6,165,464, U.S. Pat. No. 6,387,371.
  • HER2 antibody Trastuzumab/HerceptinTM are selected for therapy based on HER2 protein overexpression/gene amplification; see, for example, WO99/31140 (Paton et al.), US2003/0170234A1 (Hellmann, S.), and US2003/0147884 (Paton et al.); as well as WO01/89566, US2002/0064785, and US2003/0134344 (Mass et al.). See, also, US2003/0152987, Cohen et al., concerning immunohistochcmistry (IHC) and fluorescence in situ hybridization (FISH) for detecting HER2 overexpression and amplification.
  • IHC immunohistochcmistry
  • FISH fluorescence in situ hybridization
  • WO2004/053497 and US2004/024815A1 (Bacus et al.), as well as US 2003/0190689 (Crosby and Smith), refer to determining or predicting response to Trastuzumab therapy.
  • US2004/013297A1 (Bacus et al.) concerns determining or predicting response to ABX0303 EGFR antibody therapy.
  • WO2004/000094 (Bacus et al.) is directed to determining response to GW572016, a small molecule, EGFR-HER2 tyrosine kinase inhibitor.
  • WO2004/063709 refers to biomarkers and methods for determining sensitivity to EGFR inhibitor, erlotinib HCl.
  • US2004/0209290, Cobleigh et al. concerns gene expression markers for breast cancer prognosis.
  • pertuzumab a HER2 dimerisation inhibitor described herein below in more detail
  • Patent publications concerning pertuzumab and selection of patients for therapy therewith include: WO01/00245 (Adams et al.); US2003/0086924 (Sliwkowski, M.); US2004/0013667A1 (Sliwkowski, M.); as well as WO2004/008099A2, and US2004/0106161 (Bossenmaier et al.).
  • HerceptinTM/Trastuzumab is indicated in the art for the treatment of patients with metastatic breast cancer whose tumors overexpress HER2 protein or have HER 2 gene amplification:
  • HerceptinTM/Trastuzumab can also be used as adjuvant treatment in early breast cancer.
  • HerceptinTM/Trastuzumab is also approved for the treatment of patients with HER2-positive early breast cancer following surgery, chemotherapy (neoadjuvant (i.e. before surgery) or adjuvant), and radiotherapy (if applicable).
  • Herceptin in combination with capecitabine or 5-fluorouracil and cisplatin is indicated for the treatment of patients with HER2 positive locally advance or metastatic adenocarcinoma of the stomach or gastroesophageal junction who have not received prior anti-cancer treatment for their metastatic disease.
  • HER2-positive cancer is present if a high HER2 (protein) expression level detected by immunohistochemical methods (e.g. HER2 (+++)) or HER2 gene amplification detected by in-situ-hybridization (e.g. ISH positive, like a HER2 gene copy number higher than 4 copies of the HER2 gene per tumor cell or ratio of ⁇ 2.0 for the number of HER2 gene copies to the number of signals for CEP17.) or both is found in samples obtained from the patients such as breast tissue biopsies or breast tissue resections or in tissue derived from metastatic sites.
  • immunohistochemical methods e.g. HER2 (+++)
  • HER2 gene amplification detected by in-situ-hybridization e.g. ISH positive, like a HER2 gene copy number higher than 4 copies of the HER2 gene per tumor cell or ratio of ⁇ 2.0 for the number of HER2 gene copies to the number of signals for CEP17.
  • the NEOSPHERE study (Neoadjuvant Study of Pertuzumab and Herceptin in an Early Regimen Evaluation) is a randomized multicentre, international Phase II study that was conducted in 78 centres worldwide (except the USA) in 417 women with newly diagnosed HER2-positive early, inflammatory or locally advanced breast cancer who had never received Herceptin. Prior to surgery (neoadjuvant treatment) these women were randomized to four study arms. The primary endpoint was complete tumour disappearance at time of surgery (pathological complete response, pCR) and the results were:
  • the technical problem underlying the present invention is the provision of means and methods for identifying a patient or a group of patients with HER2-positive cancer who are non-responsive to a treatment with a HER2 inhibitor, in particular to a treatment with a HER2 antibody such as Trastuzumab or Pertuzumab.
  • the present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising evaluating the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinosirol-3 kinase (PIK3CA or p110 ⁇ ) in a sample from a patient with HER2-positive cancer; and whereby the presence of one or more mutations in exon 9 indicates non-responsiveness of said patient to said HER2 inhibitor.
  • PIK3CA or p110 ⁇ Phosphoinosirol-3 kinase
  • mutations in exon 9 of Phosphoinositol-3 kinase are indicative for non-responsiveness of a patient with HER2-positive cancer to a HER2 inhibitor, such as Trastuzumab and, in particular Pertuzumab.
  • a HER2 inhibitor such as Trastuzumab and, in particular Pertuzumab.
  • mutations in exon 20 were not predictive for non-responsiveness.
  • the evaluation only of mutations in exon 9 of Phosphoinositol-3 kinase is sufficient for a highly reliable determination of non-responders to treatment with HER2 inhibitors, in particular anti-HER2 antibodies.
  • exon 9 mutations are, preferably, the only PIK3CA mutations evaluated in the methods of the present invention.
  • solely the presence of mutations in exon 9 of PIK3CA is determined/evaluated/measured, i.e. the presence of mutations in other parts (e.g. like exon 20) of the PIK3CA gene or coding sequence are not evaluated or determined.
  • the invention is, thus, based on the surprising finding that the determination/evaluation of solely (only) mutations (like mutational SNPs) in exon 9 of PIK3CA is enough for a reliable read-out whether a patient will or will not respond to treatment with a HER2 inhibitor.
  • Exemplary mutations/SNPs in exon 9 of PIK3CA that can be determined/evaluated in the herein provided method for identification of non-responders to HER2-inhibitors are those where the mutation results in a change in the amino acid sequence at position 542 and 545 of the full length protein sequence of PIK3CA as shown in SEQ ID NO: 2.
  • the amino acid at position 542 and 545 is “E”.
  • the wild type “E” at these positions is replaced by the amino acid “K” (“E542K” or “E545K”), amino acid “A” (“E545A”) or amino acid “G” (“E545G”).
  • non-responders identified by the herein provided means and methods may be subject to other treatments than treatment with a HER2 inhibitor; for example, they may advantageously be treated with compounds other than HER2 inhibitors.
  • the term “non-responder” as used herein can refer to an individual/patient/subject that is less likely to respond to a treatment using a HER2 inhibitor (like pertuzumab or trastuzumab).
  • “Less likely to respond” as used herein refers to a decreased likeliness that a pathological complete response (pcR) will occur in a patient treated with a HER2 inhibitor.
  • agents are known in the art and comprise, but are not limited to fused pyrimidine derivatives as disclosed in U.S. Pat. No. 8,022,205 B2 or fused pyrrolopyrimidine derivatives as disclosed in WO2009/099163.
  • the sample to be evaluated can be obtained from a patient with HER2-positive cancer.
  • the HER2-positive cancer may assessed be breast cancer, such as early-stage breast cancer.
  • the method of identifying non-responders provided herein can be applied to a wide range of HER2-positive cancers, like gastric cancer, colon cancer, lung cancer and the like.
  • the HER2 inhibitor is an anti-HER2 antibody, like pertuzumab or trastuzumab.
  • the patient is a human.
  • this invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising detecting/measuring the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110 ⁇ ) in a sample from a patient with HER2-positive cancer; and whereby the presence of one or more mutations in exon 9 indicates non-responsiveness of said patient to said HER2 inhibitor.
  • PIK3CA or p110 ⁇ Phosphoinositol-3 kinase
  • the present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising the steps
  • PIK3CA Phosphoinositol-3 kinase catalytic subunit
  • PIK3CA refers to the catalytic subunit of Phosphoinositol-3 kinase (PI3K), isoform alpha, also refereed to as p110alpha.
  • PI3CA catalytic subunit of Phosphoinositol-3 kinase isoform alpha” or, short, “p110alpha”/“p110 ⁇ ” are used interchangeably herein.
  • PIK3CA is the term recommended and commonly used in the art; however, the entire protein is also known as PI3K.
  • Phosphatidylinositol 3-kinase (PI3K) is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit.
  • the protein encoded by the PIK3CA gene represents the catalytic subunit of PI3K, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4.5)P2 (i.e. this catalytic subunit is “PIK3CA” as defined and used herein). This gene has been found to be oncogenic and has been implicated in a variety of cancers.
  • Phosphoinositol-3 kinase belongs to the family of Phosphatidylinositol 3-kinases (PI 3-kinases or “PI3Ks”). This is a family of enzymes involved in cellular functions such as cell growth, proliferation, differentiation, motility, survival and intracellular trafficking, which in turn are involved in cancer. In response to lipopolysaccharide, PI3Ks phosphorylate p65, inducing anandamide synthesis to inhibit NF- ⁇ B activation. This is under the control of FAAH limiting the ability of LPS to increase AEA levels and is also inhibited by wortmannin and cannabidiol, one of the only natural compounds to inhibit FAAH.
  • the phosphoinositol-3-kinase family is divided into three different classes: Class I, Class II, and Class III. The classifications are based on primary structure, regulation, and in vitro lipid substrate specificity.
  • class 2 PIK3C2A PI3K class 2, alpha polypeptide PI3K-C2 ⁇ PIK3C2B PI3K, class 2, beta polypeptide PI3K-C2 ⁇ PIK3C2G PI3K, class 2, gamma polypeptide PI3K-C2 ⁇ class 3 PIK3C3 PI3K, class 3 Vps34 class 1 PIK3CA PI3K, catalytic, alpha polypeptide p110- ⁇ catalytic PIK3CB PI3K, catalytic, beta polypeptide p110- ⁇ PIK3CG PI3K, catalytic, gamma polypeptide p110- ⁇ PIK3CD PI3K, catalytic, delta polypeptide p110- ⁇ class 1 PIK3R1 PI3K, regulatory subunit 1 (alpha) p85- ⁇ regulatory PIK3R2 PI3K, regulatory subunit 2 (bet
  • PIK3CA and its genetic variants to be used in the herein provided methods for identifying non-responders to HER2-inhibitors and their use in screening methods for responsiveness to treatment with a compound are described, for example, in WO 2011/031861, WO 2005/091849 and WO 2011/060380.
  • the mutation (mutational SNP) to be determined/assessed in accordance with the present invention may be a mutation in the codon encoding an amino acid at position 542 and/or 545 of the full-length amino acid sequence of Phosphatidylinositol-3 kinase (PIK3CA) (see e.g. SEQ ID NO. 2 of FIG. 7 ).
  • the mutation may comprise one or more of the mutations E542K, E545K, E545A and E545G (i.e.
  • mutations/SNP in exon 9 encoding the amino acid K, A or G at position 542 or 545 of the amino acid sequence of Phosphatidylinositol-3 kinase (PIK3CA) instead of wildtype E.
  • PIK3CA Phosphatidylinositol-3 kinase
  • E542K, E545K, E545A and E545G refer to amino acid substitutions at a given position of the amino acid sequence of wild type PIK3CA.
  • Corresponding nucleic acid sequences (codons/triplets) encoding the amino acid at positions 542 and 545 in wild type and mutant PIK3CA genes/coding sequences are described below.
  • E542K refers to a substitution/replacement of amino acid “E” at position 542 of the amino acid sequence of wild type PIK3CA by amino acid “K”.
  • E545K amino acid sequence of wild type PIK3CA by amino acid “K”.
  • E545A amino acid sequence of wild type PIK3CA by amino acid “K”.
  • E545G amino acid sequence of wild type PIK3CA by amino acid “K”.
  • the mutations E542K E545K, E545A and E545G are also illustrated in the herein described sequences.
  • nucleic acid and amino acid sequences of mutation (mutational SNP) E542K are shown in SEQ ID NO. 17 and SEQ ID NO. 18, respectively; nucleic acid and amino acid sequences of mutation E545K are shown in SEQ ID NO: 19 and SEQ ID NO. 20, respectively; nucleic acid and amino acid sequences of mutation E545A are shown in SEQ ID NO: 21 and SEQ ID NO. 22, respectively, and nucleic acid and amino acid sequences of mutation E545G are shown in SEQ ID NO: 23 and SEQ ID NO. 24, respectively.
  • exemplary, non-limiting methods to be used are methods for sequencing of nucleic acids (e.g. Sanger di-deoxy sequencing), “next generation” sequencing methods, single molecule sequencing, methods enabling detection of variant alleles/mutations, such as Real-time PCR, PCR-RFLP assay (see Cancer Research 59 (1999), 5169-5175), mass-spectrometric genotyping (e.g. MALDI-TOF), HPLC, enzymatic methods and SSPC (single strand conformation polymorphism analysis; see Pathol Int (1996) 46, 801-804).
  • methods for sequencing of nucleic acids e.g. Sanger di-deoxy sequencing
  • “next generation” sequencing methods single molecule sequencing
  • methods enabling detection of variant alleles/mutations such as Real-time PCR, PCR-RFLP assay (see Cancer Research 59 (1999), 5169-5175), mass-spectrometric genotyping (e.g. MALDI-TOF), HPLC, enzymatic methods and
  • Such methods may include enzymatic amplification of DNA or cDNA fragments using oligonucleotides specifically hybridizing to exon 9 (or parts thereof) of the PIK3CA gene by PCR. Given that mutations in exon 9 of the PIK3CA gene are to be evaluated, such amplifications may be carried out in one or two reactions when employing RNA or genomic DNA.
  • the resulting PCR products may be subjected to either conventional Sanger-based dideoxy nucleotide sequencing methods or employing parallel sequencing methods (“next generation sequencing”) such as those marketed by Roche (454 technology), Illumina (Solexa technology) or ABI (Solid technology). Mutations may be identified from sequence reads by comparison with publicly available gene sequence data bases.
  • mutations may be identified by incorporation of allele-specific probes that can either be detected using enzymatic detection reactions, fluorescence, mass spectrometry or others; see Vogeser (2007) Dtsch Cardioebl 104 (31-32), A2194-200.
  • Paraffin-embedded clinical material as well as fresh frozen tissue may be used in the detection of these mutations. Detection may comprise a histolopathology review of the sample to be tested to see whether tumour tissue is present.
  • the following table shows exemplary nucleic acid sequences of the mutations (mutational SNPs) to be determined in accordance with the present invention; any other point mutation(s) that result in an amino acid change at position 542 and/or 545 (or position 546, like the E545D mutation having the sequence “gat”/“T” mutation”) of full-length the amino acid sequence of PIK3CA can be included in the assessment in accordance with the present invention.
  • mutation E542K in exon 9 of Phosphoinositol-3 kinase may refer to a codon/triplet (like aaa) encoding amino acid K at position 542 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2).
  • mutant E545K in exon 9 of Phosphoinositol-3 kinase may refer to a codon/triplet (like aag) encoding amino acid K at position 545 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2).
  • mutant E545A in exon 9 of Phosphoinositol-3 kinase may refer to a codon/triplet (like gcg) encoding amino acid A at position 545 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2).
  • mutant E545G in exon 9 of Phosphoinositol-3 kinase (PIK3CA) as used herein may refer to a codon/triplet (like ggg) encoding amino acid G at position 545 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2).
  • Each standard 50- ⁇ L amplification reaction targeting one of the Exons 7, 9 or 20 included 100 ng genomic DNA, dNTPs (including dUTP), 0.05 U/ ⁇ L Z05, DNA polymerase, 0.04 U/ ⁇ L uracil-DNA glycosylase (UNG), and 200-400 nM forward and reverse primer (Table 1), 75-200 nM mutant and wild-type specific probes (Table 2).
  • Amplification was performed in the Cobas® 4800 analyzer using the following temperature profile: 5 min at 50° C. followed by 55 cycles of 95° C. for 10 sec and 63° C. for 50 sec, followed by a single round of 40° C. for 2 min and 25° C. for 10 sec (melting curve analysis). Fluorescence data was collected during each amplification cycle and during the final melting curve analysis.
  • the following exemplary primers/primer pair may be used in the method for identifying a non-responder to a HER2-inhibitor provided herein, wherein the non-responder has a mutation in exon 9 of PIK3CA.
  • the following exemplary probes may be used in the method for identifying a non-responder to a HER2-inhibitor provided herein, wherein the non-responder has a mutation in exon 9 of PIK3CA.
  • the presence of one or more mutations in exon 9 of PIK3CA may be evaluated/determined/measured in the herein provided method for identifying a non-responder to HER2 inhibitors (the terms “evaluating”, “determining” and “measuring” can be used interchangeably in context of the present invention).
  • the presence of only one of the mutations is evaluated/determined. Accordingly, the presence of only one of the E542K, E545K, E545A and E545G mutations of PIK3CA (i.e. the nucleic acids in exon 9 of PIK3CA encoding the amino acid at these positions in the full length amino acid sequence of PIK3CA) may be evaluated, i.e.
  • the methods of the present invention may also comprise the subsequent evaluation of the presence of two or more of these mutations in any order.
  • the evaluation of the presence of E542K may be followed by the evaluation of E545K (or vice versa) which may be followed by the evaluation of the presence of E545A, which may be followed by the evaluation of the presence of E545G.
  • Other possible orders of evaluation are easily conceivable by a person skilled in the art and contemplated herein.
  • the mutations may be evaluated in combination/simultaneously. Again, any combination is envisaged. For example, the presence of E542K and E545K is evaluated; or the presence of E542K and E545A; or the presence of E542K and E545G is evaluated. Other combinations are easily conceivable. The evaluation of a combination of these mutations may be followed or preceded by the evaluation of the presence of one other mutation or a combination of other mutations.
  • the present invention provides for means to determine whether an individual/patient with HER2-positive cancer (i.e. suffering from, suspected to suffer from or being prone to suffer from HER2-positive cancer) will respond to treatment with a HER2 inhibitor or will not respond to treatment to a HER2 inhibitor.
  • This assessment may be advantageously done before the start of treatment with the HER2 inhibitor. Even if a patient has been treated with a HER2 inhibitor, a person skilled in the art can determine whether a person showed no response after the treatment with the HER2 inhibitor.
  • a non-response to an inhibitor may be reflected in an increased suffering from cancer, such as an increased growth of a cancer/tumor and/or increase in the size of a tumor, the (increase in) the formation of metastases or a increase in the number or size of metastases.
  • a non-response may also be the development of a tumor or metastases, for example after resection of a tumor, in the shortening of time to disease progression, or in the increase in the size of (a) tumor(s) and/or (a) metastases, for example in neoadjuvant therapy.
  • a patient group can be identified that does not respond to treatment with HER2 inhibitors, like Pertuzumab or Trastuzumab. It has been found herein that some individuals with HER2 positive cancer or cancer cells do not adequately respond to treatment with a HER2 inhibitor, if the patients have mutations in exon 9 of PIK3CA. In one embodiment of the present invention, at least 80%, 90%, 95% or more of the patient group identified by the herein provided method do not respond to treatment with a HER2 inhibitor. That means that at least 80% of the identified individuals having the herein described mutation(s) in exon 9 of PIK3CA will not respond to the treatment with the herein defined HER2 inhibitors, like Pertuzumab or Trastuzumab.
  • the response is pathologic complete response (pCR).
  • pCR pathologic complete response
  • the term “pCR” as used herein refers to the absence of invasive cancer cells in tissue like breast tissue or absence of invasive tumor cells in tissue like breast tissue and/or lymph nodes. pCR is commonly used as an endpoint in neoadjuvant treatment such as in breast cancer treatment.
  • HER2-positive cancer refers to a cancer/tumorous tissue etc. which comprises cancer cells which have higher than normal levels of HER2.
  • HER2-positive cancer include HER2-positive breast cancer and HER2-positive gastric cancer.
  • HER2-positive cancer has an immunohistochemistry (IHC) score of at least 2+ and/or an in situ hybridization (ISH) amplification ratio ⁇ 2.0 (i.e. is ISH-positive). Accordingly, HER2-positive cancer is present if a high HER2 (protein) expression level detected e.g.
  • HER2 gene amplification detected by in-situ-hybridization (ISH) positive like a HER2 gene copy number higher than 4 copies of the HER2 gene per tumor cell or ratio of ⁇ 2.0 for the number of HER2 gene copies to the number of signals for CEP17.
  • ISH in-situ-hybridization
  • HER2-positive cancer has an immunohistochemistry (IHC) score of HER2(3+) and/or is ISH positive.
  • the expression level of HER2 may be detected by an immunohistochemical method, whereas said HER2 gene amplification status can be measured with in situ hybridization methods, like fluorescence in situ hybridization techniques (FISH).
  • FISH fluorescence in situ hybridization techniques
  • Corresponding assays and kits are well known in the art, for protein expression assays as well as for the detection of gene amplifications. Alternatively other methods like qRT-PCR might be used to detect levels of HER2 gene expression.
  • the expression level of HER2 can, inter alia, be detected by an immunohistochemical method. Such methods are well known in the art and corresponding commercial kits are available. Exemplary kits which may be used in accordance with the present invention are, inter alia, HerceptTestTM produced and distributed by the company Dako or the test called Ventana PathwayTM. The level of HER2 protein expression may be assessed by using the reagents provided with and following the protocol of the HercepTestTM. A skilled person will be aware of further means and methods for determining the expression level of HER2 by immunohistochemical methods; see for example WO 2005/117553. Therefore, the expression level of HER2 can be easily and reproducibly determined by a person skilled in the art without undue burden. However, to ensure accurate and reproducible results, the testing must be performed in a specialized laboratory, which can ensure validation of the testing procedures.
  • the expression level of HER2 can be classified in a low expression level, an intermediate expression level and a high expression level. It is preferred in context of this invention that HER2-positive disease is defined by a strong expression level of HER2 (e.g. HER2(3+) by THC), for example determined in a sample of a cancer patient.
  • HER2-positive disease is defined by a strong expression level of HER2 (e.g. HER2(3+) by THC), for example determined in a sample of a cancer patient.
  • HER2(0), HER2(+), HER2(++) and HER2(+++) is as follows:
  • HER2(+), HER2(++) and HER2(+++) used herein are equivalent to the terms HER2(1+), HER2(2+) and HER2(3+).
  • a “low protein expression level” used in context of this invention corresponds to a 0 or 1+ score (“negative assessment” according to the table shown herein above), an “weak to moderate protein expression level” corresponds to a 2+ score (“weak to moderate overexpression”, see the table above) and a “high protein expression level” corresponds to a 3+ score (“strong overexpression”, see the table above).
  • the evaluation of the protein expression level i.e. the scoring system as shown in the table) is based on results obtained by immunohistochemical methods.
  • the HER-2 status is, accordingly, performed by immunohistochemistry with one of two FDA-approved commercial kits available; namely the Dako HerceptestTM and the Ventana PathwayTM. These are semi-quantitative assays which stratify expression levels into 0 ( ⁇ 20,000 receptors per cell, no expression visible by IHC staining), 1+( ⁇ 100,000 receptors per cell, partial membrane staining, ⁇ 10% of cells overexpressing HER-2), 2+( ⁇ 500,000 receptors per cell, light to moderate complete membrane staining, >10% of cells overexpressing HER-2), and 3+( ⁇ 2,000,000 receptors per cell, strong complete membrane staining, >10% of cells overexpressing HER-2).
  • a HER2-positive cancer may also be diagnosed by assessing the gene amplification status of HER2.
  • HER2-positive cancer is, accordingly, diagnosed if this assessment by ISH is positive.
  • the HER2-positive cancer may, inter alia, relate to a HER2 gene copy number greater than 4.
  • ISH in situ hybridization
  • FISH fluorescent in situ hybridization
  • CISH chromogenic in situ hybridization
  • SISH silver in situ hybridization
  • the HER2-positive cancer may be breast cancer or gastric cancer. Further, the HER2-positive cancer may be ovarian cancer, lung cancer, colorectal cancer, kidney cancer, bone cancer, bone marrow cancer, bladder cancer, skin cancer, prostate cancer, esophagus cancer, salivary gland cancer, pancreas cancer, liver cancer, head and neck cancer, CNS (especially brain) cancer, cervix cancer, cartilage cancer, colon cancer, genitourinary cancer, gastrointestinal tract cancer, pancreas cancer, synovium cancer, testis cancer, thymus cancer, thyroid cancer and uterine cancer.
  • the breast cancer is early-stage breast cancer, as also assessed in the appended example.
  • sample to be assessed in accordance with the herein provided methods for identification a non-responder to a HER2 inhibitor may comprise non-diseased cells and/or diseased cells, i.e. non-cancerous cells and/or cancerous cells however the content of cancerous cells among non cancerous cells should be higher than 50%.
  • the sample may also (or even solely) comprise cancer/tumor cell(s), such as breast cancer/tumor cell(s).
  • sample shall generally mean any biological sample obtained from a patient's tumor.
  • the sample may be a tissue resection or a tissue biopsy.
  • the sample may also be a metastatic lesion or a section of a metastatic lesion or a blood sample known or suspected to comprise circulating tumor cells.
  • the biological sample may comprise cancer cells and to a certain extent i.e. less than 50% non-cancer cells (other cells).
  • the skilled pathologist is able to differentiate cancer cells from normal tissue cells. Methods for obtaining tissue biopsies, tissue resections and body fluids and the like from mammals, such as humans, are well known in the art.
  • the sample is obtained from a patient with HER2-positive cancer as defined above.
  • the sample may be obtained from a tumorous tissue, (a) tumor(s) and, accordingly, is (a) tumor cell(s) or (a) tumor tissue(s) suspected of being HER2-positive tumour, like a breast tumor and the like.
  • a person skilled in the art is in the position to identify such tumors and/or individuals/patients suffering from corresponding cancer using standard techniques known in the art and methods disclosed herein.
  • said tumor cell or cancer cell may be obtained from any biological source/organism, particularly any biological source/organism, suffering from the above-mentioned cancer.
  • particular useful cells are, preferably, human cells. These cells can be obtained from e.g.
  • the tumor/cancer/tumor cell/cancer cell is a solid tumor/cancer/tumor cell/cancer cell.
  • the cancer/tumor cell may be a breast cancer/tumor cell or said sample comprises a cancer/tumor cell, such as a breast cancer/tumor cell.
  • said tumor/cancer may be a breast tumor/cancer.
  • the method for identifying a non-responder to a HER2-inhibitor provided herein may further comprise obtaining a sample of tissue from a patient with HER2-positive cancer prior to said step of identifying.
  • the tissue may be cancerous tissue.
  • the method may further comprise adjusting the treatment of the patient in response to the presence of said one or more mutations in exon 9.
  • the present invention relates in one embodiment to an inhibitor of HER2 for use in treating a patient with HER2-positive cancer, whereby the cancer has been found to be PIK3CA mutation-negative in Exon 9 of PIK3CA. Also the use of an inhibitor of HER2 for the preparation of a pharmaceutical composition for the treatment of a HER2-positive cancer patient is envisaged, whereby the cancer has been found to be PIK3CA mutation-negative.
  • the present invention relates to the use of a HER2 inhibitor to treat a HER2-positive cancer patient by administering the HER2 dimerization inhibitor in an amount effective to treat the cancer, provided the cancer has been found to be PIK3CA mutation-negative.
  • a method for the treatment of a HER2-positive cancer patient which comprises administering the HER2 dimerization inhibitor in an amount effective to treat the cancer, provided the cancer has been found to be PIK3CA mutation-negative.
  • PIK3CA mutation-negative as used herein means that the mutations are not present (absent).
  • the PIK3CA mutation comprises or consists of preferably one or more mutations in exon 9 of Phosphoatidylinositol-3 kinase (PIK3CA) as defined herein above.
  • the patient is a human.
  • the HER2 inhibitor is to be administered as a single anti-tumor agent.
  • the inhibitor may be administered in form of a combination therapy, such as chemotherapy, an anti-hormonal therapy and/or another HER2 targeted agent/another HER2 targeted therapy in addition.
  • the chemotherapy may be docetaxel, anthracycline/taxane chemotherapy, therapy with an anti-metabolite agents, therapy with an anti-hormonal compound, therapy with an anti-estrogen, therapy with a tyrosine kinase inhibitor, therapy with a raf inhibitor, therapy with a ras inhibitor, therapy with a dual tyrosine kinase inhibitor, therapy with taxol, therapy with taxane, therapy with doxorubicin, therapy with adjuvant (anti-) hormone drugs and/or therapy with cisplatin and the like.
  • the HER2 inhibitor may be administered by any one of a parenteral route, oral route, intravenous route, subcutaneous route, intranasal route or transdermal route. Further, the HER2 inhibitor may be employed in a neoadjuvant or adjuvant setting. Accordingly, said HER2 inhibitor may be administered to a patient in need of such a treatment and having the herein defined biomarker status before, during or after a surgical intervention/resection of the cancerous tissue. Therefore, the present invention is useful in neoadjuvant therapy, i.e.
  • the treatment with the herein defined HER2 inhibitor like Pertuzumab or Trastuzumab
  • the patient group of the present invention to be treated by the means and methods provided herein are cancer patients without one or more mutations in exon 9 of PIK3CA.
  • the attending physician may modify, change or amend the administration schemes for the HER2 inhibitor in accordance with his/her professional experience.
  • the HER2 inhibitor is a HER dimerization/signaling inhibitor or an inhibitor of HER2 shedding.
  • the HER dimerization inhibitor may be a HER2 dimerization inhibitor.
  • HER dimerization inhibitor inhibits HER heterodimerization or HER homodimerization.
  • the HER dimerization inhibitor may be an anti-HER antibody.
  • antibody herein is used in the broadest sense and specifically covers intact monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) formed from at least two intact antibodies, and antibody fragments, so long as they exhibit the desired biological activity. Also human and humanized as well as CDR-grafted antibodies are comprised.
  • the HER antibody may bind to a HER receptor selected from the group consisting of EGFR, HER2 and HER3. Preferably, the antibody binds to HER2. In one embodiment, the anti HER2 antibody may bind to domain II of HER2 extracellular domain. In another embodiment, the antibody may bind to a junction between domains I, II and III of HER2 extracellular domain. Most preferably, the anti HER2 antibody is Pertuzumab.
  • the variable light and variable heavy domains of variant 574/Pertuzumab are also shown in FIG. 2 (amino acid sequences thereof shown in SEQ ID Nos. 7 and 8, respectively, as depicted in FIG. 2 ).
  • Pertuzumab is an intact antibody, it preferably comprises an IgG1 antibody; in one embodiment comprising the light chain amino acid sequence in it preferably comprises the light chain and heavy chain amino acid sequences in SEQ ID Nos.
  • FIG. 5A / 5 B show the light chain and heavy chain amino acid sequences of a variant Pertuzumab, SEQ ID NOs: 15 and 16, respectively.
  • the heavy chain amino acid sequences of Pertuzumab as shown in SEQ ID NO: 12 may optionally comprise an additional amino acid “K” at position 449 at the C-terminus.
  • the antibody is optionally produced by recombinant Chinese Hamster Ovary (CHO) cells.
  • Pertuzumab and “rhuMAb 2C4” herein cover biosimilar versions of the drug with the United States Adopted Name (USAN) or International Nonproprietary Name (INN): Pertuzumab. Again, corresponding sequences are shown in FIGS. 2 to 5 .
  • the inhibitor of HER shedding is a HER2 shedding inhibitor.
  • the inhibitor of HER shedding may inhibit HER heterodimerization or HER homodimerization.
  • Said inhibitor of HER shedding may be an anti-HER antibody.
  • the anti-HER antibody may bind to a HER receptor selected from the group consisting of EGFR, HER2 and HER3.
  • the antibody binds to HER2.
  • the HER2 antibody binds to sub-domain IV of the HER2 extracellular domain.
  • the HER2 antibody is HerceptinTM/Trastuzumab.
  • Trastuzumab is an intact antibody, it preferably comprises an IgG1 antibody; in one embodiment comprising the light chain amino acid sequence of SEQ ID NO: 13 and the heavy chain amino acid sequence of SEQ ID NO: 14 as shown in FIG. 4 .
  • the antibody is optionally produced by Chinese Hamster Ovary (CHO) cells.
  • the terms “Trastuzumab” and “rhuMAb4D5-8” herein cover biosimilar versions of the drug with the United States Adopted Name (USAN) or International Nonproprietary Name (INN): Trastuzumab.
  • the HER2 positive cancer to be treated may be breast cancer, such early stage breast cancer.
  • the term “early-stage breast cancer” as used herein refers to breast cancer that has not spread beyond the breast or the axillary lymph nodes.
  • Such cancer is generally treated with neoadjuvant or adjuvant therapy.
  • Neoadjuvant therapy refers to systemic therapy given prior to surgery.
  • Adjuvant therapy refers to systemic therapy given after surgery.
  • other HER2 positive cancer types like gastric cancer can be treated in accordance with the present invention.
  • the treatment is neoadjuvant or adjuvant therapy of the early-stage breast cancer.
  • the pharmaceutical composition to be employed in the medical uses of the present invention will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient, the site of delivery of the pharmaceutical composition, the method of administration, the scheduling of administration, and other factors known to practitioners.
  • the “effective amount” of the pharmaceutical composition for purposes herein is thus determined by such considerations.
  • the effective amount of pharmaceutical composition administered to an individual will, inter alia, depend on the nature of the compound.
  • said compound is a (poly)peptide or protein
  • the total pharmaceutically effective amount of pharmaceutical composition administered parenterally per dose will be in the range of about 1 ⁇ g protein/kg/day to 10 mg protein/kg/day of patient body weight, although, as noted above, this will be subject to therapeutic discretion. More preferably, this dose is at least 0.01 mg protein/kg/day, and most preferably for humans between about 0.01 and 1 mg protein/kg/day.
  • a dose based on body-surface area or weight was not superior to a fixed dose, supporting the continued use of a fixed dose of pertuzumab in female patients with locally advanced, inflammatory or early stage HER2-positive breast cancer, metastatic breast cancer and ovarian cancer.
  • the pharmaceutical composition is typically administered at a dose rate of about 1 ⁇ g/kg/hour to about 50 g/kg/hour, either by 1-4 injections per day or by continuous subcutaneous infusions, for example, using a mini-pump.
  • An intravenous bag solution may also be employed.
  • the length of treatment needed to observe changes and the interval following treatment for responses to occur appears to vary depending on the desired effect. The particular amounts may be determined by conventional tests which are well known to the person skilled in the art.
  • Pharmaceutical compositions of the invention may be administered orally, rectally, parenterally, intracisternally, intravaginally, intraperitoneally, topically (as by powders, ointments, drops or transdermal patch), bucally, or as an oral or nasal spray.
  • compositions of the invention may comprise a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is meant a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
  • parenteral refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrasternal, subcutaneous and intraarticular injection and infusion.
  • sustained-release compositions include semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules.
  • Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman, U. et al., Biopolymers 22:547-556 (1983)), poly (2-hydroxyethyl methacrylate) (R. Langer et al., J. Biomed. Mater. Res. 15:167-277 (1981), and R.
  • Sustained release pharmaceutical composition also include liposomally entrapped compound. Liposomes containing the pharmaceutical composition are prepared by methods known per se: DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. (USA) 82:3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci.
  • the liposomes are of the small (about 200-800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol. percent cholesterol, the selected proportion being adjusted for the optimal therapy.
  • the pharmaceutical composition is formulated generally by mixing it at the desired degree of purity, in a unit dosage injectable form (solution, suspension, or emulsion), with a pharmaceutically acceptable carrier, i.e., one that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation.
  • a pharmaceutically acceptable carrier i.e., one that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation.
  • the formulations are prepared by contacting the components of the pharmaceutical composition uniformly and intimately with liquid carriers or finely divided solid carriers or both. Then, if necessary, the product is shaped into the desired formulation.
  • the carrier may be a parenteral carrier, such as a solution that is isotonic with the blood of the recipient. Examples of such carrier vehicles include water, saline, Ringer's solution, and dextrose solution. Non aqueous vehicles such as fixed oils and ethyl oleate are also useful herein, as well as liposomes.
  • the carrier suitably contains minor amounts of additives such as substances that enhance isotonicity and chemical stability.
  • Such materials are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, succinate, acetic acid, and other organic acids or their salts; antioxidants such as ascorbic acid; low molecular weight (less than about ten residues) (poly)peptides, e.g., polyarginine or tripeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids, such as glycine, glutamic acid, aspartic acid, or arginine; monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, manose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; counterions such as sodium; and/or nonionic surfactants such as polysorbates, poloxamers, or PEG.
  • buffers such as phosphat
  • the components of the pharmaceutical composition to be used for therapeutic administration must be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 micron membranes).
  • Therapeutic components of the pharmaceutical composition generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • the components of the pharmaceutical composition ordinarily will be stored in unit or multi-dose containers, for example, sealed ampoules or vials, as an aqueous solution or as a lyophilized formulation for reconstitution.
  • a lyophilized formulation 10-ml vials are filled with 5 ml of sterile-filtered 1% (w/v) aqueous solution, and the resulting mixture is lyophilized.
  • the infusion solution is prepared by reconstituting the lyophilized compound(s) using bacteriostatic Water-for-Injection.
  • Another embodiment of the present invention relates to the use of a nucleic acid or antibody capable of detecting a mutation in exon 9 of PIK3CA for identifying a non-responder to a HER2-inhibitor in accordance with the herein provided methods.
  • the oligonucleotide(s) may be about 15 to 100 nucleotides in length.
  • the present invention relates in one embodiment to a forward primer having the sequence 5′-UAAAAUUUAUUGAGAAUGUAUUUGCTTTTITC-3′ (SEQ ID NO: 25).
  • This forward primer can be used in amplification of exon 9 or a part thereof encoding the mutant triplet which encodes position 542 and/or 545 of the herein described mutant exon 9 of PIKC3A.
  • the present invention relates to a reverse primer having the sequence 5′-TCCATTTTAGCACTTACCTGTGAC-3′ (SEQ ID NO: 26).
  • This reverse primer can also be used in amplification of exon 9 or a part thereof encoding the mutant triplet which encodes position 542 and/or 545 of the herein described mutant exon 9 of PIKC3A.
  • the present invention provides a primer pair of the forward primer having the sequence 5′-UAAAAUUUAUUGAGAAUGUAUUUGCTTTTTC-3′ (SEQ ID NO: 25) and the reverse primer having the sequence 5′-TCCATTTTAGCACTTAACCTGTGAC-3′ (SEQ ID NO: 26).
  • the present invention relates to probe(s)/probe sequence(s) for evaluating/determining the presence of one or more mutations in exon 9 of PIK3CA.
  • the present invention relates to a probe having the sequence 5′-FTTTCAQAGAGAGGAUEUEGUGUAGAAAUUGEP-3′ (“542 WT Probe”) (SEQ ID NO: 27).
  • the present invention relates to a probe having the sequence 5′-LATTTTQOAGAOAGOAUEUEOUGUAGAAAUUGEUUP-3′ (542K Mutation Probe) (SEQ ID NO: 28).
  • the present invention relates to a probe having the sequence 5′-OCTGCTCAGTQAUUUIAAGAGAGGATCTCGTGTP-3′ (545 WT Probe) (SEQ ID NO: 29). In one embodiment, the present invention relates to a probe having the sequence 5′-JAATCACTAAGQAGGAGAAAGAIUUUEUAUGGAGUEP-3′ (545K Mutation Probe) (SEQ ID NO: 30). In one embodiment, the present invention relates to a probe having the sequence 5′-FCTOCGCQGGAGAAAGAUUUUEUAUGOAGUEAP-3′ (545A Mutation Probe) (SEQ ID NO: 31).
  • the present invention relates to a probe having the sequence 5′-LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP-3′ (545G Mutation Probe) (SEQ ID NO: 32).
  • F FAM Reporter Dye
  • J JA270 Reporter Dye
  • O CY5.5 Reporter Dye
  • L HEX Reporter Dye
  • U 5-propynyl dU
  • E 5-methyl dC
  • I deoxyinosine
  • Z 7-deaza dG
  • Q BHQ2 Quencher Dye
  • P 3′ Phosphate
  • oligo- or polynucleotide(s) for use in the present methods.
  • these oligo- or polynucleotides may be used as probe(s) in the detection methods described herein.
  • computer programs which may be useful for the identification of corresponding probes to be used herein.
  • the PIK3CA coding sequence SEQ ID NO: 1
  • Exemplary nucleic acid sequences are available on corresponding databases, such as the NCBI database (www.ncbi.nlm.nih.gov/sites/entrez).
  • the present invention also relates to a kit useful for carrying out the herein provided methods, the kit comprising a nucleic acid or an antibody capable of detecting a mutation in exon 9 of PIK3CA. Also envisaged herein is the use of the herein described kit for carrying out the herein provided methods.
  • said kit may comprise (a) compound(s) required for specifically determining the one or more mutations in exon 9 of PIK3CA.
  • the present invention also relates to the use of (a) compound(s) required for specifically determining the presence of one or more mutations in exon 9 of PIK3CA for the preparation of a kit for carrying out the methods or uses of this invention.
  • the skilled person knows which compound(s) is (are) required for specifically determining the presence of one or more mutations in exon 9 of PIK3CA.
  • such compound(s) may be (a) (nucleotide) probe(s), (a) primer(s) (pair(s)), (an) antibody(ies) and/or (an) aptamer(s) specific to the mutation described herein.
  • the kit (to be prepared in context) of this invention may be a diagnostic kit.
  • the kit (to be prepared in context) of this invention or the methods and uses of the invention may further comprise or be provided with (an) instruction manual(s).
  • said instruction manual(s) may guide the skilled person (how) to determine one or more mutations in exon 9 of PIK3CA i.e. (how) to diagnose non-responsiveness to a HER2 inhibitor.
  • said instruction manual(s) may comprise guidance to use or apply the herein provided methods or uses.
  • the kit (to be prepared in context) of this invention may further comprise substances/chemicals and/or equipment suitable/required for carrying out the methods and uses of this invention.
  • substances/chemicals and/or equipment are solvents, diluents and/or buffers for stabilizing and/or storing (a) compound(s) required for specifically determining the presence of a mutation in exon 9 of PIK3CA.
  • the present invention relates to a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
  • the present invention relates to a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
  • the method may further comprise, prior to detection is step (c), contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1 and generating an amplification product containing the target sequence within the PI3KCA nucleic acid.
  • the present invention relates to a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
  • the present invention provides a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
  • the present invention provides a method of determining whether a patient having a malignant tumor is likely to respond to a HER2-inhibitor, comprising:
  • the method may further comprise, prior to detection in step (c), contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1 and generating an amplification product containing the target sequence within the PI3KCA nucleic acid.
  • the present invention provides a method of determining whether a patient having a malignant tumor is less likely to respond to a HER2-inhibitor, comprising:
  • SEQ ID NO: 28 LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542 542K Mutation Probe);
  • SEQ ID NO: 30 JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545 545K Mutation Probe);
  • SEQ ID NO: 31 FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A Mutation Probe); and/or
  • SEQ ID NO: 32 LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G Mutation Probe);
  • the present invention relates to a method of determining whether a patient having a malignant tumor is less likely to respond to a HER2-inhibitor, comprising:
  • SEQ ID NO: 28 LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542 542K Mutation Probe);
  • SEQ ID NO: 30 JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545 545K Mutation Probe);
  • SEQ ID NO: 31 FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A Mutation Probe); and/or
  • SEQ ID NO: 32 LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G Mutation Probe);
  • the present invention provides a method for identifying a non-responder to a HER2-inhibitor, said method comprising
  • non-responder can refer to a “patient who is less likely to respond” “Less likely to respond” as used herein refers to a decreased likeliness that a pathological complete response (pcR) will occur in a patient treated with a HER2 inhibitor.
  • pcR pathological complete response
  • the present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising detecting the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110 ⁇ ) nucleic acid by
  • SEQ ID NO: 28 LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542 542K Mutation Probe);
  • SEQ ID NO: 30 JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545 545K Mutation Probe);
  • SEQ ID NO: 31 FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A Mutation Probe); and/or
  • SEQ ID NO: 32 LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G Mutation Probe);
  • the method can further comprise, prior to detection in step (c), contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1 and generating an amplification product containing the target sequence within the PI3KCA nucleic acid.
  • the present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising detecting the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110 ⁇ ) nucleic acid by
  • SEQ ID NO: 28 LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542 542K Mutation Probe);
  • SEQ ID NO: 30 JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545 545K Mutation Probe);
  • SEQ ID NO: 31 FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A Mutation Probe); and/or
  • SEQ ID NO: 32 LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G Mutation Probe);
  • FIG. 1 is a diagrammatic representation of FIG. 1 .
  • FIG. 1 provides a schematic of the HER2 protein structure, and amino acid sequences for Domains I-IV (SEQ ID Nos. 1-4, respectively) of the extracellular domain thereof.
  • FIG. 2 is a diagrammatic representation of FIG. 1 .
  • FIGS. 2A and 2B depict alignments of the amino acid sequences of the variable light (V L ) ( FIG. 2A ) and variable heavy (V H ) ( FIG. 2B ) domains of murine monoclonal antibody 2C4 (SEQ ID Nos. 5 and 6, respectively); V L and V H domains of variant 574/Pertuzumab (SEQ ID Nos. 7 and 8, respectively), and human V L and V H consensus frameworks (hum ⁇ 1, light kappa subgroup I; humIII, heavy subgroup III) (SEQ ID Nos. 9 and 10, respectively).
  • CDRs Complementarity Determining Regions
  • FIG. 3 is a diagrammatic representation of FIG. 3 .
  • FIGS. 3A and 3B show the amino acid sequences of Pertuzumab light chain ( FIG. 3A ; SEQ ID NO. 11) and heavy chain ( FIG. 3B ; SEQ ID No. 12). CDRs are shown in bold. Calculated molecular mass of the light chain and heavy chain are 23,526.22 Da and 49,216.56 Da (cysteines in reduced form). The carbohydrate moiety is attached to Asn 299 of the heavy chain.
  • FIG. 4 is a diagrammatic representation of FIG. 4 .
  • FIGS. 4A and 4B show the amino acid sequences of Trastuzumab light chain ( FIG. 4A ; SEQ ID NO. 13) and heavy chain ( FIG. 4B ; SEQ ID NO. 14), respectively. Boundaries of the variable light and variable heavy domains are indicated by arrows.
  • FIG. 5 is a diagrammatic representation of FIG. 5 .
  • FIGS. 5A and 5B depict a variant Pertuzumab light chain sequence ( FIG. 5A ; SEQ ID NO. 15) and a variant Pertuzumab heavy chain sequence ( FIG. 5B ; SEQ ID NO. 16), respectively.
  • FIG. 6 is a diagrammatic representation of FIG. 6 .
  • FIG. 6 shows Results of PIK3CA mutational analyses.
  • PIK3CA mutations were in general associated with decreased sensitivity to HER2-targeted therapy in NeoSphere (The NeoSphere study is described in detail e.g. in Lancet Oncol. 2012 January; 13(1):25-32. doi: 10.1016/S1470-2045(11)70336-9. Epub 2011 Dec. 6).
  • Analyses per Exon i.e. Exons 7, 9 and 20 was carried out to explore in more detail the impact of specific mutations.
  • Exon 9 mutations Out of 28 mutations detected across the 4 arms, 26 were found to be in the non-responder group.
  • Exon 20 mutations had little impact on pCR. Too few exon 7 mutations to draw conclusions.
  • TH Patients treated with docetaxel (75 ⁇ 100 mg/m 2 ) and trastuzumab (8 ⁇ 6 mg/kg)
  • THP Patients treated with docetaxel (75 ⁇ 4100 mg/m 2 )
  • HP Patients treated with trastuzumab (8 ⁇ 6 mg/kg) and pertuzumab (840 ⁇ 420 mg)
  • TP Patients treated with docetaxel (75 ⁇ 100 mg/m 2 ) and pertuzumab (840 ⁇ 420 mg).
  • FIG. 7 is a diagrammatic representation of FIG. 7 .
  • FIG. 7 shows the PIK3CA gene and the protein sequence aligned. Exon9 is annotated with ***. The wild-type triplets encoding positions E542 and E545 of the wild-type amino acid sequence are indicated in bold letters.
  • Each standard 50- ⁇ L amplification reaction targeting one of the Exons 7, 9 or 20 included 100 ng genomic DNA, dNTPs (including dNTPs), 0.05 U/ ⁇ L Z05, DNA polymerase, 0.04 U/ ⁇ L uracil-DNA glycosylase (UNG), and 200-400 nM forward and reverse primer (Table 1), 75-200 nM mutant and wild-type specific probes (Table 2).
  • Amplification was performed in the Cobas® 4800 analyzer using the following temperature profile: 5 min at 50° C. followed by 55 cycles of 95° C. for 10 sec and 63° C. for 50 sec, followed by a single round of 40° C. for 2 min and 25° C. for 10 sec (melting curve analysis). Fluorescence data was collected during each amplification cycle and during the final melting curve analysis.
  • FIG. 6 shows Results of PIK3CA mutational analyses.
  • PIK3CA mutations were in general associated with decreased sensitivity to HER2-targeted therapy in NeoSphere. Analyses per exon i.e. exons 7, 9 and 20 was carried out to explore in more detail the impact of specific mutations. For exon 9 mutations, out of 28 mutations detected across the 4 arms, 26 were found to be in the non-responder group. Exon 20 mutations had little impact on pCR. There were too few exon 7 mutations to draw conclusions.
  • the present invention refers to the following nucleotide and amino acid sequences:
  • the present invention also provides techniques and methods wherein homologous sequences, and variants of the concise sequences provided herein are used. Preferably, such “variants” are genetic variants.
  • Nucleotide sequence encoding homo sapiens phosphoinositide-3-kinase, catalytic, alpha (PIK3CA), (NCBI accession number: NG_012113.1 GI:237858742).
  • Amino acid sequence of homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit The sequence can be retrieved from the NCBI database under accession number NP_006209.2 GI:54792082 or from Uniprot database under accession number >sp
  • Positions 542 and 545 are indicated in bold letters.
  • Nucleotide sequence encoding exon 9 of homo sapiens phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • V L variable light
  • FIG. 2A Amino acid sequence of the variable light (V L ) ( FIG. 2A ) domain of murine monoclonal antibody 2C4 (SEQ ID Nos. 5 and 6, respectively) as shown in FIG. 2 .
  • V II variable heavy domain of murine monoclonal antibody 2C4 as shown in FIG. 2 .
  • V L variable light
  • FIG. 2A Amino acid sequence of the variable light (V L ) ( FIG. 2A ) domain of variant 574/Pertuzumab as shown in FIG. 2 .
  • V H variable heavy domain of variant 574/Pertuzumab as shown in FIG. 2 .
  • Nucleotide sequence encoding exon 9 of homo sapiens E542K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • the triplet (codon) encoding the mutant amino acid “K” at position 542 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7 ) is highlighted in bold letters.
  • Amino acid sequence of homo sapiens E542K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). Position 542 is highlighted in bold. The mutant shows an increase in lipid kinase activity; oncogenic in vivo; occurs in the interface between the PIK3CA helical domain and the nSH2 (N-terminal SH2) region of the p85 regulatory subunit and may reduce the inhibitory effect of p85; requires interaction with RAS to induce cellular transformation.
  • Nucleotide sequence encoding exon 9 of homo sapiens E545K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • the triplet (codon) encoding the mutant amino acid “K” at position 545 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7 ) is highlighted in bold letters.
  • Amino acid sequence of homo sapiens E545K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). Position 545 is highlighted in bold.
  • the mutant shows an increase in lipid kinase activity; oncogenic in vivo; occurs in the interface between the PIK3CA helical domain and the nSH2 (N-terminal SH2) region of the p85 regulatory subunit and may reduce the inhibitory effect of p85; requires interaction with RAS to induce cellular transformation; enhances invadopodia-mediated extracellular matrix degradation and invasion in breast cancer
  • Nucleotide sequence encoding exon 9 of homo sapiens E545A mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • the triplet (codon) encoding the mutant amino acid “A” at position 545 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7 ) is highlighted in bold letters.
  • Nucleotide sequence encoding exon 9 of homo sapiens F5450 mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • the triplet (codon) encoding the mutant amino acid “G” at position 545 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7 ) is highlighted in bold letters.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biophysics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Oncology (AREA)
  • Hospice & Palliative Care (AREA)
  • Cell Biology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

The present invention relates to means and methods for the identification of non-responders to a HER2 inhibitor, whereby one or more mutations in exon 9 of Phosphoinositol-3 kinase (PIK3CA) indicate non-responsiveness.

Description

  • The present invention relates to means and methods for the identification of non-responders to a HER2 inhibitor, whereby one or more mutations (mutational SNPs) in exon 9 of Phosphoinositol-3 kinase (PIK3CA) indicate non-responsiveness.
  • The HER family of receptor tyrosine kinases are important mediators of cell growth, differentiation and survival. The receptor family includes four distinct members including epidermal growth factor receptor (EGFR, ErbB1, or HER1), HER2 (ErbB2 or p185neu), HER3 (ErbB3) and HER4 (ErbB4 or tyro2).
  • EGFR, encoded by the erbB1 gene, has been causally implicated in human malignancy. In particular, increased expression of EGFR has been observed in breast, bladder, lung, head, neck and stomach cancer as well as glioblastomas. Increased EGFR receptor expression is often associated with increased production of the EGFR ligand, transforming growth factor alpha (TGF-α), by the same tumor cells resulting in receptor activation by an autocrine stimulatory pathway. Baselga and Mendelsohn Pharmac. Ther. 64:127-154 (1994). Monoclonal antibodies directed against the EGFR or its ligands, TGF-α and EGF, have been evaluated as therapeutic agents in the treatment of such malignancies. See, e.g., Baselga and Mendelsohn., supra; Masui et al. Cancer Research 44:1002-1007 (1984); and Wu et al. J. Clin. Invest. 95:1897-1905 (1995).
  • The second member of the HER family, p185neu, was originally identified as the product of the transforming gene from neuroblastomas of chemically treated rats. The activated form of the neu proto-oncogene results from a point mutation (valine to glutamic acid) in the transmembrane region of the encoded protein. Amplification of the human homolog of neu is observed in breast and ovarian cancers and correlates with a poor prognosis (Slamon et al., Science, 235:177-182 (1987); Slamon et al., Science, 244:707-712 (1989); and U.S. Pat. No. 4,968,603). To date, no point mutation analogous to that in the neu proto-oncogene has been reported for human tumors. Overexpression of HER2 (frequently but not uniformly due to gene amplification) has also been observed in other carcinomas including carcinomas of the stomach, endometrium, salivary gland, lung, kidney, colon, thyroid, pancreas and bladder. See, among others, King et al., Science, 229:974 (1985); Yokota et al., Lancet: 1:765-767 (1986); Fukushige et al., Mol Cell Biol., 6:955-958 (1986); Guerin et al., Oncogene Res., 3:21-31 (1988); Cohen et al., Oncogene, 4:81-88 (1989); Yonemura et al., Cancer Res., 51:1034 (1991); Borst et al., Gynecol. Oncol., 38:364 (1990); Weiner et al., Cancer Res., 50:421-425 (1990); Kern et al., Cancer Res., 50:5184 (1990); Park et al., Cancer Res., 49:6605 (1989); Zhau et al., Mol. Carcinog., 3:254-257 (1990); Aasland et al. Br. J. Cancer 57:358-363 (1988); Williams et al. Pathobiology 59:46-52 (1991); and McCann et al., Cancer, 65:88-92 (1990). HER2 may be overexpressed in prostate cancer (Gu et al. Cancer Lett. 99:185-9 (1996); Ross et al. Hum. Pathol. 28:827-33 (1997); Ross et al. Cancer 79:2162-70 (1997); and Sadasivan et al. J. Urol. 150:126-31 (1993)).
  • Antibodies directed against the rat p185neu and human HER2 protein products have been described. Drebin and colleagues have raised antibodies against the rat neu gene product, p185neu See, for example, Drebin et al., Cell 41:695-706 (1985); Myers et al., Meth. Enzym. 198:277-290 (1991); and WO94/22478. Drebin et al. Oncogene 2:273-277 (1988) report that mixtures of antibodies reactive with two distinct regions of p185neu result in synergistic anti-tumor effects on neu-transformed NIH-3T3 cells implanted into nude mice. See also U.S. Pat. No. 5,824,311 issued Oct. 20, 1998.
  • Hudziak et al., Mol. Cell. Biol. 9(3):1165-1172 (1989) describe the generation of a panel of HER2 antibodies which were characterized using the human breast tumor cell line SK-BR-3. Relative cell proliferation of the SK-BR-3 cells following exposure to the antibodies was determined by crystal violet staining of the monolayers after 72 hours. Using this assay, maximum inhibition was obtained with the antibody called 4D5 which inhibited cellular proliferation by 56%. Other antibodies in the panel reduced cellular proliferation to a lesser extent in this assay. The antibody 4D5 was further found to sensitize HER2-overexpressing breast tumor cell lines to the cytotoxic effects of TNF-α. See also U.S. Pat. No. 5,677,171 issued Oct. 14, 1997. The HER2 antibodies discussed in Hudziak et at are further characterized in Fendly et al. Cancer Research 50:1550-1558 (1990); Kotts et al. In Vitro 26(3):59A (1990); Sarup et al. Growth Regulation 1:72-82 (1991); Shepard et al. J. Clin. Immunol. 11(3):117-127 (1991); Kumar et al. Mol. Cell. Biol. 11(2):979-986 (1991); Lewis et al. Cancer Immunol. Immunother. 37:255-263 (1993); Pictras et al. Oncogene 9:1829-1838 (1994); Vitetta et al. Cancer Research 54:5301-5309 (1994); Sliwkowski et al. J. Biol. Chem. 269(20):14661-14665 (1994); Scott et al. J. Biol. Chem. 266:14300-5 (1991); D'souza et al. Proc. Natl. Acad. Sci. 91:7202-7206 (1994); Lewis et al. Cancer Research 56:1457-1465 (1996); and Schaefer et al. Oncogene 15:1385-1394 (1997).
  • A recombinant humanized version of the murine HER2 antibody 4D5 (huMAb4D5-8, rhuMAh HER2, Trastuzumab or Herceptin™; U.S. Pat. No. 5,821,337) is clinically active in patients with HER2-overexpressing metastatic breast cancers that have received extensive prior anti-cancer therapy (Baselga et al., J. Clin. Oncol. 14:737-744 (1996)). Trastuzumab received marketing approval from the Food and Drug Administration Sep. 25, 1998 for the treatment of patients with metastatic breast cancer whose tumors overexpress the HER2 protein.
  • Other HER2 antibodies with various properties have been described in Tagliabue et a. Int. J. Cancer 47:933-937 (1991); McKenzie et al. Oncogene 4:543-548 (1989); Maier et al. Cancer Res. 51:5361-5369 (1991); Bacus et al. Molecular Carcinogenesis 3:350-362 (1990); Stancovski et al. PNAS (USA) 88:8691-8695 (1991); Bacus et al. Cancer Research 52:2580-2589 (1992); Xu et al. Int. J. Cancer 53:401-408 (1993); WO94/00136; Kasprzyk et al. Cancer Research 52:2771-2776 (1992); Hancock et al. Cancer Res. 51:4575-4580 (1991); Shawver et al. Cancer Res. 54:1367-1373 (1994); Arteaga et al. Cancer Res. 54:3758-3765 (1994); Harwerth et al. J. Biol. Chem. 267:15160-15167 (1992); U.S. Pat. No. 5,783,186; and Klapper et al. Oncogene 14:2099-2109 (1997).
  • Homology screening has resulted in the identification of two other HER receptor family members: HER3 (U.S. Pat. Nos. 5,183,884 and 5,480,968 as well as Kraus et al. PNAS (USA) 86:9193-9197 (1989)) and HER4 (EP Pat. Appln. No 599,274; Plowman et al., Proc. Natl. Acad. Sci. USA, 90:1746-1750 (1993); and Plowman et al., Nature, 366:473475 (1993)). Both of these receptors display increased expression on at least some breast cancer cell lines.
  • The HER receptors are generally found in various combinations in cells and heterodimerization is thought to increase the diversity of cellular responses to a variety of HER ligands (Earp et al. Breast Cancer Research and Treatment 35: 115-132 (1995)). EGFR is bound by six different ligands; epidermal growth factor (EGF), transforming growth factor alpha (TGF-α), amphiregulin, heparin binding epidermal growth factor (HB-EGF), betacellulin and epiregulin (Groenen et al. Growth Factors 11:235-257 (1994)). A family of heregulin proteins resulting from alternative splicing of a single gene are ligands for HER3 and HER4. The heregulin family includes alpha, beta and gamma heregulins (Holmes et at, Science, 256:1205-1210 (1992); U.S. Pat. No. 5,641,869; and Schaefer et al. Oncogene 15:1385-1394 (1997)); neu differentiation factors (NDFs), glial growth factors (GGFs); acctylcholinc receptor inducing activity (ARIA); and sensory and motor neuron derived factor (SMDF). For a review, see Groenen et al. Growth Factors 11:235-257 (1994); Lemke, G. Molec. & Cell. Neurosci. 7:247-262 (1996) and Lee et al. Pharm. Rev. 47:51-85 (1995). Recently three additional HER ligands were identified; neuregulin-2 (NRG-2) which is reported to bind either HER3 or HER4 (Chang et al. Nature 387 509-512 (1997); and Carraway et al Nature 387:512-516 (1997)); neuregulin-3 which binds HER4 (Zhang et at PNAS (USA) 94(18):9562-7 (1997)); and neuregulin-4 which binds HER4 (Harari et al. Oncogene 18:2681-89 (1999)) HB-EGF, betacellulin and epiregulin also bind to HER4.
  • While EGF and TGFα do not bind HER2, EGF stimulates EGFR and HER2 to form a heterodimer, which activates EGFR and results in transphosphorylation of HER2 in the heterodimer. Dimerization and/or transphosphorylation appears to activate the HER2 tyrosine kinase. See Earp et al., supra. Likewise, when HER3 is co-expressed with HER2, an active signaling complex is formed and antibodies directed against HER2 are capable of disrupting this complex (Sliwkowski et al., J. Biol. Chem., 269(20):14661-14665 (1994)). Additionally, the affinity of HER3 for heregulin (HRG) is increased to a higher affinity state when co-expressed with HER2. See also, Levi et al., Journal of Neuroscience 15: 1329-1340 (1995); Morrissey et al., Proc. Natl. Acad. Sci. USA 92: 1431-1435 (1995); and Lewis et al., Cancer Res., 56:1457-1465 (1996) with respect to the HER2-HER3 protein complex. HER4, like HER3, forms an active signaling complex with HER2 (Carraway and Cantley, Cell 78:5-8 (1994)).
  • To target the HER signaling pathway, rhuMAb 2C4 (Pertuzumab) was developed as a humanized antibody that inhibits the dimerization of HER2 with other HER receptors, thereby inhibiting ligand-driven phosphorylation and activation, and downstream activation of the RAS and AKT pathways. In a phase I trial of Pertuzumab as a single agent for treating solid tumors, 3 subjects with advanced ovarian cancer were treated with pertuzumab. One had a durable partial response, and an additional subject had stable disease for 15 weeks. Agus et al. Proc Am Soc Clin Oncol 22: 192, Abstract 771 (2003).
  • Also antibody variant compositions are described in the art. U.S. Pat. No. 6,339,142 describes a HER2 antibody composition comprising a mixture of anti-HER2 antibody and one or more acidic variants thereof, wherein the amount of the acidic variant(s) is less than about 25%. Trastuzumab is the exemplified HER2 antibody. Reid et al. Poster presented at Well Characterized Biotech Pharmaceuticals conference (January, 2003) “Effects of Cell Culture Process Changes on Humanized Antibody Characteristics” describes an unnamed, humanized IgG1 antibody composition with N-terminal heterogeneities due to combinations of VHS signal peptide, N-terminal glutamine, and pyroglutamic acid on the heavy chain thereof. Harris et al. “The Ideal Chromatographic Antibody Characterization Method” talk presented at the IBC Antibody Production Conference (February, 2002) reports a VHS extension on the heavy chain of E25, a humanized anti-IgE antibody. Rouse et al. Poster presented at WCBP “Glycoprotein Characterization by High Resolution Mass Spectrometry and Its Application to Biopharmaceutical Development” (Jan. 6-9, 2004) describes a monoclonal antibody composition with N-terminal heterogeneity resulting from AHS or HS signal peptide residues on the light chain thereof. In a presentation at IBC Meeting (September, 2000) “Strategic Use of Comparability Studies and Assays for Well Characterized Biologicals,” Jill Porter discussed a late-eluting form of ZENAPAX™ with three extra amino acid residues on the heavy chain thereof. US2006/0018899 describes a composition comprising a main species pertuzumab antibody and an amino-terminal leader extension variant, as well as other variant forms of the pertuzumab antibody.
  • Patent publications related to HER antibodies include: U.S. Pat. No. 5,677,171, U.S. Pat. No. 5,720,937, U.S. Pat. No. 5,720,954, U.S. Pat. No. 5,725,856, U.S. Pat. No. 5,770,195, U.S. Pat. No. 5,772,997, U.S. Pat. No. 6,165,464, U.S. Pat. No. 6,387,371. U.S. Pat. No. 6,399,063, US2002/0192211A1, U.S. Pat. No. 6,015,567, U.S. Pat. No. 6,333,169, U.S. Pat. No. 4,968,603, U.S. Pat. No. 5,821,337, U.S. Pat. No. 6,054,297, U.S. Pat. No. 6,407,213, U.S. Pat. No. 6,719,971, U.S. Pat. No. 6,800,738. US2004/0236078A1, U.S. Pat. No. 5,648,237. U.S. Pat. No. 6,267,958, U.S. Pat. No. 6,685,940, U.S. Pat. No. 6,821,515, WO98/17797, U.S. Pat. No. 6,127,526, U.S. Pat. No. 6,333,398, U.S. Pat. No. 6,797,814, U.S. Pat. No. 6,339,142, U.S. Pat. No. 6,417,335, U.S. Pat. No. 6,489,447, WO99/31140, US2003/0147884A1, US20030170234A1, US2005/0002928A1, U.S. Pat. No. 6,573,043, US2003/0152987A1, WO99/48527, US2002/0141993A1, WO01/00245, US2003/0086924, US2004/0013667A1, WO00/69460, WO01/00238, WO01/15730, U.S. Pat. No. 6,627,196B1, U.S. Pat. No. 6,632,979B1, WO01/00244, US2002/0090662A1, WO01/89566, US2002/0064785, US2003/0134344, WO 04/24866, US2004/0082047, US2003/0175845A1, WO03/087131, US2003/0228663, WO2004/008099A2, US2004/0106161, WO2004/048525, US2004/0258685A1, U.S. Pat. No. 5,985,553, U.S. Pat. No. 5,747,261, U.S. Pat. No. 4,935,341, U.S. Pat. No. 5,401,638, U.S. Pat. No. 5,604,107. WO 87/07646, WO 89/10412, WO 91/05264, EP 412,116 B1, EP 494,135 B1, U.S. Pat. No. 5,824,311. EP 444,181 B1, EP 1,006,194 A2, US 2002/0155527A1, WO 91/02062, U.S. Pat. No. 5,571,894, U.S. Pat. No. 5,939,531, EP 502,812 B1, WO 93/03741, EP 554,441 B1, EP 656,367 A1, U.S. Pat. No. 5,288,477, U.S. Pat. No. 5,514,554, U.S. Pat. No. 5,587,458, WO 93/12220, WO 93/16185, U.S. Pat. No. 5,877,305, WO 93/21319, WO 93/21232, U.S. Pat. No. 5,856,089, WO 94/22478, U.S. Pat. No. 5,910,486, U.S. Pat. No. 6,028,059, WO 96/07321, U.S. Pat. No. 5,804,396, U.S. Pat. No. 5,846,749, EP 711,565, WO 96/16673, U.S. Pat. No. 5,783,404, U.S. Pat. No. 5,977,322, U.S. Pat. No. 6,512,097, WO 97/00271, U.S. Pat. No. 6,270,765, U.S. Pat. No. 6,395,272, U.S. Pat. No. 5,837,243, WO 96/40789, U.S. Pat. No. 5,783,186, U.S. Pat. No. 6,458,356, WO 97/20858, WO 97/38731, U.S. Pat. No. 6,214,388, U.S. Pat. No. 5,925,519, WO 98/02463, U.S. Pat. No. 5,922,845, WO 98/18489, WO 98/33914, U.S. Pat. No. 5,994,071, WO 98/45479, U.S. Pat. No. 6,358,682 B1, US 2003/0059790, WO 99/55367, WO 01/20033, US 2002/0076695 A1, WO 00/78347, WO 01/09187. WO 01/21192, WO 01/32155, WO 01/53354, WO 01/56604, WO 01/76630, WO02/05791, WO 02/11677, U.S. Pat. No. 6,582,919, US2002/0192652A1, US 2003/0211530A1, WO 02/44413, US 2002/0142328, U.S. Pat. No. 6,602,670 B2, WO 02/45653, WO 02/055106, US 2003/0152572, US 2003/0165840. WO 02/087619, WO 03/006509, WO03/012072, WO 03/028638, US 2003/0068318, WO 03/041736, EP 1,357,132, US 2003/0202973, US 2004/0138160, U.S. Pat. No. 5,705,157, U.S. Pat. No. 6,123,939, EP 616,812 B1, US 2003/0103973, US 2003/0108545, U.S. Pat. No. 6,403,630 B1, WO 00/61145, WO 00/61185, U.S. Pat. No. 6,333,348 B1, WO 01/05425, WO 01/64246, US 2003/0022918, US 2002/0051785 A1, U.S. Pat. No. 6,767,541, WO 01/76586, US 2003/0144252, WO 01/87336, US 2002/0031515 A1, WO 01/87334, WO 02/05791, WO 02/09754, US 2003/0157097, US 2002/0076408, WO 02/055106, WO 02/070008, WO 02/089842 and WO 03/86467.
  • Patients treated with the HER2 antibody Trastuzumab/Herceptin™ are selected for therapy based on HER2 protein overexpression/gene amplification; see, for example, WO99/31140 (Paton et al.), US2003/0170234A1 (Hellmann, S.), and US2003/0147884 (Paton et al.); as well as WO01/89566, US2002/0064785, and US2003/0134344 (Mass et al.). See, also, US2003/0152987, Cohen et al., concerning immunohistochcmistry (IHC) and fluorescence in situ hybridization (FISH) for detecting HER2 overexpression and amplification. WO2004/053497 and US2004/024815A1 (Bacus et al.), as well as US 2003/0190689 (Crosby and Smith), refer to determining or predicting response to Trastuzumab therapy. US2004/013297A1 (Bacus et al.) concerns determining or predicting response to ABX0303 EGFR antibody therapy. WO2004/000094 (Bacus et al.) is directed to determining response to GW572016, a small molecule, EGFR-HER2 tyrosine kinase inhibitor. WO2004/063709, Amler et al., refers to biomarkers and methods for determining sensitivity to EGFR inhibitor, erlotinib HCl. US2004/0209290, Cobleigh et al., concerns gene expression markers for breast cancer prognosis.
  • Patients treated with pertuzumab (a HER2 dimerisation inhibitor described herein below in more detail) can be selected for therapy based on HER activation or dimerization. Patent publications concerning pertuzumab and selection of patients for therapy therewith include: WO01/00245 (Adams et al.); US2003/0086924 (Sliwkowski, M.); US2004/0013667A1 (Sliwkowski, M.); as well as WO2004/008099A2, and US2004/0106161 (Bossenmaier et al.).
  • Herceptin™/Trastuzumab is indicated in the art for the treatment of patients with metastatic breast cancer whose tumors overexpress HER2 protein or have HER 2 gene amplification:
    • a) As monotherapy for the treatment of those patients who have received at least two chemotherapy regimens for their metastatic disease. Prior chemotherapy must have included at least an anthracycline and a taxane unless patients are unsuitable for these treatments. Hormone receptor positive patients must also have received hormonal therapy, unless patients are unsuitable for these treatments,
    • b) In combination with paclitaxel for the treatment of those patients who have not received chemotherapy for their metastatic disease and for whom an anthracycline is not suitable and
    • c) In combination with docetaxel for the treatment of those patients who have not received chemotherapy for their metastatic disease.
  • Herceptin™/Trastuzumab can also be used as adjuvant treatment in early breast cancer. Herceptin™/Trastuzumab is also approved for the treatment of patients with HER2-positive early breast cancer following surgery, chemotherapy (neoadjuvant (i.e. before surgery) or adjuvant), and radiotherapy (if applicable). In addition Herceptin in combination with capecitabine or 5-fluorouracil and cisplatin is indicated for the treatment of patients with HER2 positive locally advance or metastatic adenocarcinoma of the stomach or gastroesophageal junction who have not received prior anti-cancer treatment for their metastatic disease.
  • In the art, the treatment of breast cancer patients with Herceptin™/Trastuzumab is, for example, recommended and routine for patients having HER2-positive cancer. HER2-positive cancer is present if a high HER2 (protein) expression level detected by immunohistochemical methods (e.g. HER2 (+++)) or HER2 gene amplification detected by in-situ-hybridization (e.g. ISH positive, like a HER2 gene copy number higher than 4 copies of the HER2 gene per tumor cell or ratio of ≧2.0 for the number of HER2 gene copies to the number of signals for CEP17.) or both is found in samples obtained from the patients such as breast tissue biopsies or breast tissue resections or in tissue derived from metastatic sites.
  • The NEOSPHERE study (Neoadjuvant Study of Pertuzumab and Herceptin in an Early Regimen Evaluation) is a randomized multicentre, international Phase II study that was conducted in 78 centres worldwide (except the USA) in 417 women with newly diagnosed HER2-positive early, inflammatory or locally advanced breast cancer who had never received Herceptin. Prior to surgery (neoadjuvant treatment) these women were randomized to four study arms. The primary endpoint was complete tumour disappearance at time of surgery (pathological complete response, pCR) and the results were:
    • pCR of 29.0 percent for Herceptin and docetaxel
    • pCR of 45.8 percent for Herceptin, pertuzumab and docetaxel
    • pCR of 16.8 percent for Herceptin and pertuzumab
    • pCR of 24.0 percent for pertuzumab and docetaxel
  • The data shows that the two antibodies plus docetaxel given in the neoadjuvant setting prior to surgery significantly improved the rate of complete tumour disappearance (pathological complete response rate, pCR, of 45.8 percent) in the breast by more than half compared to Herceptin plus docetaxel (pCR of 29.0 percent), p=0.014. The study is described in detail e.g. in Lancet Oncol. 2012 January; 13(1):25-32. doi: 10.1016/S1470-2045(11)70336-9. Epub 2011 Dec. 6, which is incorporated by reference herein in its entirety. Core biopsies (tumor tissue) from 387 patients were used for biomarker analyses.
  • However, not all patients having HER2-positive cancer or cancer cells respond to treatment with a HER2 inhibitor. Therefore, efforts have been made in the art to identify non-responding patients that may be excluded from treatment. Barbereschi (Clin Cancer Res 2007, 13:6064-6069) investigated the association of phosphoinositide-3-kinase, catalytic, alpha polypeptide (PIK3CA) mutations on exon 9 and 20 with pathologic features and clinical outcome in breast cancer patients treated with chemotherapy and/or hormone therapy. Berns (Cancer Cell (2007) 12, 395-402) describes that the presence of PIK3CA mutations (inter alia in exon 9 and 20) was associated with poor prognosis after trastuzumab therapy. Also Razis (Breast Cancer Res Treat (DOI 10.1007/s10549-011-1572-5) investigates the association of PIK3CA mutations (in exon 9 and 20) with efficacy of trastuzumab therapy and describes that these mutations were associated with shorter median time to progression. Dave (2011, J Clinical Oncology 29, 166) also find that activating mutations in the PIK3CA conferred resistance to Trastuzumab.
  • Thus, the technical problem underlying the present invention is the provision of means and methods for identifying a patient or a group of patients with HER2-positive cancer who are non-responsive to a treatment with a HER2 inhibitor, in particular to a treatment with a HER2 antibody such as Trastuzumab or Pertuzumab.
  • The technical problem is solved by provision of the embodiments characterized in the claims.
  • Accordingly, the present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising evaluating the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinosirol-3 kinase (PIK3CA or p110α) in a sample from a patient with HER2-positive cancer; and whereby the presence of one or more mutations in exon 9 indicates non-responsiveness of said patient to said HER2 inhibitor.
  • In the present invention, it was surprisingly found that mutations in exon 9 of Phosphoinositol-3 kinase (PIK3CA) are indicative for non-responsiveness of a patient with HER2-positive cancer to a HER2 inhibitor, such as Trastuzumab and, in particular Pertuzumab. In contrast, as found herein, mutations in exon 20 were not predictive for non-responsiveness. In other words, it was unexpectedly found that the evaluation only of mutations in exon 9 of Phosphoinositol-3 kinase (PIK3CA) is sufficient for a highly reliable determination of non-responders to treatment with HER2 inhibitors, in particular anti-HER2 antibodies. Therefore, exon 9 mutations are, preferably, the only PIK3CA mutations evaluated in the methods of the present invention. In accordance with the invention, solely the presence of mutations in exon 9 of PIK3CA is determined/evaluated/measured, i.e. the presence of mutations in other parts (e.g. like exon 20) of the PIK3CA gene or coding sequence are not evaluated or determined. The invention is, thus, based on the surprising finding that the determination/evaluation of solely (only) mutations (like mutational SNPs) in exon 9 of PIK3CA is enough for a reliable read-out whether a patient will or will not respond to treatment with a HER2 inhibitor. The evaluation of such mutations and/or SNPs is described herein below in more detail and exemplified in the examples. None of the documents discussed above discloses or proposes the use of only (solely) PIK3CA mutations (or mutational SNPs) in exon 9 for identifying non-responders to therapy with HER2 inhibitors.
  • Exemplary mutations/SNPs in exon 9 of PIK3CA that can be determined/evaluated in the herein provided method for identification of non-responders to HER2-inhibitors are those where the mutation results in a change in the amino acid sequence at position 542 and 545 of the full length protein sequence of PIK3CA as shown in SEQ ID NO: 2. In the wild-type protein sequence of PIK3CA the amino acid at position 542 and 545 is “E”. In the mutant forms of PIK3CA to be determined herein, the wild type “E” at these positions is replaced by the amino acid “K” (“E542K” or “E545K”), amino acid “A” (“E545A”) or amino acid “G” (“E545G”). These changes at amino acid level are also reflected in mutations at the nucleic acid level (like mutational SNPs) and corresponding mutated triplets (codons) to be determined/detected/evaluated are given herein further below.
  • The non-responders identified by the herein provided means and methods may be subject to other treatments than treatment with a HER2 inhibitor; for example, they may advantageously be treated with compounds other than HER2 inhibitors. The term “non-responder” as used herein can refer to an individual/patient/subject that is less likely to respond to a treatment using a HER2 inhibitor (like pertuzumab or trastuzumab). “Less likely to respond” as used herein refers to a decreased likeliness that a pathological complete response (pcR) will occur in a patient treated with a HER2 inhibitor. In cases where (with the methods of the present invention) it was assessed that the subject is a “non-responder” or is “less likely to respond”, said subject is to receive phosphoinositol-3 kinase-targeted agents. Such agents are known in the art and comprise, but are not limited to fused pyrimidine derivatives as disclosed in U.S. Pat. No. 8,022,205 B2 or fused pyrrolopyrimidine derivatives as disclosed in WO2009/099163.
  • The sample to be evaluated can be obtained from a patient with HER2-positive cancer. The HER2-positive cancer may assessed be breast cancer, such as early-stage breast cancer. However, the method of identifying non-responders provided herein can be applied to a wide range of HER2-positive cancers, like gastric cancer, colon cancer, lung cancer and the like. In a preferred embodiment, the HER2 inhibitor is an anti-HER2 antibody, like pertuzumab or trastuzumab. Preferably, the patient is a human.
  • Accordingly, this invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising detecting/measuring the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) in a sample from a patient with HER2-positive cancer; and whereby the presence of one or more mutations in exon 9 indicates non-responsiveness of said patient to said HER2 inhibitor.
  • The present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising the steps
      • (a) obtaining a sample from a patient with HER2-positive cancer,
      • (b) evaluating the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) in said sample;
        whereby the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or pi 110α) indicates non-responsiveness of said patient to said HER2 inhibitor.
  • As mentioned, it has been found herein that the presence of one or more mutations in exon 9 of the catalytic subunit of PI3K i.e. PIK3CA indicates non-responsiveness to a HER2 inhibitor. The following provides some background information on PIK3CA and the family of Phosphatidylinositol 3-kinase to which it belongs; the mutations in exon 9 of the catalytic subunit of PI3K are explained in more detail further below. The mutation may be the replacement or exchange (substitution) of one or more amino acids as compared to the wild-type sequence of exon 9 of Phosphoinositol-3 kinase catalytic subunit (PIK3CA). Corresponding nucleic acid sequences and amino acid sequences of wild-type PIK3CA are shown in SEQ ID NO. 1 and SEQ ID NO: 2, respectively, and in FIG. 7. As used herein, the term “PIK3CA” refers to the catalytic subunit of Phosphoinositol-3 kinase (PI3K), isoform alpha, also refereed to as p110alpha. The terms “PIK3CA”, “catalytic subunit of Phosphoinositol-3 kinase isoform alpha” or, short, “p110alpha”/“p110α” are used interchangeably herein. “PIK3CA” is the term recommended and commonly used in the art; however, the entire protein is also known as PI3K. Phosphatidylinositol 3-kinase (PI3K) is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by the PIK3CA gene represents the catalytic subunit of PI3K, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4.5)P2 (i.e. this catalytic subunit is “PIK3CA” as defined and used herein). This gene has been found to be oncogenic and has been implicated in a variety of cancers.
  • Phosphoinositol-3 kinase belongs to the family of Phosphatidylinositol 3-kinases (PI 3-kinases or “PI3Ks”). This is a family of enzymes involved in cellular functions such as cell growth, proliferation, differentiation, motility, survival and intracellular trafficking, which in turn are involved in cancer. In response to lipopolysaccharide, PI3Ks phosphorylate p65, inducing anandamide synthesis to inhibit NF-κB activation. This is under the control of FAAH limiting the ability of LPS to increase AEA levels and is also inhibited by wortmannin and cannabidiol, one of the only natural compounds to inhibit FAAH. The phosphoinositol-3-kinase family is divided into three different classes: Class I, Class II, and Class III. The classifications are based on primary structure, regulation, and in vitro lipid substrate specificity.
  • The following table provides an overview of the human genes/proteins of Phosphatidylinositol 3-kinases family members. PIK3CA is highlighted in bold.
  • group gene protein synonyms
    class
    2 PIK3C2A PI3K, class 2, alpha polypeptide PI3K-C2α
    PIK3C2B PI3K, class 2, beta polypeptide PI3K-C2β
    PIK3C2G PI3K, class 2, gamma polypeptide PI3K-C2γ
    class
    3 PIK3C3 PI3K, class 3 Vps34
    class
    1 PIK3CA PI3K, catalytic, alpha polypeptide p110-α
    catalytic PIK3CB PI3K, catalytic, beta polypeptide p110-β
    PIK3CG PI3K, catalytic, gamma polypeptide p110-γ
    PIK3CD PI3K, catalytic, delta polypeptide p110-δ
    class
    1 PIK3R1 PI3K, regulatory subunit 1 (alpha) p85-α
    regulatory PIK3R2 PI3K, regulatory subunit 2 (beta) p85-β
    PIK3R3 PI3K, regulatory subunit 3 (gamma) p55-γ
    PIK3R4 PI3K, regulatory subunit 4 p150
    PIK3R5 PI3K, regulatory subunit 5 p101
    PIK3R6 PI3K, regulatory subunit 6 p87
  • PIK3CA and its genetic variants to be used in the herein provided methods for identifying non-responders to HER2-inhibitors and their use in screening methods for responsiveness to treatment with a compound are described, for example, in WO 2011/031861, WO 2005/091849 and WO 2011/060380.
  • In context of the present invention, the mutation (mutational SNP) to be determined/assessed in accordance with the present invention may be a mutation in the codon encoding an amino acid at position 542 and/or 545 of the full-length amino acid sequence of Phosphatidylinositol-3 kinase (PIK3CA) (see e.g. SEQ ID NO. 2 of FIG. 7). The mutation may comprise one or more of the mutations E542K, E545K, E545A and E545G (i.e. mutations/SNP in exon 9 encoding the amino acid K, A or G at position 542 or 545 of the amino acid sequence of Phosphatidylinositol-3 kinase (PIK3CA) instead of wildtype E. The term E542K, E545K, E545A and E545G as used herein refer to amino acid substitutions at a given position of the amino acid sequence of wild type PIK3CA. Corresponding nucleic acid sequences (codons/triplets) encoding the amino acid at positions 542 and 545 in wild type and mutant PIK3CA genes/coding sequences are described below. In accordance with internationally accepted nomenclature, the term “E542K” refers to a substitution/replacement of amino acid “E” at position 542 of the amino acid sequence of wild type PIK3CA by amino acid “K”. The same explanation applies, mutatis mutandis, to “E545K”, “E545A” and “E545G”. These mutations are well known in the art and corresponding mutated sequences can be retrieved from the respective databases like Uniprot. Based on the herein provided teaching, the presence of these mutations can readily be determined by a person skilled in the art. Preferably, the mutation is determined on a nucleic acid level as described below and exemplified in the examples. The mutations E542K E545K, E545A and E545G are also illustrated in the herein described sequences. For example, nucleic acid and amino acid sequences of mutation (mutational SNP) E542K are shown in SEQ ID NO. 17 and SEQ ID NO. 18, respectively; nucleic acid and amino acid sequences of mutation E545K are shown in SEQ ID NO: 19 and SEQ ID NO. 20, respectively; nucleic acid and amino acid sequences of mutation E545A are shown in SEQ ID NO: 21 and SEQ ID NO. 22, respectively, and nucleic acid and amino acid sequences of mutation E545G are shown in SEQ ID NO: 23 and SEQ ID NO. 24, respectively.
  • Methods for the determining/evaluation assessed/measured of the presence of the mutations are described herein and provided in the examples. Exemplary, non-limiting methods to be used are methods for sequencing of nucleic acids (e.g. Sanger di-deoxy sequencing), “next generation” sequencing methods, single molecule sequencing, methods enabling detection of variant alleles/mutations, such as Real-time PCR, PCR-RFLP assay (see Cancer Research 59 (1999), 5169-5175), mass-spectrometric genotyping (e.g. MALDI-TOF), HPLC, enzymatic methods and SSPC (single strand conformation polymorphism analysis; see Pathol Int (1996) 46, 801-804).
  • Such methods may include enzymatic amplification of DNA or cDNA fragments using oligonucleotides specifically hybridizing to exon 9 (or parts thereof) of the PIK3CA gene by PCR. Given that mutations in exon 9 of the PIK3CA gene are to be evaluated, such amplifications may be carried out in one or two reactions when employing RNA or genomic DNA. The resulting PCR products may be subjected to either conventional Sanger-based dideoxy nucleotide sequencing methods or employing parallel sequencing methods (“next generation sequencing”) such as those marketed by Roche (454 technology), Illumina (Solexa technology) or ABI (Solid technology). Mutations may be identified from sequence reads by comparison with publicly available gene sequence data bases. Alternatively, mutations may be identified by incorporation of allele-specific probes that can either be detected using enzymatic detection reactions, fluorescence, mass spectrometry or others; see Vogeser (2007) Dtsch Arztebl 104 (31-32), A2194-200.
  • Paraffin-embedded clinical material as well as fresh frozen tissue may be used in the detection of these mutations. Detection may comprise a histolopathology review of the sample to be tested to see whether tumour tissue is present. The following table shows exemplary nucleic acid sequences of the mutations (mutational SNPs) to be determined in accordance with the present invention; any other point mutation(s) that result in an amino acid change at position 542 and/or 545 (or position 546, like the E545D mutation having the sequence “gat”/“T” mutation”) of full-length the amino acid sequence of PIK3CA can be included in the assessment in accordance with the present invention.
  • gaa codon/triplet encoding wild type E542
    gag codon/triplet encoding wild type E545
    aaa codon/triplet encoding mutant E542K ((E >> K)
    aag codon/triplet encoding mutant E545K (E >> K),
    gcg codon/triplet encoding mutant E545A (E >> A),
    ggg codon/triplet encoding mutant E545G(E >> G),
  • Accordingly, the term “mutation E542K in exon 9 of Phosphoinositol-3 kinase (PIK3CA)” as used herein may refer to a codon/triplet (like aaa) encoding amino acid K at position 542 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2). The term “mutation E545K in exon 9 of Phosphoinositol-3 kinase (PIK3CA)” as used herein may refer to a codon/triplet (like aag) encoding amino acid K at position 545 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2). The term “mutation E545A in exon 9 of Phosphoinositol-3 kinase (PIK3CA)” as used herein may refer to a codon/triplet (like gcg) encoding amino acid A at position 545 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2). The term “mutation E545G in exon 9 of Phosphoinositol-3 kinase (PIK3CA)” as used herein may refer to a codon/triplet (like ggg) encoding amino acid G at position 545 of the full-length amino acid sequence of PIK3CA (the wild-type sequence thereof is shown in FIG. 7 and SEQ ID NO: 2).
  • The following exemplary test may be used.
  • The PCR amplification of isolated DNA and mutation detection procedures for the PIK3CA mutation detection test are summarized below.
  • Each standard 50-μL amplification reaction targeting one of the Exons 7, 9 or 20 included 100 ng genomic DNA, dNTPs (including dUTP), 0.05 U/μL Z05, DNA polymerase, 0.04 U/μL uracil-DNA glycosylase (UNG), and 200-400 nM forward and reverse primer (Table 1), 75-200 nM mutant and wild-type specific probes (Table 2). Amplification was performed in the Cobas® 4800 analyzer using the following temperature profile: 5 min at 50° C. followed by 55 cycles of 95° C. for 10 sec and 63° C. for 50 sec, followed by a single round of 40° C. for 2 min and 25° C. for 10 sec (melting curve analysis). Fluorescence data was collected during each amplification cycle and during the final melting curve analysis.
  • The following exemplary primers/primer pair may be used in the method for identifying a non-responder to a HER2-inhibitor provided herein, wherein the non-responder has a mutation in exon 9 of PIK3CA.
  • TABLE 1
    Primer Sequences for the PIK3CA Mutation Detection Test
    Primer Sequence 5′ to 3′
    542/545 Forward primer UAAAAUUUAUUGAGAAUGUAUUUGCTTTTTC (SEQ ID NO: 25)
    PIK3CA-9F13
    542/545 Reverse primer TCCATTTTAGCACTTACCTGTGAC (SEQ ID NO: 26)
    PIK3CA-9R01
    Key:
    U = 5-propynyl dU
  • The following exemplary probes may be used in the method for identifying a non-responder to a HER2-inhibitor provided herein, wherein the non-responder has a mutation in exon 9 of PIK3CA.
  • TABLE 2
    Probe Sequence for the PIK3CA Mutation Detection Test
    Probe Sequence 5′ to 3′
    542 WT Probe FTTTCAQAGAGAGGAUEUEGUGUAGAAAUUGEP (SEQ ID NO: 27)
    542 542K Mutation Probe LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (SEQ ID NO: 28)
    545 WT Probe OCTGCTCAGTQAUUUIAGAGAGAGGATCTCGTGTP (SEQ ID NO: 29)
    545 545K Mutation Probe JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (SEQ ID NO: 30)
    545 545A Mutation Probe FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (SEQ ID NO: 31)
    545 545G Mutation Probe LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (SEQ ID NO: 32)
    Key:
    F = FAM Reporter Dye,
    J = JA270 Reporter Dye,
    O = CY5.5 Reporter Dye,
    L = HEX Reporter Dye,
    U = 5-propynyl dU,
    E = 5-methyl dC,
    I = deoxyinosine,
    Z = 7-deaza dG,
    Q = BHQ2 Quencher Dye,
    P = 3′ Phosphate
  • In accordance with the present invention, the presence of one or more mutations in exon 9 of PIK3CA may be evaluated/determined/measured in the herein provided method for identifying a non-responder to HER2 inhibitors (the terms “evaluating”, “determining” and “measuring” can be used interchangeably in context of the present invention). In one embodiment, the presence of only one of the mutations is evaluated/determined. Accordingly, the presence of only one of the E542K, E545K, E545A and E545G mutations of PIK3CA (i.e. the nucleic acids in exon 9 of PIK3CA encoding the amino acid at these positions in the full length amino acid sequence of PIK3CA) may be evaluated, i.e. only E542K, only E545K, only E545A or only E5450. The methods of the present invention may also comprise the subsequent evaluation of the presence of two or more of these mutations in any order. For example, the evaluation of the presence of E542K may be followed by the evaluation of E545K (or vice versa) which may be followed by the evaluation of the presence of E545A, which may be followed by the evaluation of the presence of E545G. Other possible orders of evaluation are easily conceivable by a person skilled in the art and contemplated herein.
  • The mutations may be evaluated in combination/simultaneously. Again, any combination is envisaged. For example, the presence of E542K and E545K is evaluated; or the presence of E542K and E545A; or the presence of E542K and E545G is evaluated. Other combinations are easily conceivable. The evaluation of a combination of these mutations may be followed or preceded by the evaluation of the presence of one other mutation or a combination of other mutations.
  • As mentioned, the present invention provides for means to determine whether an individual/patient with HER2-positive cancer (i.e. suffering from, suspected to suffer from or being prone to suffer from HER2-positive cancer) will respond to treatment with a HER2 inhibitor or will not respond to treatment to a HER2 inhibitor. This assessment may be advantageously done before the start of treatment with the HER2 inhibitor. Even if a patient has been treated with a HER2 inhibitor, a person skilled in the art can determine whether a person showed no response after the treatment with the HER2 inhibitor. For example, a non-response to an inhibitor may be reflected in an increased suffering from cancer, such as an increased growth of a cancer/tumor and/or increase in the size of a tumor, the (increase in) the formation of metastases or a increase in the number or size of metastases. A non-response may also be the development of a tumor or metastases, for example after resection of a tumor, in the shortening of time to disease progression, or in the increase in the size of (a) tumor(s) and/or (a) metastases, for example in neoadjuvant therapy.
  • In accordance with the methods provided in the present invention a patient group can be identified that does not respond to treatment with HER2 inhibitors, like Pertuzumab or Trastuzumab. It has been found herein that some individuals with HER2 positive cancer or cancer cells do not adequately respond to treatment with a HER2 inhibitor, if the patients have mutations in exon 9 of PIK3CA. In one embodiment of the present invention, at least 80%, 90%, 95% or more of the patient group identified by the herein provided method do not respond to treatment with a HER2 inhibitor. That means that at least 80% of the identified individuals having the herein described mutation(s) in exon 9 of PIK3CA will not respond to the treatment with the herein defined HER2 inhibitors, like Pertuzumab or Trastuzumab.
  • As the skilled artisan fully appreciates a positive test for one or more mutations in exon 9 of PIK3CA in a sample of a patient with HER2-positive cancer does not indicate that the patient will not respond to treatment with absolute certainty. However, by the herein provided methods sub-groups of patients are identified that have a lower chance of response (=show a lower response rate) to a treatment with a HER2 inhibitor like pertuzumab or trastuzumab as compared to the sub-groups of patients not having these mutations in exon 9 of PIK3CA. With other words the determination of a presence of one or more mutations in exon 9 of PIK3CA indicates (=is indicative for) that the patient has a lower chance (=probability, likelihood) to respond to treatment with a HER2 inhibitor, as compared to a patient having no mutation in exon 9 of PIK3CA (wild type PIK3CA). Preferably, the response is pathologic complete response (pCR). The term “pCR” as used herein refers to the absence of invasive cancer cells in tissue like breast tissue or absence of invasive tumor cells in tissue like breast tissue and/or lymph nodes. pCR is commonly used as an endpoint in neoadjuvant treatment such as in breast cancer treatment.
  • The term “HER2-positive cancer” as used herein refers to a cancer/tumorous tissue etc. which comprises cancer cells which have higher than normal levels of HER2. Examples of HER2-positive cancer include HER2-positive breast cancer and HER2-positive gastric cancer. For the purpose of the present invention, “HER2-positive cancer” has an immunohistochemistry (IHC) score of at least 2+ and/or an in situ hybridization (ISH) amplification ratio ≧2.0 (i.e. is ISH-positive). Accordingly, HER2-positive cancer is present if a high HER2 (protein) expression level detected e.g. by immunohistochemical methods and/or HER2 gene amplification detected by in-situ-hybridization (ISH) positive, like a HER2 gene copy number higher than 4 copies of the HER2 gene per tumor cell or ratio of ≧2.0 for the number of HER2 gene copies to the number of signals for CEP17.) is found in samples obtained from die patients such as breast tissue biopsies or breast tissue resections or in tissue derived from metastatic sites. In one embodiment “HER2-positive cancer” has an immunohistochemistry (IHC) score of HER2(3+) and/or is ISH positive.
  • The expression level of HER2 may be detected by an immunohistochemical method, whereas said HER2 gene amplification status can be measured with in situ hybridization methods, like fluorescence in situ hybridization techniques (FISH). Corresponding assays and kits are well known in the art, for protein expression assays as well as for the detection of gene amplifications. Alternatively other methods like qRT-PCR might be used to detect levels of HER2 gene expression.
  • The expression level of HER2 can, inter alia, be detected by an immunohistochemical method. Such methods are well known in the art and corresponding commercial kits are available. Exemplary kits which may be used in accordance with the present invention are, inter alia, HerceptTest™ produced and distributed by the company Dako or the test called Ventana Pathway™. The level of HER2 protein expression may be assessed by using the reagents provided with and following the protocol of the HercepTest™. A skilled person will be aware of further means and methods for determining the expression level of HER2 by immunohistochemical methods; see for example WO 2005/117553. Therefore, the expression level of HER2 can be easily and reproducibly determined by a person skilled in the art without undue burden. However, to ensure accurate and reproducible results, the testing must be performed in a specialized laboratory, which can ensure validation of the testing procedures.
  • The expression level of HER2 can be classified in a low expression level, an intermediate expression level and a high expression level. It is preferred in context of this invention that HER2-positive disease is defined by a strong expression level of HER2 (e.g. HER2(3+) by THC), for example determined in a sample of a cancer patient.
  • The recommended scoring system to evaluate the IHC staining patterns which reflect the expression levels of HER2 designated herein HER2(0), HER2(+), HER2(++) and HER2(+++), is as follows:
  • Staining HER2
    Intensity overexpression
    Score Staining Pattern assessment
    0  No staining is observed or membrane staining is observed negative
    in <10% of the tumor cells
    1+ A faint/barely perceptible membrane staining is detected negative
    in >10% of the tumor cells. The cells are only stained in
    part of their membrane.
    2+ A weak to moderate complete staining is detected in >10 weak to moderate
    % of the tumor cells. overexpression.
    3+ A strong complete membrane staining is detected in >10 strong
    % of the tumor cells. overexpression.
  • The terms HER2(+), HER2(++) and HER2(+++) used herein are equivalent to the terms HER2(1+), HER2(2+) and HER2(3+). A “low protein expression level” used in context of this invention corresponds to a 0 or 1+ score (“negative assessment” according to the table shown herein above), an “weak to moderate protein expression level” corresponds to a 2+ score (“weak to moderate overexpression”, see the table above) and a “high protein expression level” corresponds to a 3+ score (“strong overexpression”, see the table above). As described herein above in detail, the evaluation of the protein expression level (i.e. the scoring system as shown in the table) is based on results obtained by immunohistochemical methods. As a standard or routinely, the HER-2 status is, accordingly, performed by immunohistochemistry with one of two FDA-approved commercial kits available; namely the Dako Herceptest™ and the Ventana Pathway™. These are semi-quantitative assays which stratify expression levels into 0 (<20,000 receptors per cell, no expression visible by IHC staining), 1+(˜100,000 receptors per cell, partial membrane staining, <10% of cells overexpressing HER-2), 2+(˜500,000 receptors per cell, light to moderate complete membrane staining, >10% of cells overexpressing HER-2), and 3+(˜2,000,000 receptors per cell, strong complete membrane staining, >10% of cells overexpressing HER-2).
  • Alternatively, further methods for the evaluation of the protein expression level of HER2 may be used, e.g. Western Blots, ELISA-based detection systems and so on.
  • A HER2-positive cancer may also be diagnosed by assessing the gene amplification status of HER2. HER2-positive cancer is, accordingly, diagnosed if this assessment by ISH is positive. In accordance with this assessment, a HER2-positive cancer may, inter alia, relate to an average HER2 gene copy number higher than 4 copies of the HER2 gene per tumor cell (for those test systems without an internal centromere control probe) or to a HER2/CEP17 ratio of >=2.0 (for those test systems using an internal chromosome 17 centromere control probe). In other words, the HER2-positive cancer may, inter alia, relate to a HER2 gene copy number greater than 4. The amplification level of the HER2 gene may easily be identified by in situ hybridization (ISH) like fluorescent in situ hybridization (FISH), chromogenic in situ hybridization (CISH) and silver in situ hybridization (SISH). These methods are known to the skilled artisan. The principles of these methods can be deduced from standard text books. Commercial kits for the determination of the HER2 gene amplification status by in situ hybridization are available.
  • The HER2-positive cancer may be breast cancer or gastric cancer. Further, the HER2-positive cancer may be ovarian cancer, lung cancer, colorectal cancer, kidney cancer, bone cancer, bone marrow cancer, bladder cancer, skin cancer, prostate cancer, esophagus cancer, salivary gland cancer, pancreas cancer, liver cancer, head and neck cancer, CNS (especially brain) cancer, cervix cancer, cartilage cancer, colon cancer, genitourinary cancer, gastrointestinal tract cancer, pancreas cancer, synovium cancer, testis cancer, thymus cancer, thyroid cancer and uterine cancer. In one embodiment the breast cancer is early-stage breast cancer, as also assessed in the appended example.
  • The sample to be assessed in accordance with the herein provided methods for identification a non-responder to a HER2 inhibitor may comprise non-diseased cells and/or diseased cells, i.e. non-cancerous cells and/or cancerous cells however the content of cancerous cells among non cancerous cells should be higher than 50%. The sample may also (or even solely) comprise cancer/tumor cell(s), such as breast cancer/tumor cell(s). The term “sample” shall generally mean any biological sample obtained from a patient's tumor. The sample may be a tissue resection or a tissue biopsy. The sample may also be a metastatic lesion or a section of a metastatic lesion or a blood sample known or suspected to comprise circulating tumor cells. In accordance with the above, the biological sample may comprise cancer cells and to a certain extent i.e. less than 50% non-cancer cells (other cells). The skilled pathologist is able to differentiate cancer cells from normal tissue cells. Methods for obtaining tissue biopsies, tissue resections and body fluids and the like from mammals, such as humans, are well known in the art.
  • As mentioned, the sample is obtained from a patient with HER2-positive cancer as defined above. For example, the sample may be obtained from a tumorous tissue, (a) tumor(s) and, accordingly, is (a) tumor cell(s) or (a) tumor tissue(s) suspected of being HER2-positive tumour, like a breast tumor and the like. A person skilled in the art is in the position to identify such tumors and/or individuals/patients suffering from corresponding cancer using standard techniques known in the art and methods disclosed herein. Generally, said tumor cell or cancer cell may be obtained from any biological source/organism, particularly any biological source/organism, suffering from the above-mentioned cancer. In context of this invention particular useful cells are, preferably, human cells. These cells can be obtained from e.g. biopsies or from biological samples. The tumor/cancer/tumor cell/cancer cell is a solid tumor/cancer/tumor cell/cancer cell. In accordance with the above, the cancer/tumor cell may be a breast cancer/tumor cell or said sample comprises a cancer/tumor cell, such as a breast cancer/tumor cell. In line with the above, said tumor/cancer may be a breast tumor/cancer.
  • The method for identifying a non-responder to a HER2-inhibitor provided herein may further comprise obtaining a sample of tissue from a patient with HER2-positive cancer prior to said step of identifying. The tissue may be cancerous tissue. The method may further comprise adjusting the treatment of the patient in response to the presence of said one or more mutations in exon 9.
  • The identification of non-responders allows for the treatment of patients that do not have the mutations in exon 9 of PIK3CA, as these patients respond well to treatment with HER2 inhibitor(s), such as Pertuzumab. Accordingly, the present invention relates in one embodiment to an inhibitor of HER2 for use in treating a patient with HER2-positive cancer, whereby the cancer has been found to be PIK3CA mutation-negative in Exon 9 of PIK3CA. Also the use of an inhibitor of HER2 for the preparation of a pharmaceutical composition for the treatment of a HER2-positive cancer patient is envisaged, whereby the cancer has been found to be PIK3CA mutation-negative.
  • Further, the present invention relates to the use of a HER2 inhibitor to treat a HER2-positive cancer patient by administering the HER2 dimerization inhibitor in an amount effective to treat the cancer, provided the cancer has been found to be PIK3CA mutation-negative. Accordingly, a method for the treatment of a HER2-positive cancer patient is provided which comprises administering the HER2 dimerization inhibitor in an amount effective to treat the cancer, provided the cancer has been found to be PIK3CA mutation-negative. The term “PIK3CA mutation-negative” as used herein means that the mutations are not present (absent). As mentioned above, the PIK3CA mutation comprises or consists of preferably one or more mutations in exon 9 of Phosphoatidylinositol-3 kinase (PIK3CA) as defined herein above. Preferably, the patient is a human.
  • In one embodiment of the present invention, the HER2 inhibitor is to be administered as a single anti-tumor agent. In a further embodiment, the inhibitor may be administered in form of a combination therapy, such as chemotherapy, an anti-hormonal therapy and/or another HER2 targeted agent/another HER2 targeted therapy in addition.
  • The chemotherapy may be docetaxel, anthracycline/taxane chemotherapy, therapy with an anti-metabolite agents, therapy with an anti-hormonal compound, therapy with an anti-estrogen, therapy with a tyrosine kinase inhibitor, therapy with a raf inhibitor, therapy with a ras inhibitor, therapy with a dual tyrosine kinase inhibitor, therapy with taxol, therapy with taxane, therapy with doxorubicin, therapy with adjuvant (anti-) hormone drugs and/or therapy with cisplatin and the like. In accordance with the present invention, the HER2 inhibitor may be administered by any one of a parenteral route, oral route, intravenous route, subcutaneous route, intranasal route or transdermal route. Further, the HER2 inhibitor may be employed in a neoadjuvant or adjuvant setting. Accordingly, said HER2 inhibitor may be administered to a patient in need of such a treatment and having the herein defined biomarker status before, during or after a surgical intervention/resection of the cancerous tissue. Therefore, the present invention is useful in neoadjuvant therapy, i.e. the treatment with the herein defined HER2 inhibitor (like Pertuzumab or Trastuzumab) given to the herein defined cancer patient group prior to surgery, as well as in adjuvant therapy. Again, the patient group of the present invention to be treated by the means and methods provided herein (in particular with Pertuzumab) are cancer patients without one or more mutations in exon 9 of PIK3CA. The attending physician may modify, change or amend the administration schemes for the HER2 inhibitor in accordance with his/her professional experience.
  • In one embodiment, the HER2 inhibitor is a HER dimerization/signaling inhibitor or an inhibitor of HER2 shedding. The HER dimerization inhibitor may be a HER2 dimerization inhibitor. HER dimerization inhibitor inhibits HER heterodimerization or HER homodimerization. The HER dimerization inhibitor may be an anti-HER antibody.
  • The term “antibody” herein is used in the broadest sense and specifically covers intact monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies) formed from at least two intact antibodies, and antibody fragments, so long as they exhibit the desired biological activity. Also human and humanized as well as CDR-grafted antibodies are comprised.
  • The HER antibody may bind to a HER receptor selected from the group consisting of EGFR, HER2 and HER3. Preferably, the antibody binds to HER2. In one embodiment, the anti HER2 antibody may bind to domain II of HER2 extracellular domain. In another embodiment, the antibody may bind to a junction between domains I, II and III of HER2 extracellular domain. Most preferably, the anti HER2 antibody is Pertuzumab.
  • For the purposes herein, “Pertuzumab” and “rhuMAb 2C4”, which are used interchangeably, refer to an antibody comprising the variable light and variable heavy domains (amino acid sequences thereof shown in SEQ ID Nos. 5 and 6, respectively, as depicted in FIG. 2). The variable light and variable heavy domains of variant 574/Pertuzumab are also shown in FIG. 2 (amino acid sequences thereof shown in SEQ ID Nos. 7 and 8, respectively, as depicted in FIG. 2). Where Pertuzumab is an intact antibody, it preferably comprises an IgG1 antibody; in one embodiment comprising the light chain amino acid sequence in it preferably comprises the light chain and heavy chain amino acid sequences in SEQ ID Nos. 11 and 12, respectively, as shown in FIG. 3A/3B and 5A/5B (FIG. 5A/5B show the light chain and heavy chain amino acid sequences of a variant Pertuzumab, SEQ ID NOs: 15 and 16, respectively). The heavy chain amino acid sequences of Pertuzumab as shown in SEQ ID NO: 12 (FIG. 3B) may optionally comprise an additional amino acid “K” at position 449 at the C-terminus. The antibody is optionally produced by recombinant Chinese Hamster Ovary (CHO) cells. The terms “Pertuzumab” and “rhuMAb 2C4” herein cover biosimilar versions of the drug with the United States Adopted Name (USAN) or International Nonproprietary Name (INN): Pertuzumab. Again, corresponding sequences are shown in FIGS. 2 to 5.
  • In a further embodiment, the inhibitor of HER shedding is a HER2 shedding inhibitor. The inhibitor of HER shedding may inhibit HER heterodimerization or HER homodimerization. Said inhibitor of HER shedding may be an anti-HER antibody. The anti-HER antibody may bind to a HER receptor selected from the group consisting of EGFR, HER2 and HER3. Preferably, the antibody binds to HER2. In one embodiment, the HER2 antibody binds to sub-domain IV of the HER2 extracellular domain. Preferably, the HER2 antibody is Herceptin™/Trastuzumab.
  • For the purposes herein, “Trastuzumab” and “rhuMAb4D5-8”, which are used interchangeably, refer to an antibody comprising the variable light domains and variable heavy domains (amino acid sequences thereof are shown in FIG. 4 in SEQ ID NO: 13 and 14, respectively; the domain is indicated by arrows). Where Trastuzumab is an intact antibody, it preferably comprises an IgG1 antibody; in one embodiment comprising the light chain amino acid sequence of SEQ ID NO: 13 and the heavy chain amino acid sequence of SEQ ID NO: 14 as shown in FIG. 4. The antibody is optionally produced by Chinese Hamster Ovary (CHO) cells. The terms “Trastuzumab” and “rhuMAb4D5-8” herein cover biosimilar versions of the drug with the United States Adopted Name (USAN) or International Nonproprietary Name (INN): Trastuzumab.
  • The HER2 positive cancer to be treated may be breast cancer, such early stage breast cancer. The term “early-stage breast cancer” as used herein refers to breast cancer that has not spread beyond the breast or the axillary lymph nodes. Such cancer is generally treated with neoadjuvant or adjuvant therapy. “Neoadjuvant therapy” refers to systemic therapy given prior to surgery. “Adjuvant therapy” refers to systemic therapy given after surgery. Also other HER2 positive cancer types like gastric cancer can be treated in accordance with the present invention. In one embodiment, the treatment is neoadjuvant or adjuvant therapy of the early-stage breast cancer.
  • The pharmaceutical composition to be employed in the medical uses of the present invention, will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient, the site of delivery of the pharmaceutical composition, the method of administration, the scheduling of administration, and other factors known to practitioners. The “effective amount” of the pharmaceutical composition for purposes herein is thus determined by such considerations.
  • The skilled person knows that the effective amount of pharmaceutical composition administered to an individual will, inter alia, depend on the nature of the compound. For example, if said compound is a (poly)peptide or protein the total pharmaceutically effective amount of pharmaceutical composition administered parenterally per dose will be in the range of about 1 μg protein/kg/day to 10 mg protein/kg/day of patient body weight, although, as noted above, this will be subject to therapeutic discretion. More preferably, this dose is at least 0.01 mg protein/kg/day, and most preferably for humans between about 0.01 and 1 mg protein/kg/day.
  • The following administration may be employed in respect of Pertuzumab:
  • A dosing regimen of pertuzumab administered every 3 weeks to patients in Phase II studies (TOC2689g, RO16934) using a fixed 840 mg loading dose (equivalent to 12 mg/kg for a 70 kg patient) for treatment cycle I followed by a fixed 420 mg “maintenance” dose (equivalent to 6 mg/kg) for subsequent treatment cycles resulted in steady-state serum trough concentrations of approximately 60 μg/mL by the second treatment cycle. A dose based on body-surface area or weight was not superior to a fixed dose, supporting the continued use of a fixed dose of pertuzumab in female patients with locally advanced, inflammatory or early stage HER2-positive breast cancer, metastatic breast cancer and ovarian cancer.
  • If given continuously, the pharmaceutical composition is typically administered at a dose rate of about 1 μg/kg/hour to about 50 g/kg/hour, either by 1-4 injections per day or by continuous subcutaneous infusions, for example, using a mini-pump. An intravenous bag solution may also be employed. The length of treatment needed to observe changes and the interval following treatment for responses to occur appears to vary depending on the desired effect. The particular amounts may be determined by conventional tests which are well known to the person skilled in the art. Pharmaceutical compositions of the invention may be administered orally, rectally, parenterally, intracisternally, intravaginally, intraperitoneally, topically (as by powders, ointments, drops or transdermal patch), bucally, or as an oral or nasal spray.
  • Pharmaceutical compositions of the invention may comprise a pharmaceutically acceptable carrier. By “pharmaceutically acceptable carrier” is meant a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type. The term “parenteral” as used herein refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrasternal, subcutaneous and intraarticular injection and infusion.
  • The pharmaceutical composition is also suitably administered by sustained release systems. Suitable examples of sustained-release compositions include semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules. Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman, U. et al., Biopolymers 22:547-556 (1983)), poly (2-hydroxyethyl methacrylate) (R. Langer et al., J. Biomed. Mater. Res. 15:167-277 (1981), and R. Langer, Chem. Tech. 12:98-105 (1982)), ethylene vinyl acetate (R. Langer et al., Id.) or poly-D-(−)-3-hydroxybutyric acid (EP 133,988). Sustained release pharmaceutical composition also include liposomally entrapped compound. Liposomes containing the pharmaceutical composition are prepared by methods known per se: DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. (USA) 82:3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci. (USA) 77:4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; Japanese Pat. Appl. 83-118008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324. Ordinarily, the liposomes are of the small (about 200-800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol. percent cholesterol, the selected proportion being adjusted for the optimal therapy.
  • For parenteral administration, the pharmaceutical composition is formulated generally by mixing it at the desired degree of purity, in a unit dosage injectable form (solution, suspension, or emulsion), with a pharmaceutically acceptable carrier, i.e., one that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation.
  • Generally, the formulations are prepared by contacting the components of the pharmaceutical composition uniformly and intimately with liquid carriers or finely divided solid carriers or both. Then, if necessary, the product is shaped into the desired formulation. The carrier may be a parenteral carrier, such as a solution that is isotonic with the blood of the recipient. Examples of such carrier vehicles include water, saline, Ringer's solution, and dextrose solution. Non aqueous vehicles such as fixed oils and ethyl oleate are also useful herein, as well as liposomes. The carrier suitably contains minor amounts of additives such as substances that enhance isotonicity and chemical stability. Such materials are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, succinate, acetic acid, and other organic acids or their salts; antioxidants such as ascorbic acid; low molecular weight (less than about ten residues) (poly)peptides, e.g., polyarginine or tripeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids, such as glycine, glutamic acid, aspartic acid, or arginine; monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, manose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; counterions such as sodium; and/or nonionic surfactants such as polysorbates, poloxamers, or PEG.
  • The components of the pharmaceutical composition to be used for therapeutic administration must be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 micron membranes). Therapeutic components of the pharmaceutical composition generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
  • The components of the pharmaceutical composition ordinarily will be stored in unit or multi-dose containers, for example, sealed ampoules or vials, as an aqueous solution or as a lyophilized formulation for reconstitution. As an example of a lyophilized formulation, 10-ml vials are filled with 5 ml of sterile-filtered 1% (w/v) aqueous solution, and the resulting mixture is lyophilized. The infusion solution is prepared by reconstituting the lyophilized compound(s) using bacteriostatic Water-for-Injection.
  • Another embodiment of the present invention relates to the use of a nucleic acid or antibody capable of detecting a mutation in exon 9 of PIK3CA for identifying a non-responder to a HER2-inhibitor in accordance with the herein provided methods. The oligonucleotide(s) may be about 15 to 100 nucleotides in length.
  • Accordingly, the present invention relates in one embodiment to a forward primer having the sequence 5′-UAAAAUUUAUUGAGAAUGUAUUUGCTTTTITC-3′ (SEQ ID NO: 25). This forward primer can be used in amplification of exon 9 or a part thereof encoding the mutant triplet which encodes position 542 and/or 545 of the herein described mutant exon 9 of PIKC3A. In a further embodiment, the present invention relates to a reverse primer having the sequence 5′-TCCATTTTAGCACTTACCTGTGAC-3′ (SEQ ID NO: 26). This reverse primer can also be used in amplification of exon 9 or a part thereof encoding the mutant triplet which encodes position 542 and/or 545 of the herein described mutant exon 9 of PIKC3A. The present invention provides a primer pair of the forward primer having the sequence 5′-UAAAAUUUAUUGAGAAUGUAUUUGCTTTTTC-3′ (SEQ ID NO: 25) and the reverse primer having the sequence 5′-TCCATTTTAGCACTTAACCTGTGAC-3′ (SEQ ID NO: 26).
  • In a further embodiment, the present invention relates to probe(s)/probe sequence(s) for evaluating/determining the presence of one or more mutations in exon 9 of PIK3CA. In one embodiment, the present invention relates to a probe having the sequence 5′-FTTTCAQAGAGAGGAUEUEGUGUAGAAAUUGEP-3′ (“542 WT Probe”) (SEQ ID NO: 27). In one embodiment, the present invention relates to a probe having the sequence 5′-LATTTTQOAGAOAGOAUEUEOUGUAGAAAUUGEUUP-3′ (542K Mutation Probe) (SEQ ID NO: 28). In one embodiment, the present invention relates to a probe having the sequence 5′-OCTGCTCAGTQAUUUIAAGAGAGGATCTCGTGTP-3′ (545 WT Probe) (SEQ ID NO: 29). In one embodiment, the present invention relates to a probe having the sequence 5′-JAATCACTAAGQAGGAGAAAGAIUUUEUAUGGAGUEP-3′ (545K Mutation Probe) (SEQ ID NO: 30). In one embodiment, the present invention relates to a probe having the sequence 5′-FCTOCGCQGGAGAAAGAUUUUEUAUGOAGUEAP-3′ (545A Mutation Probe) (SEQ ID NO: 31). In one embodiment, the present invention relates to a probe having the sequence 5′-LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP-3′ (545G Mutation Probe) (SEQ ID NO: 32). In this context, the following abbreviations used: F=FAM Reporter Dye, J=JA270 Reporter Dye, O=CY5.5 Reporter Dye, L=HEX Reporter Dye, U=5-propynyl dU, E=5-methyl dC, I=deoxyinosine, Z=7-deaza dG, Q=BHQ2 Quencher Dye, P=3′ Phosphate
  • A person skilled in the art is, based on his general knowledge and the teaching provided herein, in the position to identify and/or prepare further oligo- or polynucleotide(s) for use in the present methods. In particular these oligo- or polynucleotides may be used as probe(s) in the detection methods described herein. A skilled person will know, for example, computer programs which may be useful for the identification of corresponding probes to be used herein. For example, the PIK3CA coding sequence (SEQ ID NO: 1) may be used in this context. Exemplary nucleic acid sequences are available on corresponding databases, such as the NCBI database (www.ncbi.nlm.nih.gov/sites/entrez).
  • The present invention also relates to a kit useful for carrying out the herein provided methods, the kit comprising a nucleic acid or an antibody capable of detecting a mutation in exon 9 of PIK3CA. Also envisaged herein is the use of the herein described kit for carrying out the herein provided methods.
  • For example, said kit may comprise (a) compound(s) required for specifically determining the one or more mutations in exon 9 of PIK3CA. Moreover, the present invention also relates to the use of (a) compound(s) required for specifically determining the presence of one or more mutations in exon 9 of PIK3CA for the preparation of a kit for carrying out the methods or uses of this invention.
  • On the basis of the teaching of this invention, the skilled person knows which compound(s) is (are) required for specifically determining the presence of one or more mutations in exon 9 of PIK3CA. Particularly, such compound(s) may be (a) (nucleotide) probe(s), (a) primer(s) (pair(s)), (an) antibody(ies) and/or (an) aptamer(s) specific to the mutation described herein. The kit (to be prepared in context) of this invention may be a diagnostic kit.
  • The kit (to be prepared in context) of this invention or the methods and uses of the invention may further comprise or be provided with (an) instruction manual(s). For example, said instruction manual(s) may guide the skilled person (how) to determine one or more mutations in exon 9 of PIK3CA i.e. (how) to diagnose non-responsiveness to a HER2 inhibitor. Particularly, said instruction manual(s) may comprise guidance to use or apply the herein provided methods or uses.
  • The kit (to be prepared in context) of this invention may further comprise substances/chemicals and/or equipment suitable/required for carrying out the methods and uses of this invention. For example, such substances/chemicals and/or equipment are solvents, diluents and/or buffers for stabilizing and/or storing (a) compound(s) required for specifically determining the presence of a mutation in exon 9 of PIK3CA.
  • The present invention relates to a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
    • (a) contacting the nucleic acid in the sample with at least one mutation-specific oligonucleotide from Table 2;
    • (b) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid.
  • TABLE 2
    Probe Sequences for the PIK3CA Mutation Detection Test
    Probe Sequence 5′ to 3′
    542 WT Probe FTTTCAQAGAGAGGAUEUEGUGUAGAAAUUGEP (SEQ ID NO: 27)
    542 542K Mutation Probe LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (SEQ ID NO: 28)
    545 WT Probe OCTGCTCAGTQAUUUIAGAGAGAGGATCTCGTGTP (SEQ ID NO: 29)
    545 545K Mutation Probe JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (SEQ ID NO: 30)
    545 545A Mutation Probe FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (SEQ ID NO: 31)
    545 545G Mutation Probe LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (SEQ ID NO: 32)
    Key:
    F = FAM Reporter Dye,
    J = JA270 Reporter Dye,
    O = CY5.5 Reporter Dye,
    L = HEX Reporter Dye,
    U = 5-propynyl dU,
    E = 5-methyl dC,,
    I = deoxyinosine,
    Z = 7-deaza dG,
    Q = BHQ2 Quencher Dye,
    P = 3′ Phosphate
  • The present invention relates to a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
    • (a) contacting the nucleic acid in the sample with one or more of the following mutation-specific oligonucleotides:
  • (542 542K Mutation Probe);
    (SEQ ID NO: 28)
    LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP
    (545 545K Mutation Probe);
    (SEQ ID NO: 30)
    JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP
    (545 545A Mutation Probe);
    (SEQ ID NO: 31)
    FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP
    and/or
    (545 545G Mutation Probe);
    (SEQ ID NO: 32)
    LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP
    • (b) incubating the sample under conditions allowing hybridization of the one or more oligonucleotide to the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid.
  • The method may further comprise, prior to detection is step (c), contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1 and generating an amplification product containing the target sequence within the PI3KCA nucleic acid.
  • TABLE 1
    Primer Sequences for the PIK3CA Mutation
    Detection Test
    Primer Sequence 5′ to 3′
    542/545 Forward primer UAAAAUUUAUUGAGAAUGUAUUUGCTTTTTC (SEQ ID NO: 25)
    PIK3CA-9F13
    542/545 Reverse primer TCCATTTTAGCACTTACCTGTGAC (SEQ ID NO: 26)
    PIK3CA-9R01
    Key:
    U = 5-propynyl dU
  • The present invention relates to a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
    • (a) contacting the nucleic acid in the sample with at least one mutation-specific oligonucleotide from Table 2;
    • (b) (i) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
      • (ii) contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1
      • (iii) generating an amplification product containing the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid.
  • In accordance with the above, the present invention provides a method of detecting mutations in the human PI3KCA nucleic acid in a sample comprising:
    • (a) contacting the nucleic acid in the sample with one or more of the following mutation-specific oligonucleotides:
  • (542 542K Mutation Probe);
    (SEQ ID NO: 28)
    LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP
    (545 545K Mutation Probe);
    (SEQ ID NO: 30)
    JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP
    (545 545A Mutation Probe);
    (SEQ ID NO: 31)
    FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP
    and/or
    (545 545G Mutation Probe)
    (SEQ ID NO: 32)
    LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP
    • (b) (i) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
      • (ii) contacting the nucleic acid in the sample with one or both of the following oligonucleotides:
      • UAAAAUUUAUUGAGAAUGUAUUUGCITTTTTC (SEQ ID NO: 25) (5421545 Forward primer PIK3CA-9F13) and/or TCCATTTAGCACTTACCTGTGAC (SEQ ID NO: 26) (542/545 Reverse primer PIK3CA-9R01);
      • (iii) generating an amplification product containing the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid.
  • The present invention provides a method of determining whether a patient having a malignant tumor is likely to respond to a HER2-inhibitor, comprising:
    • (a) contacting the nucleic acid in the sample from the patient with the oligonucleotide from Table 2;
    • (b) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid, wherein the presence of the mutation indicates that the patient is likely to respond to the HER2 inhibitor.
  • TABLE 2
    Probe Sequences for the PIK3CA Mutation Detection Test
    Probe Sequence 5′ to 3′
    542 WT Probe FTTTCAQAGAGAGGAUEUEGUGUAGAAAUUGEP (SEQ ID NO: 27)
    542 542K Mutation Probe LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (SEQ ID NO: 28)
    545 WT Probe OCTGCTCAGTQAUUUIAGAGAGAGGATCTCGTGTP (SEQ ID NO: 29)
    545 545K Mutation Probe JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (SEQ ID NO: 30)
    545 545A Mutation Probe FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (SEQ ID NO: 31)
    545 545G Mutation Probe LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (SEQ ID NO: 32)
    Key:
    F = FAM Reporter Dye,
    J = JA270 Reporter Dye,
    O = CY5.5 Reporter Dye,
    L = HEX Reporter Dye,
    U = 5-propynyl dU,
    E = 5-methyl dC,
    I = deoxyinosine,
    Z = 7-deaza dG,
    Q = BHQ2 Quencher Dye,
    P = 3′ Phosphate
  • The method may further comprise, prior to detection in step (c), contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1 and generating an amplification product containing the target sequence within the PI3KCA nucleic acid.
  • TABLE 1
    Primer Sequences for the PIK3CA Mutation
    Detection Test
    Primer Sequence 5′ to 3′
    542/545 Forward primer UAAAAUUUAUUGAGAAUGUAUUUGCTT
    PIK3CA-9F13 TTTC (SEQ ID NO: 25)
    542/545 Reverse primer TCCATTTTAGCACTTACCTGTGAC
    PIK3CA-9R01 (SEQ ID NO: 26)
    Key:
    U = 5-propynyl dU
  • The present invention provides a method of determining whether a patient having a malignant tumor is less likely to respond to a HER2-inhibitor, comprising:
    • (a) contacting the nucleic acid in the sample from the patient with one or more of the following mutation-specific oligonucleotides:
  • (SEQ ID NO: 28)
    LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542
    542K Mutation Probe);
    (SEQ ID NO: 30)
    JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545
    545K Mutation Probe);
    (SEQ ID NO: 31)
    FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A
    Mutation Probe);
    and/or
    (SEQ ID NO: 32)
    LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G
    Mutation Probe);
    • (b) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid, wherein the presence of the mutation indicates that the patient is less likely to respond to the HER2 inhibitor.
  • The present invention relates to a method of determining whether a patient having a malignant tumor is less likely to respond to a HER2-inhibitor, comprising:
    • (a) contacting the nucleic acid in the sample from the patient with one or more of the following mutation-specific oligonucleotides:
  • (SEQ ID NO: 28)
    LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542
    542K Mutation Probe);
    (SEQ ID NO: 30)
    JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545
    545K Mutation Probe);
    (SEQ ID NO: 31)
    FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A
    Mutation Probe);
    and/or
    (SEQ ID NO: 32)
    LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G
    Mutation Probe);
    • (b) (i) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
      • (ii) contacting the nucleic acid in the sample with one or both of the following oligonucleotides:
  • (SEQ ID NO: 25)
    UAAAAUUUAUUGAGAAUGUAUUUGCTTTTTC (542/545
    Forward primer PIK3CA-9F13)
    and/or
    (SEQ ID NO: 26)
    TCCATTTTAGCACTTACCTGTGAC
    (542/545 Reverse primer PIK3CA-9R01);
      • (iii) generating an amplification product containing the target sequence within the PI3KCA nucleic acid;
    • (c) detecting the hybridization thereby detecting the presence of the mutation in the PI3KCA nucleic acid, wherein the presence of the mutation indicates that the patient is less likely to respond to the HER2 inhibitor.
  • The present invention provides a method for identifying a non-responder to a HER2-inhibitor, said method comprising
    • a) detecting the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) nucleic acid in a sample from an individual,
    • (b)) identifying the patient as less likely to respond to a HER2 inhibitor if the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) nucleic acid is detected.
  • TABLE 2
    Probe Sequences for the PIK3CA Mutation
    Detection Test
    Probe Sequence 5′ to 3′
    542 WT Probe FTTTCAQAGAGAGGAUEUEGUGUAGA
    AAUUGEP (SEQ ID NO: 27
    542 542K Mutation Probe LATTTTQGAGAGAGGAUEUEGUGUAG
    AAAUUGEUUP (SEQ ID NO: 28)
    545 WT Probe OCTGCTCAGTQAUUUIAGAGAGAGGA
    TCTCGTGTP (SE) ID NO: 29)
    545 545K Mutation Probe JAATCACTAAGQAGGAGAAAGAUUUU
    EUAUGGAGUEP (SEQ ID NO:
    30)
    545 545A Mutation Probe FCTGCGCQGGAGAAAGAUUUUEUAUG
    GAGUEAP (SEQ ID NO: 31)
    545 545G Mutation Probe LCCTGCCCQGTGAUUUIAGAGAGAGG
    ATCTCGP (SEQ ID NO: 32)
    Key:
    F = FAM Reporter Dye,
    J = JA270 Reporter Dye,
    O = CY5.5 Reporter Dye,
    L = HEX Reporter Dye,
    U = 5-propynyl dU,
    E = 5-methyl dC,,
    I = deoxyinosine,
    Z = 7-deaza dG,
    Q = BHQ2 Quencher Dye,
    P = 3′ Phosphate
  • The term “non-responder” as used herein can refer to a “patient who is less likely to respond” “Less likely to respond” as used herein refers to a decreased likeliness that a pathological complete response (pcR) will occur in a patient treated with a HER2 inhibitor.
  • The present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising detecting the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) nucleic acid by
    • (a) contacting the nucleic acid in the sample from a patient with HER2-positive cancer with one or more of the following mutation-specific oligonucleotides:
  • (SEQ ID NO: 28)
    LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542
    542K Mutation Probe);
    (SEQ ID NO: 30)
    JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545
    545K Mutation Probe);
    (SEQ ID NO: 31)
    FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A
    Mutation Probe);
    and/or
    (SEQ ID NO: 32)
    LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G
    Mutation Probe);
    • (b) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PIK3CA nucleic acid;
    • (c) detecting hybridization
    • (d) identifying the patient as less likely to respond to a HER2 inhibitor if the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) nucleic acid is detected.
  • The method can further comprise, prior to detection in step (c), contacting the nucleic acid in the sample with at least one oligonucleotide from Table 1 and generating an amplification product containing the target sequence within the PI3KCA nucleic acid.
  • TABLE 1
    Primer Sequences for the PIK3CA Mutation
    Detection Test
    Primer Sequence 5′ to 3′
    542/545 Forward primer UAAAAUUUAUUGAGAAUGUAUUUGCTT
    PIK3CA-9F13 TTTC (SEQ ID NO: 25)
    542/545 Reverse primer TCCATTTTAGCACTTACCTGTGAC
    PIK3CA-9R01 (SEG ID NO: 26)
    Key:
    U = 5-propynyl dU
  • The present invention relates to a method for identifying a non-responder to a HER2-inhibitor, said method comprising detecting the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) nucleic acid by
    • (a) contacting the nucleic acid in the sample from a patient with HER2-positive cancer with one or more of the following mutation-specific oligonucleotides:
  • (SEQ ID NO: 28)
    LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (542
    542K Mutation Probe);
    (SEQ ID NO: 30)
    JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (545
    545K Mutation Probe);
    (SEQ ID NO: 31)
    FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (545 545A
    Mutation Probe);
    and/or
    (SEQ ID NO: 32)
    LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (545 545G
    Mutation Probe);
    • (b) (i) incubating the sample under conditions allowing hybridization of the oligonucleotide to the target sequence within the PI3KCA nucleic acid;
      • (ii) contacting the nucleic acid in the sample with one or both of the following oligonucleotides:
  • (SEQ ID NO: 25)
    UAAAAUUUAUUGAGAAUGUAUUUGCTTTTTC (542/545
    Forward primer PIK3CA-9F13)
    and/or
    (SEQ ID NO: 26)
    TCCATTTTAGCACTTACCTGTGAC
    (542/545 Reverse primer PIK3CA-9R01);
      • (iii) generating an amplification product containing the target sequence within the PI3KCA nucleic acid;
    • (c) detecting hybridization
    • (d) identifying the patient as less likely to respond to a HER2 inhibitor if the presence of one or more mutations in exon 9 of the catalytic subunit of Phosphoinositol-3 kinase (PIK3CA or p110α) nucleic acid is detected.
  • The present invention is further illustrated by reference to the following non-limiting figures and examples.
  • The Figures show:
  • FIG. 1.
  • FIG. 1 provides a schematic of the HER2 protein structure, and amino acid sequences for Domains I-IV (SEQ ID Nos. 1-4, respectively) of the extracellular domain thereof.
  • FIG. 2.
  • FIGS. 2A and 2B depict alignments of the amino acid sequences of the variable light (VL) (FIG. 2A) and variable heavy (VH) (FIG. 2B) domains of murine monoclonal antibody 2C4 (SEQ ID Nos. 5 and 6, respectively); VL and VH domains of variant 574/Pertuzumab (SEQ ID Nos. 7 and 8, respectively), and human VL and VH consensus frameworks (hum κ1, light kappa subgroup I; humIII, heavy subgroup III) (SEQ ID Nos. 9 and 10, respectively). Asterisks identify differences between variable domains of Pertuzumab and murine monoclonal antibody 2C4 or between variable domains of Pertuzumab and the human framework. Complementarity Determining Regions (CDRs) are in brackets.
  • FIG. 3.
  • FIGS. 3A and 3B show the amino acid sequences of Pertuzumab light chain (FIG. 3A; SEQ ID NO. 11) and heavy chain (FIG. 3B; SEQ ID No. 12). CDRs are shown in bold. Calculated molecular mass of the light chain and heavy chain are 23,526.22 Da and 49,216.56 Da (cysteines in reduced form). The carbohydrate moiety is attached to Asn 299 of the heavy chain.
  • FIG. 4.
  • FIGS. 4A and 4B show the amino acid sequences of Trastuzumab light chain (FIG. 4A; SEQ ID NO. 13) and heavy chain (FIG. 4B; SEQ ID NO. 14), respectively. Boundaries of the variable light and variable heavy domains are indicated by arrows.
  • FIG. 5.
  • FIGS. 5A and 5B depict a variant Pertuzumab light chain sequence (FIG. 5A; SEQ ID NO. 15) and a variant Pertuzumab heavy chain sequence (FIG. 5B; SEQ ID NO. 16), respectively.
  • FIG. 6.
  • FIG. 6 shows Results of PIK3CA mutational analyses. PIK3CA mutations were in general associated with decreased sensitivity to HER2-targeted therapy in NeoSphere (The NeoSphere study is described in detail e.g. in Lancet Oncol. 2012 January; 13(1):25-32. doi: 10.1016/S1470-2045(11)70336-9. Epub 2011 Dec. 6). Analyses per Exon i.e. Exons 7, 9 and 20 was carried out to explore in more detail the impact of specific mutations. Exon 9 mutations: Out of 28 mutations detected across the 4 arms, 26 were found to be in the non-responder group. Exon 20 mutations had little impact on pCR. Too few exon 7 mutations to draw conclusions. TH=Patients treated with docetaxel (75→100 mg/m2) and trastuzumab (8→6 mg/kg), THP=Patients treated with docetaxel (75→4100 mg/m2), trastuzumab (8→6 mg/kg) and pertuzumab (840→4420 mg), HP=Patients treated with trastuzumab (8→6 mg/kg) and pertuzumab (840→420 mg), TP=Patients treated with docetaxel (75→100 mg/m2) and pertuzumab (840→420 mg).
  • FIG. 7.
  • FIG. 7 shows the PIK3CA gene and the protein sequence aligned. Exon9 is annotated with ***. The wild-type triplets encoding positions E542 and E545 of the wild-type amino acid sequence are indicated in bold letters.
  • EXAMPLE Identification of Non-Responders to HER2 Inhibitors by Determining the Presence of Mutations in Exon 9 of PIK3CA
  • Each standard 50-μL amplification reaction targeting one of the Exons 7, 9 or 20 included 100 ng genomic DNA, dNTPs (including dNTPs), 0.05 U/μL Z05, DNA polymerase, 0.04 U/μL uracil-DNA glycosylase (UNG), and 200-400 nM forward and reverse primer (Table 1), 75-200 nM mutant and wild-type specific probes (Table 2). Amplification was performed in the Cobas® 4800 analyzer using the following temperature profile: 5 min at 50° C. followed by 55 cycles of 95° C. for 10 sec and 63° C. for 50 sec, followed by a single round of 40° C. for 2 min and 25° C. for 10 sec (melting curve analysis). Fluorescence data was collected during each amplification cycle and during the final melting curve analysis.
  • TABLE A
    Primer Sequences for the PIK3C4 Mutation
    Detection Test
    Primer Sequence 5′ to 3′
    Codon 420 Forward Primer UUUUGGGGAAGAAAAGUGUUUUG
    PIK3CA-7F03 AA (SEQ ID NO: 33)
    Codon 420 Reverse primer GATTCAAAGCCATTTTTCCAGAT
    PIK3CA-7R04 ACTAGA (SEQ ID NO: 34)
    Codon 542/545 Forward UAAAAUUUAUUGAGAAUGUAUUU
    primer PIK3CA-9F13 GCTTTTTC (SEQ ID NO: 25)
    Codon 542/545 Reverse TCCATTTTAGCACTTACCTGTGAC
    primer PIK3CA-9R01 (SEQ ID NO: 26)
    Codon 1047 Forward primer GAGGCTTTGGAGTATTTCATGAA
    PIK3CA-20F01 (SEQ ID NO: 35)
    Codon 1047 Reverse primer CCAATCCATTTTTGTTGTCCA
    PIK3CA-20R01 (SEQ ID NO: 36)
    Key:
    U = 5-propynyl dU
  • TABLE B
    Probe Sequences for the PIK3CA Mutation Detection Test
    Probe Sequence 5′ to 3′
    Codon 420 WT Probe JCAATGGACAGQGUUEEUUAAAAAAEAAAGAAAAAUAUUP
    (SEQ ID NO: 37)
    Codon 420 420R Mutation Probe OGAACACCQTCCAUUGGEAUGGGGAAAUAUAAAP (SEQ ID NO: 38)
    Codon 542 WT Probe FTTTCAQAGAGAGGAUEUEGUGUAGAAAUUGEP (SEQ ID NO: 27)
    Codon 542 542K Mutation Probe LATTTTQGAGAGAGGAUEUEGUGUAGAAAUUGEUUP (SEQ ID NO: 28)
    Codon 545 WT Probe OCTGCTCAGTQAUUUIAGAGAGAGGATCTCGTGTP (SEQ ID NO: 29)
    Codon 545 545K Mutation Probe JAATCACTAAGQAGGAGAAAGAUUUUEUAUGGAGUEP (SEQ ID NO: 30)
    Codon 545 545A Mutation Probe FCTGCGCQGGAGAAAGAUUUUEUAUGGAGUEAP (SEQ ID NO: 31)
    Codon 545 545G Mutation Probe LCCTGCCCQGTGAUUUIAGAGAGAGGATCTCGP (SEQ ID NO: 32)
    Codon 1047 WT Probe FTZCACATCQTZZTZZCTZZACAACAAP (SEQ ID NO: 39)
    Codon 1047 1047R Mutation Probe LGACGTQCAUEAUUEAUUUGUUUEAUGP (SEQ ID NO: 40)
    Codon 1047 1047L Mutation Probe JGCACTTCATGQTGGCTGGACAACAAAAAP (SEQ ID NO: 41)
    Codon 1047 1047Y Mutation Probe OACCATGATATQCAUEAUUEAUUUGUUUEP (SEQ ID NO: 42)
    Key:
    F = FAM Reporter Dye,
    J = JA270 Reporter Dye,
    O = CY5.5 Reporter Dye,
    L = HEX Reporter Dye,
    U = 5-propynyl dU,
    E = 5-methyl dC,,
    I = deoxyinosine,
    Z = 7-deaza dG,
    Q = BHQ2 Quencher Dye,
    P = 3′ Phosphate
  • FIG. 6 shows Results of PIK3CA mutational analyses. PIK3CA mutations were in general associated with decreased sensitivity to HER2-targeted therapy in NeoSphere. Analyses per exon i.e. exons 7, 9 and 20 was carried out to explore in more detail the impact of specific mutations. For exon 9 mutations, out of 28 mutations detected across the 4 arms, 26 were found to be in the non-responder group. Exon 20 mutations had little impact on pCR. There were too few exon 7 mutations to draw conclusions.
  • While the invention has been described in detail with reference to specific examples, it will be apparent to one skilled in the art that various modifications can be made within the scope of this invention. Thus the scope of the invention should not be limited by the examples described herein, but by the claims presented below.
  • The present invention refers to the following nucleotide and amino acid sequences:
  • The sequences provided herein are available in the NCBI database and can be retrieved from www.ncbi.nlm.nih.gov/sites/entrez?db=gene; Theses sequences also relate to annotated and modified sequences. The present invention also provides techniques and methods wherein homologous sequences, and variants of the concise sequences provided herein are used. Preferably, such “variants” are genetic variants.
  • SEQ ID No. 1:
  • Nucleotide sequence encoding homo sapiens phosphoinositide-3-kinase, catalytic, alpha (PIK3CA), (NCBI accession number: NG_012113.1 GI:237858742).
  • SEQ ID No. 2:
  • Amino acid sequence of homo sapiens phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit. The sequence can be retrieved from the NCBI database under accession number NP_006209.2 GI:54792082 or from Uniprot database under accession number >sp|P42336|.
  • Positions 542 and 545 are indicated in bold letters.
  • MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELF
    KEARKYPLHQLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLK
    VIEPVGNREEKILNREIGFAIGMPVCEFDMVKDPEVQDFRRNILNVCKEA
    VDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKGQHVVIWVIVSPN
    NDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYI
    LKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMDC
    FTMPSYSRRISTATPYMNGETSTKSLAWVINSALRIKILCATYVNVNIRD
    IDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAA
    RLCLSICSVKGRKGAKEEHCPLAWGNINLFDYTDTLVSGKMALNLWPVPH
    GLEDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMSVIEEHANWSV
    SREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDF
    LWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
    LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLV
    RFLLKKALTNQRIGHFFFWHLKSENHNKTVSQRFGLLLESYCRACGMYLK
    HLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQG
    FLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDIMSELLFQNNEII
    FKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLSIGDCVGLIEV
    VRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
    CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRE
    RVPFVLTQDFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFIN
    LFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGG
    WTTKMDWIFHTIKQHALN
  • SEQ ID No. 3:
  • Nucleotide sequence encoding exon 9 of homo sapiens phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • AGTAACAGACTAGCTAGAGACAATGAATTAAGGGAAAATGACAAAGAACA
    GCTCAAAGCAATTTCTACACGAGATCCTCTCTCTGAAATCACTGAGCAGG
    AGAAAGATTTTCTATGGAGTCACAG
  • SEQ ID No. 4:
  • Amino acid sequence encoded by exon 9 of homo sapiens phosphoinositide-3-kinase, catalytic, alpha (PIK3CA).
  • SEQ ID No. 5:
  • Amino acid sequence of the variable light (VL) (FIG. 2A) domain of murine monoclonal antibody 2C4 (SEQ ID Nos. 5 and 6, respectively) as shown in FIG. 2.
  • SEQ ID No. 6:
  • Amino acid sequence of the variable heavy (VII) (FIG. 2B) domain of murine monoclonal antibody 2C4 as shown in FIG. 2.
  • SEQ ID No. 7:
  • Amino acid sequence of the variable light (VL) (FIG. 2A) domain of variant 574/Pertuzumab as shown in FIG. 2.
  • SEQ ID No. 8:
  • Amino acid sequence of the variable heavy (VH) (FIG. 2B) domain of variant 574/Pertuzumab as shown in FIG. 2.
  • SEQ ID No. 9:
  • human VL consensus frameworks (hum κ1, light kappa subgroup I; humIII, heavy subgroup III) as shown in FIG. 2.
  • SEQ ID No. 10:
  • human VH consensus frameworks (hum κ1, light kappa subgroup I; humIII, heavy subgroup III) as shown in FIG. 2.
  • SEQ ID No. 11:
  • Amino acid sequences of Pertuzumab light chain as shown in FIG. 3A.
  • SEQ ID No. 12:
  • Amino acid sequences of Pertuzumab heavy chain as shown in FIG. 3B.
  • SEQ ID No. 13:
  • Amino acid sequence of Trastuzumab light chain domain as shown in FIG. 4A. Boundaries of the variable light domain are indicated by arrows.
  • SEQ ID No. 14:
  • Amino acid sequence of Trastuzumab heavy chain as shown in FIG. 4B. Boundaries of the variable heavy domain are indicated by arrows.
  • SEQ ID No. 15:
  • Amino acid sequence of variant Pertuzumab light chain sequence (FIG. 5A).
  • SEQ ID No. 16:
  • Amino acid sequence of variant Pertuzumab heavy chain sequence (FIG. 5B).
  • SEQ ID No. 17:
  • Nucleotide sequence encoding exon 9 of homo sapiens E542K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). The triplet (codon) encoding the mutant amino acid “K” at position 542 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7) is highlighted in bold letters.
  • AGTAACAGACTAGCTAGAGACAATGAATTAAGGGAAAATGACAAA
    GAACAGCTCAAAGCAATTTCTACACGAGATCCTCTCTCTAAAATC
    ACTGAGCAGGAGAAAGATTTTCTATGGAGTCACAG
  • SEQ ID No. 18:
  • Amino acid sequence of homo sapiens E542K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). Position 542 is highlighted in bold. The mutant shows an increase in lipid kinase activity; oncogenic in vivo; occurs in the interface between the PIK3CA helical domain and the nSH2 (N-terminal SH2) region of the p85 regulatory subunit and may reduce the inhibitory effect of p85; requires interaction with RAS to induce cellular transformation.
  • MPPRPSSGEL WGIHLMPPRI LVECLLPNGM IVTLECLREA
                                  70         80
    TLITIKHELF KEARKYPLHQ LLQDESSYIF VSVTQEAERE
            90        100        110        120
    EFFDETRRLC DLRLFQPFLK VIEPVGNREE KILNREIGFA
           130        140        150        160
    IGMPVCEFDM VKDPEVQDFR RNILNVCKEA VOLRDLNSPH
           170        180        190        200
    SRAMYVYPPN VESSPELPKE IYNKLDKGQI IVVIWVIVSP
           210        220        230        240
    NNDKQKYTLK INHDCVPEQV IAEAIRKKTR SMLLSSEQLK
           250        260        270        280
    LCVLEYQGKY ILKVCGCDEY FLEKYPLSQY KYIRSCIMLG
           290        300        310        320
    RMPNLMLMAK ESLYSQLPMD CFTMPSYSRR ISTATPYMNG
           330        340        350        360
    ETSTKSLWVI NSALRIKILC ATYVNVNIRD IDKIYVRTGI
           370        380        390        400
    YHGGEPLCDN VNTQRVPCSN PRWNEWLNYD IYIPDLPRAA
           410        420        430        440
    RLCLSICSVK GRKGAKEERC PLAWGNINLF DYTDTLVSGK
           450        460        470        480
    MALNLWPVPH GLEDLLNPIG VTGSNPNKET PCLELEFDWF
           490        500        510        520
    SSVVKFPDMS VIEEHANWSV SREAGFSYSH AGLSNRLARD
           530        540        550        560
    NELRENDKEQ LKAISTRDPL S
    Figure US20160265067A1-20160915-P00001
    ITEQEKDF LWSHRHYCVT
           570        580        590        600
    ZPEILPKLLL SVKWNSRDEV AQMYCLVKDW PPIKPEQAME
           610        620        630        640
    LLDCNYPDPM VRGFAVRCLE KYLTDDKLSQ YLIQLVQVLX
           650        660        670        680
    YEQYLDNLLV RFLLKKALTN QRIGHFFFWH LKSEMHNKTV
           690        700        710        720
    SQRFGLLLES YCRACGMYLK HLNRQVEAME KLINLTDILK
           730        740        750        760
    QEKKDETQKV QMKFLVEQMR RPDFMDALQG FLSPLNPAHQ
           770        780        790        800
    LGNLRLEECR IMSSAKRPLW LNWENPDIMS ELLFQNNEII
           810        820        830        840
    FKNGDDLRQD MLTLQIIRIM ENIWQNQGLD LRMLPYGCLS
           850        860        870        880
    IGDCVGLIEV VRNSHTIMQI QCKGGLKGAL QFNSHTLHQW
           890        900        910        920
    LKDKNKGEIY DAAIDLFTRS CAGYCVATFI LGIGDRHNSN
           930        940        950        960
    IMVKDDCQLF HIDFGEFLDH KKKKFGYKRE RVPFVLTQDF
           970        980        990       1000
    LIVISKGAQE CTKTREFERF QEMCYKAYLA IRQHANLFIN
          1010       1020       1030       1040
    LFSMMLGSGM PELQSFDDIA YIRKTLALDK TEQEALEYFM
          1050       1060
    KQMNDAHHGG WTTKMDWIFH TIKQHALN
  • SEQ ID No. 19:
  • Nucleotide sequence encoding exon 9 of homo sapiens E545K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). The triplet (codon) encoding the mutant amino acid “K” at position 545 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7) is highlighted in bold letters.
  • AGTAACAGACTAGCTAGAGACAATGAATTAAGGGAAAATGACAAA
    GAACAGCTCAAAGCAATTTCTACACGAGATCCTCTCTCTGAAATCACT
    AAGCAGGAGAAAGATTTTCTATGGAGTCACAG
  • SEQ ID No. 20:
  • Amino acid sequence of homo sapiens E545K mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). Position 545 is highlighted in bold. The mutant shows an increase in lipid kinase activity; oncogenic in vivo; occurs in the interface between the PIK3CA helical domain and the nSH2 (N-terminal SH2) region of the p85 regulatory subunit and may reduce the inhibitory effect of p85; requires interaction with RAS to induce cellular transformation; enhances invadopodia-mediated extracellular matrix degradation and invasion in breast cancer
  • MPPRPSSGEL WGIHLMPPRI LVECLLPNGM IVTLECLREA
                                  70         80
    TLITIKHELF KEAPKYPLHQ LLQDESSYIF VSVTQEAERE
            90        100        110        120
    EFFDETRRLC DLRLFQPFLK VIEPVGNREE KILNREIGFA
           130        140        150        160
    IGMPVCEFDM VKDPEVQDFR RNILNVCKEA VDLRDLNSPH
           170        180        190        200
    SRAMYVYPPN VESSPELPKH IYNKLDKCQI IVVIWVIVSP
           210        220        230        240
    NNDKQKYTLK INHDCVPEQV IAEAIRKKTR SMLLSSEQLK
           250        260        270        280
    LCVLEYQGKY ILKVCGCDEY FLEKYPLSQY KYIRSCIMLG
           290        300        310        320
    RMPNLMLMAK ESLYSQLPMD CFTMPSYSRR ISTATPYMNG
           330        340        350        360
    ETSTKSLWVI NSALRIKILC ATYVNVNIRD IDKIYVRTGI
           370        380        390        400
    YHGGEPLCDN VNTQRVPCSN PRWNEWLNYD IYIPDLPRAA
           410        420        430        440
    RLCLSICSVK GRKGAKEEHC PLAWGNINLF DYTDTLVSGK
           450        460        470        480
    MALNLWPVPH GLEDLINPIG VTGSNPNKET PCLELEFDWF
           490        500        510        520
    SSVVKFPDMS VIEEHANWSV SREAGFSYSH AGLSNRLARD
           530        540        550        560
    NELRENDKEQ LKAISTRDPL SEIT
    Figure US20160265067A1-20160915-P00002
    QEKDF LWSHRHYCVT
           570        580        590        600
    IPEILPKLLL SVKWNSRDEV AQMYCLVKDW PPIKPEQAME
           610        620        630        640
    LLDCNYPDPM VRGFAVRCLE KYLTDDKLSQ YLIQLVQVLK
           650        660        670        680
    YEQYLDNLLV RFLLKKALTN QRIGHFFFWH LKSEMHNKTV
           690        700        710        720
    SQRFGLLLES YCRACGMYLK HLNRQVEAME KLINLTDILK
           730        740        750        760
    QEKKDETQKV QMKFLVEQMR RPDFMDALQG FLSPLNPAHQ
           770        780        790        800
    LGNLRLEECR IMSSAKRPLW LNWENPDIMS ELLFQNNEII
           810        820        830        840
    FKNGDDLRQD MLTLQIIRIM ENIWQNQGLD LRMLPYGCLS
           850        860        870        880
    IGDCVGLIEV VRNSHTIMQI QCKGGLKGAL QFNSHTLHQW
           890        900        910        920
    LKDKNKGEIY DAAIDLFTRS CAGYCVATFI LGIGDRHNSN
           930        940        950        960
    IMVKDDGQLF HIDFGEFLDH KKKKFGYKRE RVPFVLTQDF
           970        980        990       1000
    LIVISKGAQE CTKTREFERF QEMCYKAYLA IRQHANLFIN
          1010       1020       1030       1040
    LFSMMLGSGM PELQSFDDIA YIRKTLALDK TEQEALEYFM
          1050       1060
    KQMNDAAHGG WTTKMDWIFH TIKQHALN
  • SEQ ID No. 21:
  • Nucleotide sequence encoding exon 9 of homo sapiens E545A mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). The triplet (codon) encoding the mutant amino acid “A” at position 545 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7) is highlighted in bold letters.
  • AGTAACAGACTAGCTAGAGACAATGAATTAAGGGAAAATGACAAA
    GAACAGCTCAAAGCAATTTCTACACGAGATCCTCTCTCTGAAATCACT
    GCGCAGGAGAAAGATTTTCTATGGAGTCACAG
  • Amino acid sequence of homo sapiens E545A mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). Position 545 is highlighted in bold.
  • MPPRPSSGEL WGIHLMPPRI LVECLLPNGM IVTLECLREA
                                  70         80
    TLITIKHELF KEARKYPLHQ LLQDESSYIF VSVTQEAERE
            90        100        110        120
    EFFDETRRLC DLRLFQPFLK VIEPVGNREE KILNREIGFA
           130        140        150        160
    IGMPVCEFDM VKDPEVQDFR RNILNVCKEA VDLRDINSPH
           170        180        190        200
    SRAMYVYPPN VESSPELPKH TYNKLDKGQI IVVIWVIVSP
           210        220        230        240
    NNDKQKYTLK INHDCVPEQV IAEAIRKKTR SMLLSSEQLK
           250        260        270        280
    LCVLEYQGKY ILKVCGCDEY FLEKYPLSQY KYIRSCIMLG
           290        300        310        320
    RMPNLMLMAK ESLYSQLPMD CFTMPSYSRR ISTATPYMNG
           330        340        350        360
    ETSTKSLWVI NSALRIKILC ATYVNVNIRD IDKIYVRTGI
           370        380        390        400
    YHGGEPLCDN VNTQRVPCSN PRWNEWLMYD IYIPDLPRAA
           410        420        430        440
    RLCLSICSVK GRKGAKEEHC PLAWGNINLF DYTDTLVSGK
           450        460        470        480
    MALNLWPVPH GLEDLLNPIG VTGSNPNKET PCLELEFDWF
           490        500        510        520
    SSVVKFPDMS VIEEHANWSV SREAGFSYSH AGLSNRLARD
           530        540        550        560
    NELRENDKEQ LKAISTRDPL SEIT
    Figure US20160265067A1-20160915-P00003
    QEKDF LWSHRHYCVT
           570        580        590        600
    IPEILPKLLL SVKWNSRDEV AQMYCLVKDW PPIKPEQAME
           610        620        630        640
    LLDCNYPDPM VRGFAVRCLE KYLTDDKLSQ YLIQLVQVLK
           650        660        670        680
    YEQYLDNLLV RFLLKKALTN QRIGHFFFWH LKSEMHNKTV
           690        700        710        720
    SQRFGLLLES YCRACGMYLK HLNRQVEAME KLINLTDILK
           730        740        750        760
    QEKKDETQKV QMKFLVEQMR RPDFMDALQG FLSPLNPAHQ
           770        780        790        800
    LGNLRLEECR IMSSAKRPLW LNWENPDIMS ELLFQNNEII
           810        820        830        840
    FKNGDDLRQD MLTLQIIRIM ENIWQNQGLD LRMLPYGCLS
           850        860        870        880
    TGDCVGLIEV VRNSHTIMQI QCKGGLKGAL QFNSHTLHQW
           890        900        910        920
    LKDKNKGEIY DAAIDLFTRS CAGYCVATFI LGIGDRHNSN
           930        940        950        960
    IMVKDDGQLF HIDFGHFLDH KKKKFGYKRE RVPFVLTQDF
           970        980        990       1000
    LIVISKGAQE CTKTREFERE QEMCYKAYLA IRQHANLFIN
          1010       1020       1030       1040
    LFSMMLGSGM PELQSFDDIA YIRKTLALDK TEQEALEYFM
          1050       1060
    KQMNDAHHGG WTTKMDWIFH TIKQHALN
  • SEQ ID No. 23:
  • Nucleotide sequence encoding exon 9 of homo sapiens F5450 mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). The triplet (codon) encoding the mutant amino acid “G” at position 545 of the full-length amino acid sequence of PIKC3CA (see SEQ ID NO: 2 and FIG. 7) is highlighted in bold letters.
  • AGTAACAGACTAGCTAGAGACAATGAATTAAGGGAAAATGACAAA
    GAACAGCTCAAAGCAATTTCTACACGAGATCCTCTCTCTGAAATCACT
    GGGCAGGAGAAAGATTTTCTATGGAGTCACAG
  • SEQ ID No. 24:
  • Amino acid sequence of homo sapiens E545G mutant of phosphoinositide-3-kinase, catalytic, alpha (PIK3CA). Position 545 is highlighted in bold.
  • MPPRPSSGEL WGIHLMPPRI LVECLLPNGM IVTLECLREA
                                  70         80
    TLITIKHELF KEARKYPLHQ LLQDESSYIF VSVTQEAERE
            90        100        110        120
    EFFDETRRLC DLRLFQPFLK VIEPVGNREE KILNREIGFA
           130        140        150        160
    IGMPVCEFDM VKDPEVQDFR RNILNVCKEA VDLRDLNSPH
           170        180        190        200
    SRAMYVYPPN VESSPELPKH IYNKLDKGQI IVVIWVIVSP
           210        220        230        240
    NNDKQKYTLK INHDCVPEQV IAEAIRKKTR SMLLSSEQLK
           250        260        270        280
    LCVLEYQGKY ILKVCGCDEY FLEKYPLSQY KYIRSCIMLG
           290        300        310        320
    RMPNLMLMAK ESLYSQLPMD CFTMPSYSRR ISTATPYMNG
           330        340        350        360
    ETSTKSLWVI NSALRIKILC ATYVNVNIRD IDKIYVRTGI
           370        380        390        400
    YHGGEPLCDN VNTQRVPCSN PRWNEWLNYD IYIPDLPRAA
           410        420        430        440
    RLCLSICSVK GRKGAKEEHC PLAWGNINLF DYTDTLVSGK
           450        460        470        480
    MALNLWPVPH GLEDLLNFIG VTGSNPNKET PCLELEFDEF
           490        500        510        520
    SSVVKFPDMS VIEEHANWSV SREAGFSYSH AGLSNRLARD
           530        540        550        560
    NELRENDKEQ LKAISTRDPL SEIT
    Figure US20160265067A1-20160915-P00004
    QEKDF LWSHRHYCVT
           570        580        590        600
    IPEILPKLLL SVKWNSRDEV AQMYCLVKDW PPIKPEQAME
           610        620        630        640
    LLDCNYPDPM VRGFAVRCLE KYLTDDKLSQ YLIQLVQVLK
           650        660        670        680
    YEQYLDNLLV RFLLKKALTN QRIGHFFFWH LKSEMHNKTV
           690        700        710        720
    SQRFGLLLES YCRACGMYLK HLNRQVEAME KLINLTDILK
           730        740        750        760
    QEKKDETQKV QMKFLVEQMR RPDFMDALQG FLSPLNPAHQ
           770        780        790        800
    LGNLRLEECR IMSSAKRPLW LNWENPDIMS ELLFQNNEII
           810        820        830        840
    FKNGDDLRQD MLTLQIIRIM ENIWQNQGLD LRMLPYGCLS
           850        860        870        880
    IGDCVGLIEV VRNSHTIMQI QCKGGLKGAL QFNSHTLHQW
           890        900        910        920
    LKDKNKGEIY DAAIDLFTRS CAGYCVATFI LGIGDRHNSN
           930        940        950        960
    IMVKDDGQLF HIDFGHFLDH KKKKFGYKRE RVPFVLTQDF
           970        980        990       1000
    LIVISKGAQE CTKTREFERF QEMCYKAYLA IRQHANLFIN
          1010       1020       1030       1040
    LFSMMLGSGM PELQSFDDTA YIRKTLALDK TEQEALEYFM
          1050       1060
    KQMNDAHHGG WTTKMCWIFH TIKQHALN
  • All references cited herein are fully incorporated by reference. Having now fully described the invention, it will be understood by a person skilled in the art that the invention may be practiced within a wide and equivalent range of conditions, parameters and the like, without affecting the spirit or scope of the invention or any embodiment thereof.

Claims (14)

1-47. (canceled)
48. A method for detecting the presence of a mutation in exon 9 of Phosphoinositol-3 kinase (PIK3CA) in a sample from a patient with HER2-positive cancer comprising:
i) obtaining a nucleic acid sample from the patient;
ii) contacting the nucleic acid sample from the patient with primers that specifically amplify a target sequence in exon 9 of PIK3CA and a probe that specifically hybridizes to a mutation in the target sequence in exon 9 of PIK3CA;
iii) carrying out an amplification reaction to generate a target sequence amplification product; and
iv) detecting the presence of a mutation in exon 9 of PIK3CA by detecting hybridization of the probe to the amplification product, wherein the presence of a mutation in exon 9 is detected and the presence of a mutation in exon 20 is not detected.
49. The method of claim 48, wherein the HER2-positive cancer is breast cancer.
50. The method of claim 49, wherein the breast cancer is early-stage breast cancer.
51. The method of claim 48, wherein the mutation is one or more of the mutations E542 E545K, E545A and E545G in exon 9 of PIK3CA.
52. The method of claim 48, further comprising treating the patient with a HER2 inhibitor if a mutation in exon 9 of PIK3CA is not detected.
53. The method of claim 52, wherein the HER2-inhibitor is an anti-HER2 antibody.
54. The method of claim 53, wherein the anti-HER2 antibody is pertuzumab.
55. A method of treating a patient with a HER2-positive cancer comprising:
i) obtaining a nucleic acid sample from the patient;
ii) contacting the nucleic acid sample from the patient with primers that specifically amplify a target sequence in exon 9 of PIK3CA and a probe that specifically hybridizes to a mutation in the target sequence in exon 9 of PIK3CA;
iii) carrying out an amplification reaction to generate a target sequence amplification product;
iv) detecting the presence of a mutation in exon 9 of PIK3CA by detecting hybridization of the probe to the amplification product; and
v) treating the patient with a HER2 inhibitor if a mutation in exon 9 of PIK3CA is not detected.
56. The method of claim 55, wherein the HER2-positive cancer is breast cancer.
57. The method of claim 56, wherein the breast cancer is early-stage breast cancer.
58. The method of claim 55, wherein the mutation is one or more of the mutations E542 E545K, E545A and E545G in exon 9 of PIK3CA.
59. The method of claim 55, wherein the HER2-inhibitor is an anti-HER2 antibody.
60. The method of claim 55, wherein the anti-HER2 antibody is pertuzumab.
US15/163,552 2011-12-09 2016-05-24 Identification of non-responders to her2 inhibitors Abandoned US20160265067A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US15/163,552 US20160265067A1 (en) 2011-12-09 2016-05-24 Identification of non-responders to her2 inhibitors

Applications Claiming Priority (5)

Application Number Priority Date Filing Date Title
EP11192861 2011-12-09
EP11192861.0 2011-12-09
PCT/EP2012/074857 WO2013083810A1 (en) 2011-12-09 2012-12-07 Identification of non-responders to her2 inhibitors
US201414363982A 2014-06-09 2014-06-09
US15/163,552 US20160265067A1 (en) 2011-12-09 2016-05-24 Identification of non-responders to her2 inhibitors

Related Parent Applications (2)

Application Number Title Priority Date Filing Date
US14/363,982 Division US9376715B2 (en) 2011-12-09 2012-12-07 Methods for detecting mutations in the catalytic subunit of the phosphoinositol-3 kinase (PIK3CA) gene
PCT/EP2012/074857 Division WO2013083810A1 (en) 2011-12-09 2012-12-07 Identification of non-responders to her2 inhibitors

Publications (1)

Publication Number Publication Date
US20160265067A1 true US20160265067A1 (en) 2016-09-15

Family

ID=48573606

Family Applications (2)

Application Number Title Priority Date Filing Date
US14/363,982 Active US9376715B2 (en) 2011-12-09 2012-12-07 Methods for detecting mutations in the catalytic subunit of the phosphoinositol-3 kinase (PIK3CA) gene
US15/163,552 Abandoned US20160265067A1 (en) 2011-12-09 2016-05-24 Identification of non-responders to her2 inhibitors

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US14/363,982 Active US9376715B2 (en) 2011-12-09 2012-12-07 Methods for detecting mutations in the catalytic subunit of the phosphoinositol-3 kinase (PIK3CA) gene

Country Status (3)

Country Link
US (2) US9376715B2 (en)
EP (1) EP2788500A1 (en)
WO (1) WO2013083810A1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102021126650A1 (en) 2021-10-14 2023-04-20 Rheinische Friedrich-Wilhelms-Universität Bonn, Körperschaft des öffentlichen Rechts METHOD OF DETERMINING THE PROBABILITY OF RESPONSE OF A MALIGNANT DISEASE TO TREATMENT WITH A PHARMACEUTICAL INHIBITING AGENT

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JO3000B1 (en) 2004-10-20 2016-09-05 Genentech Inc Antibody Formulations.
AU2006216732C1 (en) 2005-02-23 2017-07-20 Genentech, Inc. Extending time to disease progression or survival in cancer patients using a HER dimerization inhibitor
WO2008109440A2 (en) 2007-03-02 2008-09-12 Genentech, Inc. Predicting response to a her dimerisation inhibitor based on low her3 expression
TWI472339B (en) 2008-01-30 2015-02-11 Genentech Inc Composition comprising antibody that binds to domain ii of her2 and acidic variants thereof
BRPI0812682A2 (en) 2008-06-16 2010-06-22 Genentech Inc metastatic breast cancer treatment
AR095863A1 (en) 2013-04-16 2015-11-18 Genentech Inc VARIATIONS OF PERTUZUMAB, ITS ASSESSMENT, METHOD OF TREATMENT, METHOD OF PREPARATION AND ARTICLE OF MANUFACTURE
RU2750821C2 (en) 2017-01-17 2021-07-05 Дженентек, Инк. Anti-her2 antibody drugs for subcutaneous injection
FI3589661T3 (en) 2017-03-02 2024-01-31 Genentech Inc Adjuvant treatment of her2-positive breast cancer
JP7306618B2 (en) * 2017-09-26 2023-07-11 東ソー株式会社 Factors Involved in Metastasis Formation of Cancer and Method for Predicting Prognosis of Cancer Patients Using Said Factors
CN108315428A (en) * 2018-04-13 2018-07-24 江西海普洛斯生物科技有限公司 A kind of the primer combination of probe object and its detection method of detection PIK3CA genes E545K

Family Cites Families (144)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4263428A (en) 1978-03-24 1981-04-21 The Regents Of The University Of California Bis-anthracycline nucleic acid function inhibitors and improved method for administering the same
US4935341A (en) 1986-06-04 1990-06-19 Whitehead Institute For Biomedical Research Detection of point mutations in neu genes
ATE12348T1 (en) 1980-11-10 1985-04-15 Gersonde Klaus Prof Dr PROCESS FOR THE PRODUCTION OF LIPID VESICLES BY ULTRASONIC TREATMENT, APPLICATION OF THE PROCESS AND DEVICE FOR CARRYING OUT THE PROCESS.
IE52535B1 (en) 1981-02-16 1987-12-09 Ici Plc Continuous release pharmaceutical compositions
US4485045A (en) 1981-07-06 1984-11-27 Research Corporation Synthetic phosphatidyl cholines useful in forming liposomes
JPS58118008A (en) 1982-01-06 1983-07-13 Nec Corp Data processor
EP0088046B1 (en) 1982-02-17 1987-12-09 Ciba-Geigy Ag Lipids in the aqueous phase
DE3218121A1 (en) 1982-05-14 1983-11-17 Leskovar, Peter, Dr.-Ing., 8000 München Pharmaceutical compositions for tumour treatment
EP0102324A3 (en) 1982-07-29 1984-11-07 Ciba-Geigy Ag Lipids and surfactants in an aqueous medium
US4544545A (en) 1983-06-20 1985-10-01 Trustees University Of Massachusetts Liposomes containing modified cholesterol for organ targeting
HUT35524A (en) 1983-08-02 1985-07-29 Hoechst Ag Process for preparing pharmaceutical compositions containing regulatory /regulative/ peptides providing for the retarded release of the active substance
DE3486459D1 (en) 1983-09-26 1997-12-11 Udo Dr Med Ehrenfeld Means and product for the diagnosis and therapy of tumors and for the treatment of weaknesses in cellular and humoral immune defense
DE3474511D1 (en) 1983-11-01 1988-11-17 Terumo Corp Pharmaceutical composition containing urokinase
US7838216B1 (en) 1986-03-05 2010-11-23 The United States Of America, As Represented By The Department Of Health And Human Services Human gene related to but distinct from EGF receptor gene
US5401638A (en) 1986-06-04 1995-03-28 Oncogene Science, Inc. Detection and quantification of neu related proteins in the biological fluids of humans
US4968603A (en) 1986-12-31 1990-11-06 The Regents Of The University Of California Determination of status in neoplastic disease
US5824311A (en) 1987-11-30 1998-10-20 Trustees Of The University Of Pennsylvania Treatment of tumors with monoclonal antibodies against oncogene antigens
US5720937A (en) 1988-01-12 1998-02-24 Genentech, Inc. In vivo tumor detection assay
WO1989006692A1 (en) 1988-01-12 1989-07-27 Genentech, Inc. Method of treating tumor cells by inhibiting growth factor receptor function
JPH03505964A (en) 1988-04-18 1991-12-26 アプライド・バイオテクノロジー・インコーポレーテッド Expression of neu gene and detection of gene product
DK0474727T3 (en) 1989-05-19 1998-01-12 Genentech Inc HER2 extracellular domain
US5705157A (en) 1989-07-27 1998-01-06 The Trustees Of The University Of Pennsylvania Methods of treating cancerous cells with anti-receptor antibodies
EP0444181B2 (en) 1989-08-04 2010-11-24 Bayer Schering Pharma Aktiengesellschaft C-erbb-2 external domain: gp75
US6884418B1 (en) 1989-08-04 2005-04-26 Berlex Laboratories, Inc. Use of ligand-mimicking agents and anti-neoplastic drugs in cancer therapy
DE68926248T2 (en) 1989-09-29 1996-12-19 Oncogene Science Inc p100 "new" human protein and the use of this protein for the detection of preneoplasmic or neoplasmic in humans
US5183884A (en) 1989-12-01 1993-02-02 United States Of America Dna segment encoding a gene for a receptor related to the epidermal growth factor receptor
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
AU662311B2 (en) 1991-02-05 1995-08-31 Novartis Ag Recombinant antibodies specific for a growth factor receptor
IL101943A0 (en) 1991-05-24 1992-12-30 Genentech Inc Structure,production and use of heregulin
ES2206447T3 (en) 1991-06-14 2004-05-16 Genentech, Inc. HUMANIZED ANTIBODY FOR HEREGULINE.
WO1994004679A1 (en) 1991-06-14 1994-03-03 Genentech, Inc. Method for making humanized antibodies
US6800738B1 (en) 1991-06-14 2004-10-05 Genentech, Inc. Method for making humanized antibodies
US5939531A (en) 1991-07-15 1999-08-17 Novartis Corp. Recombinant antibodies specific for a growth factor receptor
EP0656367A1 (en) 1991-08-22 1995-06-07 Becton, Dickinson and Company Method and composition for cancer therapy and for prognosticating responses to cancer theraphy
US7018809B1 (en) 1991-09-19 2006-03-28 Genentech, Inc. Expression of functional antibody fragments
US5288477A (en) 1991-09-27 1994-02-22 Becton, Dickinson And Company Method for prognosticating response to cancer therapy
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
AU3236793A (en) 1991-12-12 1993-07-19 Berlex Laboratories, Inc. Recombinant and chimeric antibodies to c-erbB-2
AU675929B2 (en) 1992-02-06 1997-02-27 Curis, Inc. Biosynthetic binding protein for cancer marker
AU4025193A (en) 1992-04-08 1993-11-18 Cetus Oncology Corporation Humanized C-erbB-2 specific antibodies
ZA932522B (en) 1992-04-10 1993-12-20 Res Dev Foundation Immunotoxins directed against c-erbB-2(HER/neu) related surface antigens
AU687346B2 (en) 1992-06-30 1998-02-26 Oncologix, Inc. A combination of anti-erbB-2 monoclonal antibodies and method of using
WO1994009022A1 (en) 1992-10-09 1994-04-28 Oncor, Inc. Methods for the detection of chromosome structural abnormalities by in situ hybridization to fixed tissue
CA2103323A1 (en) 1992-11-24 1994-05-25 Gregory D. Plowman Her4 human receptor tyrosine kinase
ATE186219T1 (en) 1993-03-24 1999-11-15 Berlex Biosciences COMBINATION OF ANTIHORMONAL AND BINDING MOLECULES FOR CANCER TREATMENT
AU6527894A (en) 1993-03-30 1994-10-24 Trustees Of The University Of Pennsylvania, The Prevention of tumors with monoclonal antibodies against (neu)
US6811779B2 (en) 1994-02-10 2004-11-02 Imclone Systems Incorporated Methods for reducing tumor growth with VEGF receptor antibody combined with radiation and chemotherapy
US20030108545A1 (en) 1994-02-10 2003-06-12 Patricia Rockwell Combination methods of inhibiting tumor growth with a vascular endothelial growth factor receptor antagonist
US5910486A (en) 1994-09-06 1999-06-08 Uab Research Foundation Methods for modulating protein function in cells using, intracellular antibody homologues
US5804396A (en) 1994-10-12 1998-09-08 Sugen, Inc. Assay for agents active in proliferative disorders
US5846749A (en) 1994-10-12 1998-12-08 The Regents Of The University Of California Quantitative measurement of tissue protein identified by immunohistochemistry and standardized protein determination
US6214388B1 (en) 1994-11-09 2001-04-10 The Regents Of The University Of California Immunoliposomes that optimize internalization into target cells
EP0711565B1 (en) 1994-11-10 1998-08-26 Eberhard-Karls-Universität Tübingen Universitätsklinikum Inhibiting growth of leukemic cells by targeting HER-2 protein
AU4289496A (en) 1994-12-02 1996-06-19 Chiron Corporation Method of promoting an immune response with a bispecific antibody
US5783404A (en) 1995-04-13 1998-07-21 Amgen Inc. Methods and compositions for determining HER-2/neu expression using monoclonal antibodies
US6410690B1 (en) 1995-06-07 2002-06-25 Medarex, Inc. Therapeutic compounds comprised of anti-Fc receptor antibodies
US5977322A (en) 1995-06-14 1999-11-02 The Regents Of The University Of California High affinity human antibodies to tumor antigens
US6685940B2 (en) 1995-07-27 2004-02-03 Genentech, Inc. Protein formulation
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
US5783186A (en) 1995-12-05 1998-07-21 Amgen Inc. Antibody-induced apoptosis
US5925519A (en) 1996-06-03 1999-07-20 The Regents Of The University Of California Genetic alterations associated with prostate cancer
US5922845A (en) 1996-07-11 1999-07-13 Medarex, Inc. Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies
NZ519191A (en) 1996-10-18 2005-04-29 Univ Texas Antibodies that bind to domain 1 of ErbB2 useful for inducing cell death via apoptosis, and nucleic acids encoding such antibodies
WO1998018489A1 (en) 1996-10-30 1998-05-07 The Uab Research Foundation Enhancement of tumor cell chemosensitivity and radiosensitivity using single chain intracellular antibodies
US6468547B1 (en) 1996-10-30 2002-10-22 Uab Research Foundation Enhancement of tumor cell chemosensitivity and radiosensitivity using single chain secretory antibodies
EP1864999B1 (en) 1996-11-27 2009-03-18 Genentech, Inc. Affinity purification of polypeptide on protein a matrix
CA2279547A1 (en) 1997-01-31 1998-08-06 University Of Rochester Chimeric antibody fusion proteins for the recruitment and stimulation of an antitumor immune response
US20020076695A1 (en) 1997-04-04 2002-06-20 Jeffrey S. Ross Methods for treating prostate cancer
US5994071A (en) 1997-04-04 1999-11-30 Albany Medical College Assessment of prostate cancer
ZA9811162B (en) 1997-12-12 2000-06-07 Genentech Inc Treatment with anti-ERBB2 antibodies.
US6358682B1 (en) 1998-01-26 2002-03-19 Ventana Medical Systems, Inc. Method and kit for the prognostication of breast cancer
WO1999048527A1 (en) 1998-03-27 1999-09-30 Genentech, Inc. Apo-2 ligand-anti-her-2 antibody synergism
US7244826B1 (en) 1998-04-24 2007-07-17 The Regents Of The University Of California Internalizing ERB2 antibodies
ATE321066T1 (en) 1998-05-06 2006-04-15 Genentech Inc ANTI-HER2 ANTIBODY COMPOSITION
US6573043B1 (en) 1998-10-07 2003-06-03 Genentech, Inc. Tissue analysis and kits therefor
DE60041808D1 (en) 1999-01-27 2009-04-30 Cornell Res Foundation Inc TREATMENT OF CANCER WITH HER-2 / NEU OVEREXPRIMATION
US6333348B1 (en) 1999-04-09 2001-12-25 Aventis Pharma S.A. Use of docetaxel for treating cancers
US6316462B1 (en) 1999-04-09 2001-11-13 Schering Corporation Methods of inducing cancer cell death and tumor regression
ES2320311T3 (en) 1999-05-14 2009-05-21 Genentech, Inc. TREATMENT WITH ANTI-ERBB2 ANTIBODIES.
JP3485252B2 (en) 1999-06-16 2004-01-13 インターナショナル・ビジネス・マシーンズ・コーポレーション Information processing method, information terminal support server, collaboration system, storage medium for storing information processing program
AUPQ105799A0 (en) 1999-06-18 1999-07-08 Victor Chang Cardiac Research Institute, The Cell growth inhibition
JP4579471B2 (en) 1999-06-25 2010-11-10 ジェネンテック, インコーポレイテッド Treatment of prostate cancer with anti-ErbB2 antibody
DK2283866T3 (en) 1999-06-25 2015-05-18 Genentech Inc METHODS OF TREATMENT USING ANTI-ERBB ANTIBODY-MAYTANSINOID CONJUGATES
EP1189641B1 (en) 1999-06-25 2009-07-29 Genentech, Inc. HUMANIZED ANTI-ErbB2 ANTIBODIES AND TREATMENT WITH ANTI-ErbB2 ANTIBODIES
US20040013667A1 (en) 1999-06-25 2004-01-22 Genentech, Inc. Treatment with anti-ErbB2 antibodies
US20030086924A1 (en) 1999-06-25 2003-05-08 Genentech, Inc. Treatment with anti-ErbB2 antibodies
GB9917012D0 (en) 1999-07-20 1999-09-22 Pharmacia & Upjohn Spa Combined preparations comprising antitumor agents
MXPA02000962A (en) 1999-07-29 2002-07-02 Medarex Inc Human monoclonal antibodies to her2 neu.
ES2330301T3 (en) 1999-08-27 2009-12-09 Genentech, Inc. DOSAGES FOR TREATMENT WITH ANTI-ERBB2 ANTIBODIES.
WO2001021192A2 (en) 1999-09-22 2001-03-29 Corixa Corporation Methods for diagnosis and therapy of hematological and virus-associated malignancies
GB9925958D0 (en) 1999-11-02 1999-12-29 Bundred Nigel J Therapeutic use
AU2001227966A1 (en) 2000-01-20 2001-07-31 Chiron Corporation Methods for treating tumors
US20030022918A1 (en) 2000-02-29 2003-01-30 Horak Ivan David Farnesyl protein transferase inhibitor combinations with an her2 antibody
US6632979B2 (en) 2000-03-16 2003-10-14 Genentech, Inc. Rodent HER2 tumor model
US6767541B2 (en) 2000-03-20 2004-07-27 The Regents Of The University Of California HER-2/neu overexpression abrogates growth inhibitory pathways
WO2001076630A1 (en) 2000-04-06 2001-10-18 Kyowa Hakko Kogyo Co., Ltd. Diagnostics and remedies for rheumatoid arthritis
GB0008368D0 (en) 2000-04-06 2000-05-24 Astrazeneca Ab Combination product
CZ20023748A3 (en) 2000-05-15 2003-04-16 Pharmacia Italia S.P.A. Aromatase inhibitors and monoclonal anti-HER2 antibodies functioning as antitumor agents
US7306801B2 (en) 2000-05-15 2007-12-11 Health Research, Inc. Methods of therapy for cancers characterized by overexpression of the HER2 receptor protein
CN102698265A (en) 2000-05-19 2012-10-03 杰南技术公司 Gene detection assay for improving the likelihood of an effective response to an erbb antagonist cancer therapy
GB0017635D0 (en) 2000-07-18 2000-09-06 Pharmacia & Upjohn Spa Antitumor combined therapy
DE10036735C2 (en) 2000-07-27 2002-07-11 Infineon Technologies Ag Multiplier circuit with offset compensation and quadricorrelator
TWI317285B (en) 2000-07-28 2009-11-21 Dainippon Sumitomo Pharma Co New use and kit for remedies for cancer
JP2004527456A (en) 2000-08-09 2004-09-09 イムクローン システムズ インコーポレイティド Treatment of hyperproliferative diseases with EGF receptor antagonists
US6984494B2 (en) 2000-08-15 2006-01-10 Genentech, Inc. Analytical method
US6582919B2 (en) 2001-06-11 2003-06-24 Response Genetics, Inc. Method of determining epidermal growth factor receptor and HER2-neu gene expression and correlation of levels thereof with survival rates
CA2436910C (en) 2000-12-01 2014-06-17 Response Genetics, Inc. Method of determining epidermal growth factor receptor and her2-neu gene expression and correlation of levels thereof with survival rates
US20020142328A1 (en) 2000-12-01 2002-10-03 Danenberg Kathleen D. Method of determining a chemotherapeutic regimen by assaying gene expression in primary tumors
US7005278B2 (en) 2001-03-02 2006-02-28 Danenberg Kathleen D Method of determining dihydropyrimidine dehydrogenase gene expression
US6602670B2 (en) 2000-12-01 2003-08-05 Response Genetics, Inc. Method of determining a chemotherapeutic regimen based on ERCC1 expression
WO2002045653A2 (en) 2000-12-08 2002-06-13 Uab Research Foundation Combination radiation therapy and chemotherapy in conjuction with administration of growth factor receptor antibody
EP1349574A2 (en) 2001-01-09 2003-10-08 MERCK PATENT GmbH Combination therapy using receptor tyrosine kinase inhibitors and angiogenesis inhibitors
WO2002087619A1 (en) 2001-04-27 2002-11-07 Takeda Chemical Industries, Ltd. Preventive/therapeutic method for cancer
CA2449166A1 (en) 2001-05-08 2002-11-14 Merck Patent Gesellschaft Mit Beschraenkter Haftung Combination therapy using anti-egfr antibodies and anti-hormonal agents
ITRM20010408A1 (en) 2001-07-10 2003-01-10 Univ Napoli Federico Ii CYTOTOXIC HUMAN MINI-ANTIBODY FOR CANCER CELLS THAT EXPRESS THE ERBB2 RECEPTOR.
WO2003012072A2 (en) 2001-08-03 2003-02-13 The Trustees Of The University Of Pennsylvania Monoclonal antibodies to activated erbb family members and methods of use thereof
US20030068318A1 (en) 2001-09-28 2003-04-10 O'brien Timothy Treatment of uterine serous papillary cancer
US20030096823A1 (en) 2001-11-16 2003-05-22 Beryl Asp Method for the treatment of cardiotoxicity induced by antitumor compounds
US20030175845A1 (en) 2002-03-13 2003-09-18 Kalbag Suresh M. Use of sulfitolysis in high performance peptide mapping
US20030190689A1 (en) 2002-04-05 2003-10-09 Cell Signaling Technology,Inc. Molecular profiling of disease and therapeutic response using phospho-specific antibodies
JP2005534623A (en) 2002-04-08 2005-11-17 スミスクライン ビーチャム コーポレーション ERB family inhibitors and methods of treating cancer comprising administering RAF and / or RAS inhibitors
CA2481515C (en) 2002-04-10 2013-10-01 Genentech, Inc. Anti-her2 antibody variants
ITTO20020340A1 (en) 2002-04-19 2003-10-20 Biother Di Contardi Gabriella LOCATION OF THE HER2 RECEPTOR BY HUMANIZED BIOTINYLATE ANTIBODY.
US20030202973A1 (en) 2002-04-29 2003-10-30 Dr. George Pieczenik Treatment of refractory human tumors with epidermal growth factor receptor and HER1 mitogenic ligand (EGFRML) antagonists
AU2003235470A1 (en) 2002-06-19 2004-01-06 Smithkline Beecham Corporation Predictive markers in cancer therapy
PT1585966E (en) 2002-07-15 2012-02-20 Hoffmann La Roche Treatment of cancer with the anti-erbb2 antibody rhumab 2c4
US20040013297A1 (en) 2002-07-18 2004-01-22 Roger Lo Method for performing color gamut compression
ES2629602T5 (en) 2002-09-11 2021-06-08 Genentech Inc Protein purification
WO2004048525A2 (en) 2002-11-21 2004-06-10 Genentech, Inc. Therapy of non-malignant diseases or disorders with anti-erbb2 antibodies
AU2003302821B2 (en) 2002-12-11 2009-05-07 Cell Signaling Technology, Inc. Method for predicting the response to HER2-directed therapy
WO2004063709A2 (en) 2003-01-08 2004-07-29 Bristol-Myers Squibb Company Biomarkers and methods for determining sensitivity to epidermal growth factor receptor modulators
US20040231909A1 (en) 2003-01-15 2004-11-25 Tai-Yang Luh Motorized vehicle having forward and backward differential structure
ES2663248T3 (en) 2004-03-02 2018-04-11 The Johns Hopkins University PIK3CA gene mutations in human cancers
CA2567293C (en) 2004-05-27 2017-05-16 The Regents Of The University Of Colorado Methods for prediction of clinical outcome to epidermal growth factor receptor inhibitors by cancer patients
KR20160096228A (en) 2004-07-22 2016-08-12 제넨테크, 인크. Her2 antibody composition
ES2426031T3 (en) * 2005-10-24 2013-10-18 The Johns Hopkins University Improved methods for BEAMing
AU2007282535B9 (en) 2006-08-08 2013-06-20 Chugai Seiyaku Kabushiki Kaisha Pyrimidine derivative as PI3K inhibitor and use thereof
EP1980626A1 (en) 2007-04-13 2008-10-15 Het Nederlands Kanker Instituut Involvement of lipid kinase, and signal transduction pathway comprising said lipid kinase, in resistance to HER2-targeting therapy
CL2009000241A1 (en) 2008-02-07 2010-09-03 Chugai Pharmaceutical Co Ltd Compounds derived from 5- (2-morpholin-4-yl-7h-pyrrolo [2,3-d] pyrimidin-4-yl) pyrimidin-2-ylamine; Preparation process; pharmaceutical composition; and use of the compounds to treat or prevent a proliferative disease such as cancer.
US20100041048A1 (en) 2008-07-31 2010-02-18 The Johns Hopkins University Circulating Mutant DNA to Assess Tumor Dynamics
EP2475789A4 (en) 2009-09-09 2013-12-18 Quintiles Transnat Corp Methods for predicting responsiveness of a disease or disorder to a receptor tyrosine kinase inhibitor by analysis of mutations in pik3ca
WO2011060380A1 (en) 2009-11-14 2011-05-19 The Regents Of The University Of California Pik3ca mutation status and sash1 expression predicts synergy between lapatinib and an akt inhibitor in her2 positive breast cancer
EP2510121A1 (en) 2009-12-11 2012-10-17 Wyeth LLC Phosphatidylinositol-3-kinase pathway biomarkers

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102021126650A1 (en) 2021-10-14 2023-04-20 Rheinische Friedrich-Wilhelms-Universität Bonn, Körperschaft des öffentlichen Rechts METHOD OF DETERMINING THE PROBABILITY OF RESPONSE OF A MALIGNANT DISEASE TO TREATMENT WITH A PHARMACEUTICAL INHIBITING AGENT
WO2023062115A1 (en) 2021-10-14 2023-04-20 Rheinische Friedrich-Wilhelms-Universität Bonn Methods for determining the likelihood of a malignant disease responding to treatment with a pharmaceutical inhibitor

Also Published As

Publication number Publication date
EP2788500A1 (en) 2014-10-15
WO2013083810A1 (en) 2013-06-13
US9376715B2 (en) 2016-06-28
US20150079076A1 (en) 2015-03-19

Similar Documents

Publication Publication Date Title
US9376715B2 (en) Methods for detecting mutations in the catalytic subunit of the phosphoinositol-3 kinase (PIK3CA) gene
JP7181854B2 (en) Identification of patients in need of PD-L1 inhibitor combination therapy
JP6513355B2 (en) Gene detection assays to improve the likelihood of an effective response to ERBB antagonist cancer therapy
JP5705836B2 (en) Modulators for HER2 signaling in gastric cancer patients expressing HER2
WO2010052225A1 (en) Modulators for her2 signaling in normal her2 expressing settings

Legal Events

Date Code Title Description
STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION