US20160235833A1 - Chimeric Factor H Binding Proteins (fHBP) and Methods of Use - Google Patents
Chimeric Factor H Binding Proteins (fHBP) and Methods of Use Download PDFInfo
- Publication number
- US20160235833A1 US20160235833A1 US14/992,872 US201614992872A US2016235833A1 US 20160235833 A1 US20160235833 A1 US 20160235833A1 US 201614992872 A US201614992872 A US 201614992872A US 2016235833 A1 US2016235833 A1 US 2016235833A1
- Authority
- US
- United States
- Prior art keywords
- fhbp
- naturally occurring
- amino acid
- modular
- group
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000034 method Methods 0.000 title claims abstract description 55
- 102000016550 Complement Factor H Human genes 0.000 title description 3
- 108010053085 Complement Factor H Proteins 0.000 title description 3
- 108091008324 binding proteins Proteins 0.000 title description 2
- 102000014914 Carrier Proteins Human genes 0.000 title 1
- 101710186862 Factor H binding protein Proteins 0.000 claims abstract description 375
- 241000588650 Neisseria meningitidis Species 0.000 claims abstract description 66
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 153
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 121
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 89
- 239000000203 mixture Substances 0.000 claims description 67
- 150000007523 nucleic acids Chemical class 0.000 claims description 46
- 229920001184 polypeptide Polymers 0.000 claims description 46
- 108020004707 nucleic acids Proteins 0.000 claims description 41
- 102000039446 nucleic acids Human genes 0.000 claims description 41
- 238000004519 manufacturing process Methods 0.000 claims description 37
- 241000588653 Neisseria Species 0.000 claims description 26
- 239000012528 membrane Substances 0.000 claims description 23
- 241000282414 Homo sapiens Species 0.000 claims description 19
- 230000002950 deficient Effects 0.000 claims description 18
- 230000002163 immunogen Effects 0.000 claims description 15
- 150000004676 glycans Chemical class 0.000 claims description 13
- 229920001282 polysaccharide Polymers 0.000 claims description 13
- 239000005017 polysaccharide Substances 0.000 claims description 13
- 108700028369 Alleles Proteins 0.000 claims description 12
- 230000015572 biosynthetic process Effects 0.000 claims description 10
- 238000002360 preparation method Methods 0.000 claims description 7
- 238000003786 synthesis reaction Methods 0.000 claims description 6
- 241000124008 Mammalia Species 0.000 claims description 5
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 5
- 230000005875 antibody response Effects 0.000 claims description 3
- 230000000844 anti-bacterial effect Effects 0.000 abstract description 46
- 108090000623 proteins and genes Proteins 0.000 description 100
- 102000004169 proteins and genes Human genes 0.000 description 61
- 210000004027 cell Anatomy 0.000 description 60
- 235000018102 proteins Nutrition 0.000 description 60
- 125000000539 amino acid group Chemical group 0.000 description 40
- 235000001014 amino acid Nutrition 0.000 description 33
- 230000014509 gene expression Effects 0.000 description 33
- 230000000890 antigenic effect Effects 0.000 description 32
- 229940024606 amino acid Drugs 0.000 description 26
- 150000001413 amino acids Chemical group 0.000 description 26
- 238000004458 analytical method Methods 0.000 description 25
- 230000001580 bacterial effect Effects 0.000 description 25
- 239000000427 antigen Substances 0.000 description 24
- 102000036639 antigens Human genes 0.000 description 24
- 108091007433 antigens Proteins 0.000 description 24
- 229960005486 vaccine Drugs 0.000 description 24
- 239000013598 vector Substances 0.000 description 21
- 238000009739 binding Methods 0.000 description 20
- 230000027455 binding Effects 0.000 description 19
- 239000002775 capsule Substances 0.000 description 19
- 230000000875 corresponding effect Effects 0.000 description 17
- 210000002966 serum Anatomy 0.000 description 17
- 239000002158 endotoxin Substances 0.000 description 16
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 15
- 210000004899 c-terminal region Anatomy 0.000 description 15
- 201000010099 disease Diseases 0.000 description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 15
- 241000894006 Bacteria Species 0.000 description 13
- 239000002671 adjuvant Substances 0.000 description 11
- 239000000463 material Substances 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 241001212279 Neisseriales Species 0.000 description 10
- 208000002352 blister Diseases 0.000 description 10
- 230000003247 decreasing effect Effects 0.000 description 10
- 230000003053 immunization Effects 0.000 description 10
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 10
- 230000004048 modification Effects 0.000 description 10
- 238000012986 modification Methods 0.000 description 10
- 230000006798 recombination Effects 0.000 description 10
- 238000005215 recombination Methods 0.000 description 10
- 230000002829 reductive effect Effects 0.000 description 10
- 238000012360 testing method Methods 0.000 description 10
- 241001465754 Metazoa Species 0.000 description 9
- 239000003599 detergent Substances 0.000 description 9
- 238000002649 immunization Methods 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 238000003556 assay Methods 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 150000001875 compounds Chemical class 0.000 description 8
- 230000036039 immunity Effects 0.000 description 8
- 229920006008 lipopolysaccharide Polymers 0.000 description 8
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 239000004471 Glycine Substances 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 7
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 230000000295 complement effect Effects 0.000 description 7
- 238000009472 formulation Methods 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 210000004408 hybridoma Anatomy 0.000 description 7
- 230000028993 immune response Effects 0.000 description 7
- 208000015181 infectious disease Diseases 0.000 description 7
- 239000002773 nucleotide Substances 0.000 description 7
- 125000003729 nucleotide group Chemical group 0.000 description 7
- 230000001717 pathogenic effect Effects 0.000 description 7
- 230000009257 reactivity Effects 0.000 description 7
- 230000003252 repetitive effect Effects 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 6
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 208000024891 symptom Diseases 0.000 description 6
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 5
- 238000002965 ELISA Methods 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 102000004895 Lipoproteins Human genes 0.000 description 5
- 108090001030 Lipoproteins Proteins 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- 244000052616 bacterial pathogen Species 0.000 description 5
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 5
- 238000004422 calculation algorithm Methods 0.000 description 5
- 210000004520 cell wall skeleton Anatomy 0.000 description 5
- 108091036078 conserved sequence Proteins 0.000 description 5
- 238000009826 distribution Methods 0.000 description 5
- 238000012239 gene modification Methods 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 230000005017 genetic modification Effects 0.000 description 5
- 235000013617 genetically modified food Nutrition 0.000 description 5
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 5
- 239000001963 growth medium Substances 0.000 description 5
- -1 lbpB Proteins 0.000 description 5
- 239000013612 plasmid Substances 0.000 description 5
- 108091033319 polynucleotide Proteins 0.000 description 5
- 102000040430 polynucleotide Human genes 0.000 description 5
- 239000002157 polynucleotide Substances 0.000 description 5
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 5
- 229920000053 polysorbate 80 Polymers 0.000 description 5
- 230000001681 protective effect Effects 0.000 description 5
- 238000010188 recombinant method Methods 0.000 description 5
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 5
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 5
- 230000002588 toxic effect Effects 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- 230000002103 transcriptional effect Effects 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- NFFPKRVXIPSSQR-JJYYJPOSSA-N (2s,3r,4r)-2,3,4,5-tetrahydroxypentanamide Chemical compound NC(=O)[C@@H](O)[C@H](O)[C@H](O)CO NFFPKRVXIPSSQR-JJYYJPOSSA-N 0.000 description 4
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 4
- 241000588677 Neisseria meningitidis serogroup B Species 0.000 description 4
- 241000040340 Oat mosaic virus Species 0.000 description 4
- 108091034117 Oligonucleotide Proteins 0.000 description 4
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 4
- CTMZLDSMFCVUNX-VMIOUTBZSA-N cytidylyl-(3'->5')-guanosine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=C(C(N=C(N)N3)=O)N=C2)O)[C@@H](CO)O1 CTMZLDSMFCVUNX-VMIOUTBZSA-N 0.000 description 4
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 238000000605 extraction Methods 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 238000002955 isolation Methods 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 239000008188 pellet Substances 0.000 description 4
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- 229930182490 saponin Natural products 0.000 description 4
- 150000007949 saponins Chemical class 0.000 description 4
- 235000002639 sodium chloride Nutrition 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 229940031439 squalene Drugs 0.000 description 4
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- XETCRXVKJHBPMK-MJSODCSWSA-N trehalose 6,6'-dimycolate Chemical compound C([C@@H]1[C@H]([C@H](O)[C@@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](COC(=O)C(CCCCCCCCCCC3C(C3)CCCCCCCCCCCCCCCCCC)C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)O2)O)O1)O)OC(=O)C(C(O)CCCCCCCCCCCCCCCCCCCCCCCCC)CCCCCCCCCCC1CC1CCCCCCCCCCCCCCCCCC XETCRXVKJHBPMK-MJSODCSWSA-N 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 238000009631 Broth culture Methods 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 108700020354 N-acetylmuramyl-threonyl-isoglutamine Proteins 0.000 description 3
- 101100203230 Neisseria meningitidis serogroup B (strain MC58) siaA gene Proteins 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 3
- 108010093965 Polymyxin B Proteins 0.000 description 3
- 101710132190 Porin B Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 206010040047 Sepsis Diseases 0.000 description 3
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 210000002421 cell wall Anatomy 0.000 description 3
- 230000009260 cross reactivity Effects 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- KXGVEGMKQFWNSR-LLQZFEROSA-N deoxycholic acid Chemical compound C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(O)=O)C)[C@@]2(C)[C@@H](O)C1 KXGVEGMKQFWNSR-LLQZFEROSA-N 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 239000003022 immunostimulating agent Substances 0.000 description 3
- 230000003308 immunostimulating effect Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- JMUHBNWAORSSBD-WKYWBUFDSA-N mifamurtide Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCC)COP(O)(=O)OCCNC(=O)[C@H](C)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)OC(O)[C@@H]1NC(C)=O JMUHBNWAORSSBD-WKYWBUFDSA-N 0.000 description 3
- 229960005225 mifamurtide Drugs 0.000 description 3
- 210000003205 muscle Anatomy 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 229920000024 polymyxin B Polymers 0.000 description 3
- 229960005266 polymyxin b Drugs 0.000 description 3
- 235000004400 serine Nutrition 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 102000003390 tumor necrosis factor Human genes 0.000 description 3
- YHQZWWDVLJPRIF-JLHRHDQISA-N (4R)-4-[[(2S,3R)-2-[acetyl-[(3R,4R,5S,6R)-3-amino-4-[(1R)-1-carboxyethoxy]-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid Chemical compound C(C)(=O)N([C@@H]([C@H](O)C)C(=O)N[C@H](CCC(=O)O)C(N)=O)C1[C@H](N)[C@@H](O[C@@H](C(=O)O)C)[C@H](O)[C@H](O1)CO YHQZWWDVLJPRIF-JLHRHDQISA-N 0.000 description 2
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical group N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 2
- OBMZMSLWNNWEJA-XNCRXQDQSA-N C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 Chemical compound C1=CC=2C(C[C@@H]3NC(=O)[C@@H](NC(=O)[C@H](NC(=O)N(CC#CCN(CCCC[C@H](NC(=O)[C@@H](CC4=CC=CC=C4)NC3=O)C(=O)N)CC=C)NC(=O)[C@@H](N)C)CC3=CNC4=C3C=CC=C4)C)=CNC=2C=C1 OBMZMSLWNNWEJA-XNCRXQDQSA-N 0.000 description 2
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical compound O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 102100031416 Gastric triacylglycerol lipase Human genes 0.000 description 2
- FZHXIRIBWMQPQF-UHFFFAOYSA-N Glc-NH2 Natural products O=CC(N)C(O)C(O)C(O)CO FZHXIRIBWMQPQF-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- 102000005720 Glutathione transferase Human genes 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000737574 Homo sapiens Complement factor H Proteins 0.000 description 2
- 101000941284 Homo sapiens Gastric triacylglycerol lipase Proteins 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 201000009906 Meningitis Diseases 0.000 description 2
- 108700015872 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine Proteins 0.000 description 2
- 101100509462 Nicotiana attenuata JAR4 gene Proteins 0.000 description 2
- 101710116435 Outer membrane protein Proteins 0.000 description 2
- 101710176384 Peptide 1 Proteins 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- PRXRUNOAOLTIEF-ADSICKODSA-N Sorbitan trioleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCC\C=C/CCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCC\C=C/CCCCCCCC PRXRUNOAOLTIEF-ADSICKODSA-N 0.000 description 2
- 101710120037 Toxin CcdB Proteins 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- NWMHDZMRVUOQGL-CZEIJOLGSA-N almurtide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)CO[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(C)=O)C=O NWMHDZMRVUOQGL-CZEIJOLGSA-N 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 229940037003 alum Drugs 0.000 description 2
- 230000001727 anti-capsular Effects 0.000 description 2
- 239000013602 bacteriophage vector Substances 0.000 description 2
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000024203 complement activation Effects 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 229940104302 cytosine Drugs 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 229940009976 deoxycholate Drugs 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- 230000007893 endotoxin activity Effects 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 238000011049 filling Methods 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000000703 high-speed centrifugation Methods 0.000 description 2
- 238000002744 homologous recombination Methods 0.000 description 2
- 230000006801 homologous recombination Effects 0.000 description 2
- 102000045512 human CFH Human genes 0.000 description 2
- 238000001114 immunoprecipitation Methods 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- 150000002632 lipids Chemical group 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 238000000464 low-speed centrifugation Methods 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 210000004877 mucosa Anatomy 0.000 description 2
- 125000001446 muramyl group Chemical group N[C@@H](C=O)[C@@H](O[C@@H](C(=O)*)C)[C@H](O)[C@H](O)CO 0.000 description 2
- 229940105132 myristate Drugs 0.000 description 2
- 239000007764 o/w emulsion Substances 0.000 description 2
- 229920002113 octoxynol Polymers 0.000 description 2
- 229940066429 octoxynol Drugs 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 229920000136 polysorbate Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 210000002345 respiratory system Anatomy 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 208000013223 septicemia Diseases 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- TUNFSRHWOTWDNC-UHFFFAOYSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 2
- 241001515965 unidentified phage Species 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- JYZJYKOZGGEXSX-UHFFFAOYSA-N 2-hydroxymyristic acid Chemical compound CCCCCCCCCCCCC(O)C(O)=O JYZJYKOZGGEXSX-UHFFFAOYSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- ODHCTXKNWHHXJC-VKHMYHEASA-N 5-oxo-L-proline Chemical compound OC(=O)[C@@H]1CCC(=O)N1 ODHCTXKNWHHXJC-VKHMYHEASA-N 0.000 description 1
- XZIIFPSPUDAGJM-UHFFFAOYSA-N 6-chloro-2-n,2-n-diethylpyrimidine-2,4-diamine Chemical compound CCN(CC)C1=NC(N)=CC(Cl)=N1 XZIIFPSPUDAGJM-UHFFFAOYSA-N 0.000 description 1
- 206010001052 Acute respiratory distress syndrome Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 101100509461 Arabidopsis thaliana JAR1 gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- QYOVMAREBTZLBT-KTKRTIGZSA-N CCCCCCCC\C=C/CCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO Chemical compound CCCCCCCC\C=C/CCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO QYOVMAREBTZLBT-KTKRTIGZSA-N 0.000 description 1
- TXCIAUNLDRJGJZ-BILDWYJOSA-N CMP-N-acetyl-beta-neuraminic acid Chemical compound O1[C@@H]([C@H](O)[C@H](O)CO)[C@H](NC(=O)C)[C@@H](O)C[C@]1(C(O)=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-BILDWYJOSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 102000000989 Complement System Proteins Human genes 0.000 description 1
- 108010069112 Complement System Proteins Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 101100245206 Dictyostelium discoideum psmC4 gene Proteins 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 102000015689 E-Selectin Human genes 0.000 description 1
- 108010024212 E-Selectin Proteins 0.000 description 1
- 101100483656 Escherichia coli (strain K12) ugd gene Proteins 0.000 description 1
- 241001198387 Escherichia coli BL21(DE3) Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 238000000729 Fisher's exact test Methods 0.000 description 1
- 230000010558 Gene Alterations Effects 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 206010019280 Heart failures Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 238000007476 Maximum Likelihood Methods 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 208000034762 Meningococcal Infections Diseases 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- BRGMHAYQAZFZDJ-PVFLNQBWSA-N N-Acetylglucosamine 6-phosphate Chemical compound CC(=O)N[C@H]1[C@@H](O)O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O BRGMHAYQAZFZDJ-PVFLNQBWSA-N 0.000 description 1
- 241000588654 Neisseria cinerea Species 0.000 description 1
- 241000588673 Neisseria elongata Species 0.000 description 1
- 241000588651 Neisseria flavescens Species 0.000 description 1
- 241000588649 Neisseria lactamica Species 0.000 description 1
- 241000287798 Neisseria meningitidis CU385 Species 0.000 description 1
- 241000897304 Neisseria meningitidis H44/76 Species 0.000 description 1
- 241000287773 Neisseria meningitidis M6190 Species 0.000 description 1
- 241001174901 Neisseria meningitidis alpha275 Species 0.000 description 1
- 241000947238 Neisseria meningitidis serogroup C Species 0.000 description 1
- 241001573069 Neisseria meningitidis serogroup Y Species 0.000 description 1
- 241000588659 Neisseria mucosa Species 0.000 description 1
- 241000588660 Neisseria polysaccharea Species 0.000 description 1
- 241000588645 Neisseria sicca Species 0.000 description 1
- 241001136170 Neisseria subflava Species 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 101100504410 Oryza sativa subsp. japonica GH3.5 gene Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 101150093941 PORA gene Proteins 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 101710094909 Porin PorA Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 208000013616 Respiratory Distress Syndrome Diseases 0.000 description 1
- 101001120437 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Lipid A palmitoyltransferase PagP Proteins 0.000 description 1
- 101100155269 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) udg gene Proteins 0.000 description 1
- 241000754835 Sapovirus isolates Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 206010040070 Septic Shock Diseases 0.000 description 1
- 108090000233 Signal peptidase II Proteins 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 108010092220 Tetraacyldisaccharide 4'-kinase Proteins 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102000057144 Uridine Diphosphate Glucose Dehydrogenase Human genes 0.000 description 1
- 108010054269 Uridine Diphosphate Glucose Dehydrogenase Proteins 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 1
- 238000005903 acid hydrolysis reaction Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 150000005215 alkyl ethers Chemical class 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000118 anti-neoplastic effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000027645 antigenic variation Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 101150008162 arnC gene Proteins 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 102000023732 binding proteins Human genes 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000012472 biological sample Substances 0.000 description 1
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 210000003850 cellular structure Anatomy 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000012866 crystallographic experiment Methods 0.000 description 1
- 230000001351 cycling effect Effects 0.000 description 1
- 238000007822 cytometric assay Methods 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000007071 enzymatic hydrolysis Effects 0.000 description 1
- 238000006047 enzymatic hydrolysis reaction Methods 0.000 description 1
- 229960003276 erythromycin Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 229940044627 gamma-interferon Drugs 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 230000004077 genetic alteration Effects 0.000 description 1
- 231100000118 genetic alteration Toxicity 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 238000000265 homogenisation Methods 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000000951 immunodiffusion Effects 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 231100001231 less toxic Toxicity 0.000 description 1
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000004335 litholrubine BK Substances 0.000 description 1
- 239000006210 lotion Substances 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002934 lysing effect Effects 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 208000037941 meningococcal disease Diseases 0.000 description 1
- 229940124731 meningococcal vaccine Drugs 0.000 description 1
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 108700007621 mifamurtide Proteins 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 238000002887 multiple sequence alignment Methods 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 1
- DVEKCXOJTLDBFE-UHFFFAOYSA-N n-dodecyl-n,n-dimethylglycinate Chemical compound CCCCCCCCCCCC[N+](C)(C)CC([O-])=O DVEKCXOJTLDBFE-UHFFFAOYSA-N 0.000 description 1
- 210000001989 nasopharynx Anatomy 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 101150047779 ompB gene Proteins 0.000 description 1
- 230000000625 opsonophagocytic effect Effects 0.000 description 1
- 230000004768 organ dysfunction Effects 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- 229960005030 other vaccine in atc Drugs 0.000 description 1
- 239000003002 pH adjusting agent Substances 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 210000002741 palatine tonsil Anatomy 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 208000008494 pericarditis Diseases 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 229940051841 polyoxyethylene ether Drugs 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 101150031507 porB gene Proteins 0.000 description 1
- 230000020971 positive regulation of blood coagulation Effects 0.000 description 1
- 230000018338 positive regulation of fibrinolysis Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 229940043131 pyroglutamate Drugs 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- CVHZOJJKTDOEJC-UHFFFAOYSA-N saccharin Chemical compound C1=CC=C2C(=O)NS(=O)(=O)C2=C1 CVHZOJJKTDOEJC-UHFFFAOYSA-N 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 108700004121 sarkosyl Proteins 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000036303 septic shock Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- KSAVQLQVUXSOCR-UHFFFAOYSA-M sodium lauroyl sarcosinate Chemical compound [Na+].CCCCCCCCCCCC(=O)N(C)CC([O-])=O KSAVQLQVUXSOCR-UHFFFAOYSA-M 0.000 description 1
- 229940045885 sodium lauroyl sarcosinate Drugs 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 229940035044 sorbitan monolaurate Drugs 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 229940032094 squalane Drugs 0.000 description 1
- YYGNTYWPHWGJRM-AAJYLUCBSA-N squalene Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CC\C=C(/C)CC\C=C(/C)CCC=C(C)C YYGNTYWPHWGJRM-AAJYLUCBSA-N 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 238000000528 statistical test Methods 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 101150095556 tbpB gene Proteins 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 230000001018 virulence Effects 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/095—Neisseria
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/12—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria
- C07K16/1203—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-negative bacteria
- C07K16/1217—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from bacteria from Gram-negative bacteria from Neisseriaceae (F)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55566—Emulsions, e.g. Freund's adjuvant, MF59
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
Definitions
- This invention relates to vaccines for diseases caused by Neisseria meningitidis.
- Neisseria meningitidis is a Gram-negative bacterium which colonizes the human upper respiratory tract and is responsible for worldwide sporadic and cyclical epidemic outbreaks of, most notably, meningitis and sepsis. The attack and morbidity rates are highest in children under 2 years of age. Like other Gram-negative bacteria, Neisseria meningitidis typically possess a cytoplasmic membrane, a peptidoglycan layer, an outer membrane which together with the capsular polysaccharide constitute the bacterial wall, and pili, which project into the outside environment. Encapsulated strains of Neisseria meningitidis are a major cause of bacterial meningitis and septicemia in children and young adults. The prevalence and economic importance of invasive Neisseria meningitidis infections have driven the search for effective vaccines that can confer immunity across different strains, and particularly across genetically diverse group B strains with different serotypes or serosubtypes.
- fHbp Factor H Binding Protein
- lipoprotein 2086 Fletcher et al, Infect Immun 2004; 72:2088-2100
- An important function of fHbp is to bind human complement fH, which down-regulates complement activation. Binding of fH to the bacterial surface is an important mechanism by which the pathogen survives in non-immune human serum or blood and evades innate host defenses.
- N. meningitidis strains From analysis of 71 N. meningitidis strains in the first study, and more than 200 strains in the second study, representative of its genetic and geographic diversity, N. meningitidis strains have been sub-divided into three fHbp variant groups (referred to as variant 1 (v.1), variant 2 (v.2), and variant 3 (v.3)) based on amino acid sequence variability and immunologic cross-reactivity (Masignani et al. J Exp Med 2003; 197:789-99). Other workers (Fletcher et al, 2004) have subdivided the protein into two sub-families designated A (which includes v.2 and v.3 of Masignani) and B (v.1).
- Variant 1 strains account for about 60% of disease-producing group B isolates (Masignani et al. 2003, supra). Within each variant group, there is on the order of about 92% or greater conservation of amino acid sequence. Specifically, conservation within each variant group ranges between 89 and 100%, while between the variant groups (e.g., between v.1 and v.2) the conservation can be as low as 59%. The protein is expressed by all known strains of N. meningitidis.
- Chimeric fHbps that can elicit antibodies that are bactericidal for different fHbp variant strains of N. meningitidis , and methods of use, are provided.
- FIG. 1A-1G is Table 7 that lists the source strains and characteristics of about 69 unique factor H binding proteins.
- FIG. 2A-2E is Table 8 that lists unique sequences in fHbp variable segment A through E and number of unique peptides from each variant group containing the segment ID.
- Segment ID is an identifier for each variable segment. Distinct sequence variants were assigned a unique identifier beginning with a letter, A through E, to represent the segment; followed by an ⁇ or ⁇ to indicate homology of the segment with either the corresponding fHbp segment from peptide ID 1 (fHbp v.1) or peptide ID 28 (fHbp v.3), respectively, followed by a number for each distinct sequence. Numbers in variant groups 1, 2, and 3 are provided for some segment IDs of each segment (A through E) in subtables.
- FIG. 3 is a phylogram of fHbp based on 69 unique amino acid sequences.
- panel A is a schematic representation of fHbp showing positions of linkers, which are also referred herein as invariant segment (I), shown as vertical rectangles, together with variable segments (V).
- Panel B is a table listing the amino acid sequence for each invariant segment.
- FIG. 5 is a phylogram of unique fHbp amino acid sequences in variable segments A (residues 8-73) (panel A) and B (residues 79-93) (panel B).
- FIG. 6 is a phylogram of unique fHbp amino acid sequences in variable segments C (residues 98-159) (panel A) and D (residues 162-180) (panel B).
- FIG. 7 is a phylogram of unique fHbp amino acid sequences in variable segment E (residues 186-253).
- FIG. 8 panel A is a schematic representation of 9 fHbp modular architectures deduced from phylogenic analysis, including the more common 6 modular group types. Gray segments represent ⁇ progenitor sequences homologous to peptide ID 1 while white segments represent ⁇ progenitor sequences homologous to peptide 28. About 94% of the unique fHbp amino acid sequences analyzed herein belong to one of the first six modular group types (I, II, III, IV, V, and VI).
- Panel B Four of the analyzed fHbps are classified as one of three modular architectures shown. The architectures contain junction points within a variable segment, designated by arrows.
- Panel C is a table listing the amino acid residues at which an ⁇ progenitor sequence switches to a ⁇ or vice versa (J 1 , J 2 , and J 3 ) within a variable segment.
- FIG. 9 presents structural models of factor H binding protein based on the coordinates of fHbp in a complex with a fragment of human factor H (Schneider et al. (2009) Nature 458:890-3). Left models in each of the following panels show fHbps facing membrane side; center models are facing exposed side; and the right models depict membrane side of the fHbp down.
- Panel A Cartoon representation depicting the two structural domains.
- B Space-filling model with factor H-binding residues depicted in black and the amino acid residues of the invariant segments in white.
- C Space-filling model with the amino acid residues of the invariant segments depicted in white as in panel B, and the residues affecting the epitopes of anti-fHbp mAbs shown in black.
- FIG. 10A-10I is Table 9 that lists certain characteristics of unique factor H binding protein variants use in an analysis that include 275 peptide IDs.
- Sequence identifiers for N-terminal variable sequences are as follows: GGGS (SEQ ID NO: 7), SGSGG (SEQ ID NO: 8), GGGSGG (SEQ ID NO:9), GGGSGS (SEQ ID NO:10), GSGG (SEQ ID NO:11), GGGSGGGG (SEQ ID NO:12), GGGSGGGSGG (SEQ ID NO:13), and GGSGG (SEQ ID NO:14).
- FIG. 11 shows fHbp expression measured by immunoblotting with infrared detection.
- Panels A and C Recombinant proteins in modular groups I (ID 1) or VI (ID 77), or heat-killed bacterial cells from strains expressing fHbp in the corresponding modular groups.
- the modular group I proteins were detected with murine anti-fHbp mAb JAR 5, which recognizes nearly all fHbps in modular groups I and IV.
- the modular group VI proteins were detected with anti-fHbp mAb JAR 31, which recognizes nearly all proteins in modular groups II, III, V and VI (See Table 6 in example section).
- Panels B and D Standard curves from the corresponding binding of the recombinant proteins shown in Panels A and C.
- FIG. 13 shows serum bactericidal activities of serum pools from mice immunized with fHbps from modular groups I to VI.
- the black bars represent the median titers of 3 to 4 serum pools for each modular group tested against homologous test strains.
- the white bars represent the median titer of the respective heterologous serum pools against the test strain.
- + refers to relative expression of fHbp by each of the strains; strains with +/ ⁇ representing low fHbp-expressing strains (see values in Table 5 in example section)
- the present disclosure provides chimeric fHbps that can elicit antibodies that are bactericidal for different fHBP variant strains of N. meningitidis , and methods of use.
- “Factor H Binding Protein” (fHbp), which is also known in the literature as GNA1870, GNA 1870, ORF2086, LP2086 (lipoprotein 2086), and “741” refers to a polypeptide of N. meningitidis that is a lipoprotein presented on the surface of the bacterium.
- N. meningitidis strains have been sub-divided into three fHbp variant groups (referred to as variant 1 (v.1), variant 2 (v.2), and variant 3 (v.3) in some reports (Masignani et al. 2003, supra) and Family A and B in other reports (see, e.g., Fletcher et al.
- variant 2 (v.2) fHbp protein (from strain 8047, peptide ID 77) and variant 3 (v.3) fHBP (from strain M1239, peptide ID 28) differ by ⁇ 1 and +7 amino acid residues, respectively, from that of MC58 (peptide ID 1)
- the numbering used to refer to residues for v.2 and v.3 fHbp proteins differs from numbering based on the actual amino acid sequences of these proteins.
- reference to a leucine residue (L) at position 166 of the v.2 or v.3 fHBP sequence refers to the residue at position 165 of the v.2 protein and at position 173 in the v.3 protein.
- heterologous refers to two components that are defined by structures derived from different sources.
- the chimeric polypeptide includes operably linked amino acid sequences that can be derived from different polypeptides of different phylogenic groupings (e.g., a first component from an ⁇ and a second component from a ⁇ progenitor amino acid sequences).
- heterologous in the context of a polynucleotide encoding a chimeric polypeptide includes operably linked nucleic acid sequence that can be derived from different genes (e.g., a first component from a nucleic acid encoding a fHbp v.1 polypeptide and a second component from a nucleic acid encoding a fHbp v.2 polypeptide).
- Such chimeric polypeptides as described herein provide for presentation of epitopes in a single polypeptide that are normally found in different polypeptides.
- heterologous nucleic acids include expression constructs in which a nucleic acid comprising a coding sequence is operably linked to a regulatory element (e.g., a promoter) that is from a genetic origin different from that of the coding sequence (e.g., to provide for expression in a host cell of interest, which may be of different genetic origin relative to the promoter, the coding sequence or both).
- a regulatory element e.g., a promoter
- a T7 promoter operably linked to a polynucleotide encoding an fHbp polypeptide or domain thereof is said to be a heterologous nucleic acid.
- Heterologous in the context of recombinant cells can refer to the presence of a nucleic acid (or gene product, such as a polypeptide) that is of a different genetic origin than the host cell in which it is present.
- a Neisserial amino acid or nucleic acid sequence of one strain is heterologous to a Neisserial host of another strain.
- “Derived from” in the context of an amino acid sequence or polynucleotide sequence is meant to indicate that the polypeptide or nucleic acid has a sequence that is based on that of a reference polypeptide or nucleic acid (e.g., a naturally occurring fHbp protein or encoding nucleic acid), and is not meant to be limiting as to the source or method in which the protein or nucleic acid is made.
- a reference polypeptide or nucleic acid e.g., a naturally occurring fHbp protein or encoding nucleic acid
- “Derived from” in the context of bacterial strains is meant to indicate that a strain was obtained through passage in vivo, or in in vitro culture, of a parental strain and/or is a recombinant cell obtained by modification of a parental strain.
- Constant amino acid substitution refers to a substitution of one amino acid residue for another sharing chemical and physical properties of the amino acid side chain (e.g., charge, size, hydrophobicity/hydrophilicity). “Conservative substitutions” are intended to include substitution within the following groups of amino acid residues: gly, ala; val, ile, leu; asp, glu; asn, gln; ser, thr; lys, arg; and phe, tyr. Conservative amino acid substitutions in the context of a chimeric fHBP disclosed herein are selected so as to preserve presentation of an epitope of interest. Guidance for such substitutions can be drawn from alignments of amino acid sequences of polypeptides presenting the epitope of interest.
- protective immunity means that a vaccine or immunization schedule that is administered to a mammal induces an immune response that prevents, retards the development of, or reduces the severity of a disease that is caused by Neisseria meningitidis , or diminishes or altogether eliminates the symptoms of the disease.
- Protective immunity can be accompanied by production of bactericidal antibodies. It should be noted that production of bactericidal antibodies against Neisseria meningitidis is accepted in the field as predictive of a vaccine's protective effect in humans. (Goldschneider et al., 1969, J. Exp. Med. 129:1307; Borrow et al. 2001 Infect Immun. 69:1568).
- a disease caused by a strain of capsular group B of Neisseria meningitidis encompasses any clinical symptom or combination of clinical symptoms that are present in an infection of a human with a member of capsular group B of Neisseria meningitidis . These symptoms include but are not limited to: colonization of the upper respiratory tract (e.g.
- mucosa of the nasopharynx and tonsils by a pathogenic strain of capsular group B of Neisseria meningitidis , penetration of the bacteria into the mucosa and the submucosal vascular bed, septicemia, septic shock, inflammation, haemmorrhagic skin lesions, activation of fibrinolysis and of blood coagulation, organ dysfunction such as kidney, lung, and cardiac failure, adrenal hemorrhaging and muscular infarction, capillary leakage, edema, peripheral limb ischaemia, respiratory distress syndrome, pericarditis and meningitis.
- broad spectrum protective immunity means that a vaccine or immunization schedule elicits “protective immunity” against at least more than one strain (and can be against at least two, at least three, at least four, at least five, against at least eight, or more strains) of Neisseria meningitidis , wherein each of the strains expresses a different fHbp subvariant or fHbp variant.
- the present disclosure specifically contemplates and encompasses a vaccine or vaccination regimen that confers protection against a disease caused by a member of any capsular group (e.g., A, B, or C), with protection against disease caused by a capsular group B strain of Neisseria meningitidis being of interest due to the epidemiological prevalence of strains causing disease with this capsular group and lack of broadly effective group B vaccines.
- a member of any capsular group e.g., A, B, or C
- an antibody or “specifically immunoreactive with”, in the context of an antigen (e.g., a polypeptide antigen) refers to a binding reaction which is based on and/or is probative of the presence of the antigen in a sample which may also include a heterogeneous population of other molecules.
- an antigen e.g., a polypeptide antigen
- the specified antibody or antibodies bind(s) to a particular antigen or antigens in a sample and do not bind in a significant amount to other molecules present in the sample.
- an antibody or “specifically immunoreactive with” in the context of an epitope of an antigen (e.g., an epitope of a polypeptide) refers to a binding reaction which is based on and/or is probative of the presence of the epitope in an antigen (e.g., polypeptide) which may also include a heterogeneous population of other epitopes, as well as a heterogeneous population of antigens.
- the specified antibody or antibodies bind(s) to a particular epitope of an antigen and do not bind in a significant amount to other epitopes present in the antigen and/or in the sample.
- Immune response indicators include but are not limited to: antibody titer or specificity, as detected by an assay such as enzyme-linked immunoassay (ELISA), bactericidal assay, flow cytometry, immunoprecipitation, Ouchter-Lowny immunodiffusion; binding detection assays of, for example, spot, Western blot or antigen arrays; cytotoxicity assays, etc.
- an assay such as enzyme-linked immunoassay (ELISA), bactericidal assay, flow cytometry, immunoprecipitation, Ouchter-Lowny immunodiffusion
- binding detection assays of, for example, spot, Western blot or antigen arrays
- cytotoxicity assays etc.
- a “surface antigen” is an antigen that is present in a surface structure of Neisseria meningitidis (e.g. the outer membrane, capsule, pili, etc.).
- isolated refers to an entity of interest that is in an environment different from that in which the compound may naturally occur. “Isolated” is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.”
- Enriched means that a sample is non-naturally manipulated (e.g., by an experimentalist or a clinician) so that a compound of interest is present in a greater concentration (e.g., at least a three-fold greater, at least 4-fold greater, at least 8-fold greater, at least 64-fold greater, or more) than the concentration of the compound in the starting sample, such as a biological sample (e.g., a sample in which the compound naturally occurs or in which it is present after administration), or in which the compound was made (e.g., as in a bacterial polypeptide, antibody, chimeric polypeptide, and the like)
- a biological sample e.g., a sample in which the compound naturally occurs or in which it is present after administration
- the compound was made e.g., as in a bacterial polypeptide, antibody, chimeric polypeptide, and the like
- a “knock-out” or “knockout” of a target gene refers to an alteration in the sequence of the gene that results in a decrease of function of the target gene, e.g., such that target gene expression is undetectable or insignificant, and/or the gene product is not functional or not significantly functional.
- a “knockout” of a gene involved in LPS synthesis indicates means that function of the gene has been substantially decreased so that the expression of the gene is not detectable or only present at insignificant levels and/or a biological activity of the gene product (e.g., an enzymatic activity) is significantly reduced relative to prior to the modification or is not detectable.
- “Knock-outs” encompass conditional knock-outs, where alteration of the target gene can occur upon, for example, exposure to a predefined set of conditions (e.g., temperature, osmolarity, exposure to substance that promotes target gene alteration, and the like.
- a “knock-in” or “knockin” of a target gene refers to a genetic alteration in a host cell genome that that results in an increase in a function provided by the target gene.
- Non-naturally occurring refers to a protein (e.g. fHbp) that is not normally found in nature and is instead artificially produced and/or modified by a human.
- a non-naturally occurring subject fHbp can be made via chemical synthesis or recombinant methods.
- non-naturally occurring chimeras refers to “man-made chimeras” and encompass fHbp with heterologous components that are not found in nature.
- peptide ID 1 the native amino acid sequence of the v.1 fHBP of the N. meningitidis strain MC58 (peptide ID 1) was arbitrarily selected as a reference sequence for all native v.1, v.2, and v.3 fHbp amino acid sequences, as well as for the chimeric fHbps described herein. Unless otherwise noted, amino acid residue positions are also referred herein with reference to peptide ID 1. The sequence of peptide ID 1 is presented below:
- FIG. 4 panel A
- the rectangles in FIG. 4 , panel A represent the conserved sequences (I) and the variable segments are designated as the N-terminal element, V A , V B , V C , V D , or V E segments.
- the amino acid sequence of the conserved sequences are listed in FIG. 4 , panel B.
- fHbps naturally occurring fHbps can be defined by the formula: I 1 -Nte-I 2 -V A -I 3 -V B -I 4 -V C -I 5 -V D -I 6 -V E -I 7 , wherein “Nte” refers to the N-terminal element, “I” refers to an “invariant” segment, and “V” refers to a variable segment of either an ⁇ or a ⁇ progenitor type.
- the non-naturally occurring chimeric fHbps of the present disclosure can be constructed by various combinations of the V segments which are flanked by I segments.
- the invariant and variable segments which can be used in construction of such chimeric fHbps are described from N-terminus to C-terminus in more detail below.
- the progenitor groups ⁇ and ⁇ as described below are referred to 1 and 2, respectively.
- V A ⁇ 2-V B ⁇ 1-V C ⁇ 5-V D ⁇ 5-V E ⁇ 8 becomes A1.2-B1.1-C2.5-D1.5-E1.8.
- fHbps contain amino acid sequences that are conserved among all fHbp amino acid sequences analyzed herein.
- the conserved sequences flank variable segments that are derived from either the ⁇ or ⁇ progenitor amino acid sequences. These conserved sequences are referred to herein as “invariant sequences” or “invariant segments”, and may serve as sites of recombination in naturally-occurring fHbps. Where these invariant segments are flanked by variable segments, the invariant segments may be referred to as “linker” sequences. While these sequences exhibit amino acid sequence identity between the fHbps disclosed herein, such amino acid sequences may still tolerate certain conservative amino acid substitutions. As such, the term “invariant segment” as used herein should not be construed to be limited to the specific amino acid sequences described herein, and may at least contain one or more conservative amino acid substitutions.
- the most N-terminal invariant segment found in naturally-occurring fHbps starts at residue 1 and is of the amino acid sequence CSSG (SEQ ID NO:2).
- SEQ ID NO:2 amino acid sequence CSSG
- I 1 Immediately C-terminal to the first invariant segment CSSG (I 1 ) is a variable N-terminal element of about 1 to about 6 glycine or serine residues.
- the various N-terminal elements are listed in FIG. 1A-1G (Table 7) and FIGS. 10A-10I (Table 9).
- the second invariant segment (I 2 ) is of the amino acid sequence GG, which is positioned C-terminal to the N-terminal element and starts at residue 6, 7, or 11, depending on the length of the N-terminal element (e.g., in peptide ID 28 of variant 3, I 2 starts at residue 11).
- the next invariant segment, I 3 is defined by the amino acid sequence of SRFDF (SEQ ID NO:3) and is positioned at residue 74, C-terminal to I 2 and a variable segment.
- I 4 which is C-terminal to I 3 , is defined by the amino acid sequence GEFQ (SEQ ID NO:4) and is positioned at residue 94.
- I 5 is defined by the amino acid sequence DD and is C-terminal to I 4 at residue 159.
- I 6 positioned C-terminal to Is, is defined by IEHLK (SEQ ID NO:5) or IEHLE (SEQ ID NO: 6) and starts at residue 180.
- I 7 the most C-terminal invariant segment in naturally-occurring fHbps, starts at residue 252 and is defined by the amino acid sequence of KQ.
- residue position listed above at which each invariant segment starts may be shifted from 1 to 8 residues depending on the length of the N-terminal element and the amino acid sequence of the variable segments.
- residue numbering used in reference to non-naturally occurring chimeric fHbps throughout the present disclosure is based on the amino acid sequence numbering of the fHbp of MC58 (peptide ID 1), which is a variant 1 strain.
- the length of the invariant segments ranges from about 2 amino acid residues to about 5 amino acid residues.
- variable segments (V) are flanked by linkers, also referred herein as invariant segments (I).
- invariant segments I
- V A , V B , V C , V D , and V E each flanked by the invariant segments discussed above.
- each of the variable segments may be classified as being of one of the two progenitor amino acid sequences: ⁇ or ⁇ .
- V A ⁇ indicates that variable segment A is derived from an ⁇ progenitor amino acid sequence while V A ⁇ refers to a variable segment A derived from a ⁇ progenitor amino acid sequence.
- V A ⁇ 1 denotes that the variable segment A is of the amino acid sequence set forth as Segment ID A. ⁇ .1 in FIG. 2A (Table 8, segment A), which is one allele of the ⁇ progenitor sequences of variable segment A.
- the chimeric fHbp of the present disclosure contain a non-naturally occurring combination of variable segments in which each segment may be independently selected from either an ⁇ and a ⁇ progenitor type and/or a non-naturally occurring combination of any alleles of the corresponding segment shown in FIGS. 2A-2E , Table 8.
- the ⁇ and ⁇ progenitor variable segments are each defined by certain signature amino acid residues.
- the ⁇ progenitor variable segments exhibit sequence similarity to fHbp of variant 1 group (e.g. peptide ID 1), while the ⁇ progenitor variable segments exhibit sequence similarity to fHbp of variant 3 group (e.g. peptide ID 28).
- Signature amino acid residues of ⁇ or ⁇ progenitors for each variable segment are be discussed below.
- variable segments of the same progenitor type share amino acid sequence identity of at least 80%, at least 85%, at least 90%, at least 95%, and can be 100%.
- amino acid sequence identity drops by at least 10% to 40%.
- N-terminal element The most N-terminal variable segment is referred to herein as the N-terminal element (Nte) ( FIG. 4 ).
- the various N-terminal elements found in the fHbps analyzed are listed in FIGS. 1A-1G (Table 7) and also in FIGS. 10A-10I (Table 9). They range in length from 1 to 6 residues of glycine or a combination of glycine and serine.
- V A of an ⁇ progenitor comprises an amino acid sequence that is about 89 to 100% identical to Segment ID A. ⁇ .1 as presented in FIG. 2A (Table 8): V A ADIG AG LA DAL T A P LDHK DK S LQS LT LD QSVR KN E KL K L A AQGAEK T Y GNGD S L N TGKLKNDK V (SEQ ID NO: 15).
- V A ⁇ is further characterized by signature amino acid residues QSV, bolded in sequence. Certain residues that may have alternative amino acid residues among V A ⁇ of different fHbps are underlined.
- V A of a ⁇ progenitor comprises an amino acid sequence that is about 89 to 100% identical to Segment ID A. ⁇ .1 as set forth in FIG. 2A (Table 8): VAADIG T GLA DALTAPLDHK DKGLKSLTLE DSI P QNGTLT LSAQGAE K T F KA GD KDN SLN TGKLKNDK I (SEQ ID NO:67).
- V A ⁇ is further characterized by signature amino acid residues DSI and/or KDN, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among V A ⁇ of different fHbps are underlined.
- V B of an ⁇ progenitor comprises an amino acid sequence that is about 80% to 100% identical to Segment ID B. ⁇ .1 as set forth in FIG. 2B (Table 8): I R QIEV DGQL ITL ES (SEQ ID NO:85).
- V B ⁇ is further characterized by signature amino acid residues IRQ, bolded in the sequence. Certain residues that have alternative or deleted amino acid residues among V B ⁇ of different fHbps are underlined.
- V B of a ⁇ progenitor comprises an amino acid sequence that is about 100% identical to Segment ID B. ⁇ .1 as set forth in FIG. 2B (Table 8): VQKIEVDGQT ITLAS (SEQ ID NO:95). V B ⁇ is further characterized by signature amino acid residues VQK, bolded in the sequence.
- V C of an ⁇ progenitor comprises an amino acid sequence that is about 85 to 100% identical to Segment ID C. ⁇ .1 as presented in FIG. 2C (Table 8): VYKQS H SALT A L QTE QV QD S E H S GK MVAKR Q F R IGDI A GE HT S FDKL PEG GRAT YRGTAF G S (SEQ ID NO:96).
- V C ⁇ is further characterized by signature amino acid residues QDS, bolded in the sequence. Certain residues that have alternative or deleted amino acid residues among V C ⁇ of different fHbps are underlined.
- V C of a ⁇ progenitor comprises an amino acid sequence that is about 93 to 100% identical to Segment ID C. ⁇ .1 as presented in FIG. 2C (Table 8): IYK QD HSAVV ALQIEKINNP DK I DSLINQR SFLVSGLGGE HTAFNQL PG G KAEYHGKAF S S (SEQ ID NO:152).
- V C ⁇ is further characterized by signature amino acid residues NNP, bolded in sequence. This signature is found in all of V C ⁇ amino acid sequences. Certain residues that have alternative or deleted amino acid residues among V C ⁇ of different fHbps are underlined.
- V D of an ⁇ progenitor comprises an amino acid sequence that is about 89 to 100% identical to Segment ID D. ⁇ .1 as presented in FIG. 2D (Table 8): A G GKL T YTID FA A KQG H GK (SEQ ID NO: 174).
- V D ⁇ is further characterized by signature amino acid residues AG or AS, of which AG is bolded in sequence. Certain residues that have alternative or deleted amino acid residues among V D ⁇ of different fHbps are underlined.
- V D of a ⁇ progenitor comprises an amino acid sequence that is about 84 to 100% identical to Segment ID D. ⁇ .1 as presented in FIG. 2D (Table 8): PNGRLHY S ID FTKKQGYG R (SEQ ID NO: 192).
- V D ⁇ is further characterized by signature amino acid residues PN, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among V D ⁇ of different fHbps are underlined.
- V E of an ⁇ progenitor comprises an amino acid sequence that is about 86 to 100% identical to Segment ID E. ⁇ .1 as presented in FIG. 2E (Table 8): SPELNV D LA A AY IKPD E K HH AVISGSVLYN Q A EKGSYSLG IFG GKA QEVA GSAE V K T V NG I R HIGLAA (SEQ ID NO:195).
- V E ⁇ is further characterized by signature amino acid residues SLGI, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among V E ⁇ of different fHbps are underlined.
- V E of a ⁇ progenitor comprises an amino acid sequence that is about 94 to 100% identical to Segment ID E. ⁇ .1 as set forth in FIG. 2E (Table 8): T PE Q NV E LA S AELKADEKSH AVILGDTRY G G EEKGTYHLA LFGDRAQEIA GSATVKI R E K VHEI G IAG (SEQ ID NO:262).
- V E ⁇ is further characterized by signature amino acid residues HLAL, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among V E ⁇ of different fHbps are underlined.
- residue numbering used in reference to non-naturally occurring chimeric fHbps throughout the present disclosure is based on the amino acid sequence numbering of the fHbp of MC58 (peptide ID 1).
- residue position listed above at which each variable segment starts and ends may be shifted from 1 to 8 residues depending on the length of the N-terminal element and the amino acid sequence of the variable segments.
- Naturally occurring fHbp amino acid sequences can be described according to a modular architecture based on a combination of ⁇ or ⁇ progenitor segments flanked by invariable segments, as shown in FIG. 1A-1G (Table 7) and FIGS. 10A-10I (Table 9).
- naturally occurring fHbps exhibit particular combinations of modular segments, and can be classified accordingly into nine modular group types as shown in FIG. 8 , where gray variable segments correspond to the ⁇ progenitor sequences and white segments correspond to the ⁇ progenitor sequences.
- the Type I modular group is characterized by variable segments, all of which are derived from the ⁇ progenitor amino acid sequences.
- FHbps classified as belonging to the Type I modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- An example of a fHbp that is of the Type I modular group is peptide ID 1 from strain MC58. As noted above, peptide ID is from the factor H-binding protein database at Neisseria.org.
- the Type II modular group is characterized by variable segments, all of which are derived from the ⁇ progenitor.
- FHbps classified as belonging to the Type II modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- An example of a fHbp that is of the Type II modular group is peptide ID 28 from strain M1239. Nearly 60% of the fHbps in FIG. 1A-1G (Table 7) belong in either Type I or II modular group.
- variable segments from both ⁇ and ⁇ progenitors have variable segments from both ⁇ and ⁇ progenitors.
- One modular group defined by variable segments derived from both progenitors is Type III, in which variable segments V A and V B are derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type III modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B -I 4 -V C ⁇ -I 3 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- One example of a fHbp that belongs to the Type III modular group is peptide ID 22 from strain RM1090.
- Type IV is a modular group that has a variable segment V A derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type IV modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- a fHbp that belongs to the Type IV modular group is peptide ID 15 from strain NM452.
- An additional modular group is Type V, in which the variable segment V D is derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type V modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D -I 6 -V E ⁇ -I 7 .
- One example of a fHbp that belongs to the Type V modular group is peptide ID 79 from strain S3032.
- Type VI Another modular group set forth in FIG. 8 is Type VI, in which variable segments V C and V E are derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- a fHbp that belongs to the Type VI modular group is peptide ID 16 from strain 961-5945.
- Type VII Another modular group set forth in FIG. 8 is Type VII, in which variable segment V E are derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- One fHbp found to have the Type VI modular group is peptide ID 207 from strain 0167/03.
- Type VIII Another modular group set forth in FIG. 8 is Type VIII, in which variable segments V B is derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- One fHbp found to have the Type VIII modular group is peptide ID 67 from strain MA-5756.
- Type IX The last modular group set forth in FIG. 8 is Type IX, in which variable segments V B and V D are derived from the ⁇ progenitor and the rest of the variable segments from the ⁇ progenitor.
- FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I 1 -Nte-I 2 -V A ⁇ -I 3 -V B ⁇ -I 4 -V C ⁇ -I 5 -V D ⁇ -I 6 -V E ⁇ -I 7 .
- One Example of a fHbp that belongs to the Type IX modular group is peptide ID 175 from strain 19498.
- More than 98% of the unique fHbp amino acid sequences analyzed herein belong to one of the first six types of modular groups (I, II, III, IV, V, and VI) described above and schematically presented in FIG. 8 .
- the numbers of unique fHbp that belong to each of the modular groups are also listed on the right of the schematic in FIG. 8 .
- fHbps Four naturally occurring fHbps vary at least slightly from this nomenclature, and do not precisely fit into the first six modular group types set forth in FIG. 8 , panel A. These four fHbps “switch” from one progenitor amino acid sequence to another at a residue position that is within a canonical variable segment as described above. As a result, they each contain a heterologous variable segments and their junction points deviate from junction points of the rest of the fHbps found to be at I 3 , I 4 , I 5 , or I 6 defined above. See FIG. 8 , panel B for the modular architecture of these four fHbps along with the arrow pointing at the junction point for each. However, the junction points of these four naturally occurring fHbps still reside at conserved residue(s) found within the variable segment. See table in FIG. 8 , panel C.
- fHbp is a naturally occurring fHbp derived from strain CDC-1573 (peptide ID 55), in which the junction point where V A ⁇ switches to V A ⁇ resides in the middle of V A .
- the heterologous V A of peptide ID 55 may be represented as V A ( ⁇ ), signifying that the variable segment A comprises a ⁇ progenitor amino acid sequence starting at the N-terminus and switches to an ⁇ progenitor amino acid sequence toward the C-terminus.
- the junction point (J 1 ) of peptide ID 55 resides at a sequence of AQGAE (SEQ ID NO:278) conserved among all the V A sequences, which starts at residue position 50.
- Two other fHbps which contain junction points that are not in the residue position of I 3 , I 4 , I 5 , or I 6 , are peptide ID 24 and peptide ID 25, derived from strain M08 240117 and strain 6275, respectively. Their junction points (J 2 ) at which V B ⁇ switches to V B ⁇ reside in the middle of V B (residue 82), at which there is an amino acid sequence of IEV) conserved among all V B s.
- the V B of peptide ID 24 and 25 may be represented as V B ( ⁇ ).
- peptide ID 82 from strain MD1475 switches from V E ⁇ to V E ⁇ at residue A196 (J 3 ), which is conserved among all V E .
- the variable segment E of peptide ID 82 may be represented as V E ( ⁇ ).
- chimeric fHbps can be constructed using the invariant and variable segments of this modular architecture to produce amino acid sequences not found in nature.
- fHbp polypeptides, and encoding nucleic acids, from which segments of the chimeric fHbps of the present disclosure can be derived may be from any suitable N. meningitidis strain.
- N. meningitidis strains are divided into serologic groups (capsular groups), serotypes (PorB phenotypes) and subtypes (PorA phenotypes) on the basis of reactions with polyclonal (Frasch, C. E. and Chapman, 1973 , J. Infect. Dis. 127: 149-154) or monoclonal antibodies that interact with different surface antigens.
- Capsular grouping traditionally has been based on immunologically detectable variations in the capsular polysaccharide but is being replaced by PCR of genes encoding specific enzymes responsible for the biosynthesis of the structurally different capsular polysaccharides.
- About 12 capsular groups (including A, B, C, X, Y, Z, 29-E, and W-135) are known. Strains of the capsular groups A, B, C, Y and W-135 account for nearly all meningococcal disease.
- Serotyping traditionally has been based on monoclonal antibody defined antigenic differences in an outer membrane protein called Porin B (PorB). Antibodies defining about 21 serotypes are currently known (Sacchi et al., 1998 , Clin. Diag. Lab.
- Serosubtyping has been based on antibody defined antigenic variations on an outer membrane protein called Porin A (PorA). Both serotyping and serosubtyping are being replaced by PCR and/or DNA sequencing for identification of genes encoding the variable regions of PorB and PorA, respectively that are associated with mAb reactivity (e.g. Sacchi, Lemos et al., supra; Urwin et al., 1998 , Epidem. and Infect. 120:257).
- Porin A Porin A
- N. meningitidis strains of any capsular group may be used, N. meningitidis strains of capsular group B are of particular interest as sources from which nucleic acid encoding fHbp and domains thereof are derived.
- the chimeric fHbp can contain amino acid sequences that are at least 80%, at least 85%, at least 90%, or at least 95% identical to an amino acid sequence of a naturally occurring fHbp.
- Nucleic acids encoding fHbp polypeptides for use in construction of chimeric fHbps contemplated herein are known in the art. Examples of fHbp polypeptides are described in, for example, WO 2004/048404; Masignani et al. 2003 J Exp Med 197:789-799; Fletcher et al. Infect Immun 2004 2088-2100; Welsch et al. J Immunol 2004 172:5606-5615; and WO 99/57280. Nucleic acid (and amino acid sequences) for fHbp variants and subvariants are also provided in GenBank as accession nos.: NC_003112, GeneID: 904318 (NCBI Ref.
- NP_274866 peptide ID 1 from N. meningitidis strain MC58; AY548371 (AAT01290.1) (from N. meningitidis strain CU385); AY548370 (AAT01289.1) (from N. meningitidis strain H44/76); AY548377 (AAS56920.1) peptide ID 4 from N. meningitidis strain M4105; AY548376 (AAS56919.1) (from N. meningitidis strain M1390); AY548375 (AAS56918.1) (from N. meningitidis strain NZ98/254); AY548374 (AAS56917.1) (from N.
- the immature fHbp protein includes a leader sequence of about 19 residues.
- sequences of nucleic acid that can encode for, and provide for expression of, a polypeptide having such an amino acid sequence.
- polypeptides and nucleic acids having sequences that are at least 80%, at least 85%, at least 90%, or at least 95% identical in sequence to the amino acid and nucleic acids.
- nucleic acid refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical over a specified region), when compared and aligned for maximum correspondence over a designated region, e.g., a V E or a region at least about 40, 45, 50, 55, 60, 65 or more amino acids or nucleotides in length, and can be up to the full-length of the reference amino acid or nucleotide sequence (e.g., a full-length fHbp).
- the disclosure specifically contemplates both naturally-occurring polymorphisms and synthetically produced amino acid sequences and their encoding nucleic acids.
- sequence comparison typically one sequence acts as a reference sequence (e.g., a naturally-occurring fHbp polypeptide sequence), to which test sequences are compared.
- a reference sequence e.g., a naturally-occurring fHbp polypeptide sequence
- test and reference sequences are input into a computer program, sequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- BLAST and BLAST 2.0 algorithms are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov).
- Further exemplary algorithms include ClustalW (Higgins D., et al. (1994) Nucleic Acids Res 22: 4673-4680), available at www.ebi.ac.uk/Tools/clustalw/index.html.
- residue positions which are not identical differ by conservative amino acid substitutions.
- Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine
- a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine
- a group of amino acids having amide-containing side chains is asparagine and glutamine
- a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan
- a group of amino acids having basic side chains is lysine, arginine, and histidine
- a group of amino acids having sulfur-containing side chains is cysteine and methionine.
- Sequence identity between two nucleic acids can also be described in terms of hybridization of two molecules to each other under stringent conditions.
- the hybridization conditions are selected following standard methods in the art (see, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.).
- An example of stringent hybridization conditions is hybridization at 50° C. or higher and 0.1 ⁇ SSC (15 mM sodium chloride/1.5 mM sodium citrate).
- Another example of stringent hybridization conditions is overnight incubation at 42° C.
- Stringent hybridization conditions are hybridization conditions that are at least as stringent as the above representative conditions, where conditions are considered to be at least as stringent if they are at least about 80% as stringent, typically at least 90% as stringent as the above specific stringent conditions.
- the chimeric fHbp of the present disclosure refers to non-naturally occurring chimeric fHbp, including fHbps that may be described by a modular architecture as those set forth in FIG. 8 , panels A and B and a modular architecture not shown in FIG. 8 , panels A and B.
- the term “chimeric factor H binding protein” or “chimeric fHbp” refers to a polypeptide comprising, from N-terminus to C-terminus, a group of five variable segments represented by V A , V B , V C , V D , and V E , in which the combination of ⁇ / ⁇ progenitor segments and/or combination of alleles of which is not found in nature.
- the chimeric fHbps of the present disclosure can contain at least one or more of the variable segments derived from a different progenitor than at least one other variable segment in the chimeric fHbp.
- the chimeric fHbp contains at least one variable segment of an ⁇ progenitor amino acid sequences and at least one variable segment of a ⁇ progenitor, such that the combination is not found in nature.
- the fHbp may also be of a modular architecture shown in FIG. 8 , panel A (e.g. modular I or II in which all variable segments are ⁇ or ⁇ , respectively), in which each segment is of an allele such that the combination of the alleles is not found in nature.
- variable segments may be flanked by invariant segments (I 2 , I 3 , I 4 , I 5 , I 6 , I 7 ), which can act as linkers for the variable segments.
- invariant segments I 2 , I 3 , I 4 , I 5 , I 6 , I 7
- linkers for the variable segments.
- variable segments (V A , V B , V C , V D , and V E ) can be derived from either an ⁇ or a ⁇ progenitor amino acid sequence.
- Chimeric fHbp can optionally include a leader sequence, e.g., to provide for expression of the chimeric fHbp on a cell surface of a bacterial host cell.
- Chimeric fHbp may also include about 1, 5, 10, or more residues as an N-terminal element (Nte) and/or C-terminal element (Cte).
- Nte N-terminal element
- Cte C-terminal element
- the Nte may comprise 1, 2, or 6 glycine residues, or about 6 residues of a mixture of glycines and serines following the N-terminal most invariant segment (I 1 ).
- chimeric fHbps of the present disclosure can optionally include an N-terminal element, one or both of invariant segments that flank the N-terminal element, and/or most C-terminal invariant segment (1 7 ).
- a chimeric fHbp comprising one or more of these optional features can be described by the following formula:
- variable segments (V A , V B , V C , V D , and V E ) can be derived from either an ⁇ or ⁇ progenitor amino acid sequence.
- chimeric fHbp of the present disclosure may also contain one or more variable segments that are heterologous with respect to ⁇ and ⁇ progenitor amino acid sequences.
- a heterologous variable segment refers to a variable segment that comprises both a contiguous ⁇ and a contiguous ⁇ progenitor amino acid sequences, with the point at which the amino acid sequence “switches” to the other progenitor sequence referred to herein as a “junction point”.
- junction points within a variable segment described above for peptide ID 55, 24, 25, and 82 may be used to construct a chimeric fHbp having a heterologous variable segment. See table in FIG. 8 , panel C for the conserved residues in each variable segment that serve as junction points.
- Variable segments of the non-naturally occurring chimeric fHbps of the present disclosure may have an amino acid sequence of at least 80%, at least 85%, at least 90%, at least 95% identical to a corresponding segment in a naturally occurring fHbp, and can be 100% identical in amino acid sequence.
- chimeric fHbps examples include those containing one or more of the following variable segments. Each segment can be independently selected from any alleles in the corresponding segment shown in FIGS. 2A-2E , Table 8. The variable segments are described in more detail below using certain alleles as examples.
- VA contains a contiguous amino acid sequence that is at least 85%, at least 90%, or at least 95% identical to Segment ID A. ⁇ .1 or A. ⁇ .1 (SEQ ID NO:15 or NO:67) shown in FIG. 2A (Table 8), e.g., at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown in FIG. 2A (Table 8) for Segment A.
- V B contains a contiguous amino acid sequence that is at least 75%, at least 80%, at least 90%, or at least 95% identical to Segment ID B. ⁇ .1 or B. ⁇ .1 (SEQ ID NO:85 or NO:95) shown in FIG. 2B (Table 8), e.g., at least 75%, at least 80%, at least 90%, or at least 95% identical to one of the amino acid sequences shown in FIG. 2B (Table 8) for Segment B.
- V C contains s a contiguous amino acid sequence that is at least 80%, at least 85%, at least 90%, or at least 95% identical to Segment ID C. ⁇ .1 or C. ⁇ .1 (SEQ ID NO:96 or NO:152) shown in FIG. 2C (Table 8), e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown in FIG. 2C (Table 8) for Segment C.
- V D contains a contiguous amino acid sequence that is at least 80%, at least 85%, at least 90%, or at least 95% identical to Segment ID D. ⁇ .1 or D. ⁇ .1 (SEQ ID NO:174 or NO:192) shown in FIG. 2D (Table 8), e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown in FIG. 2D (Table 8) for Segment D.
- V E contains a contiguous amino acid sequence that is at least 80%, at least 85%, at least 90%, or at least 95% identical to Segment ID E. ⁇ .1 or E. ⁇ .1 (SEQ ID NO: 195 or NO:262) shown in FIG. 2E (Table 8), e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown in FIG. 2E (Table 8) for Segment E.
- variable segments in the chimeric fHbp of the present disclosure may also be of the similar length as the corresponding segments listed in FIG. 2A-2E (Table 8).
- a variable segment may be no more than about 50, 30, 20, 10, 5, or 1 amino acid residues less or more than one of the corresponding amino acid sequences shown in FIG. 2A-2E (Table 8).
- the chimeric fHbps of the present disclosure have a full length amino acid sequence that is not found in a naturally occurring fHbp. Most of the naturally occurring fHbps which contain only ⁇ or only ⁇ progenitor sequences or combinations thereof fall into one of the following modular groups: I, II, III, IV, V, VI, VII, VIII, or IX (see FIG. 8 ). Non-naturally occurring fHbps of the present disclosure can also be of a modular group other than I, II, III, IV, V, VI, VII, VIII, or IX. The non-naturally occurring fHbps of the present disclosure can be described by new modular groups encompassing non-naturally occurring amino acid sequences that are built based on the modular architecture described herein. Some examples of chimeric fHbps of the present disclosure are presented below.
- the chimeric fHbps of the present disclosure encompass those that can be described in terms of one or more of, for example, the invariant and variable segments and their progenitor type, the presence or absence of an epitope(s) specifically bound by a mAb, or any combination of such features that may be present in the chimeric fHbps.
- Modular group may also be designed to maintain or include certain antibody epitopes. Certain antibodies are found to be bactericidal against a specific variant of N. meningitidis but not a different variant. If a chimeric fHbp of a modular group contains variable segments that present multiple epitopes, each specific for an antibody bactericidal against a different variant, the chimeric fHbp may be useful to elicit antibodies or immune response effective against a broad spectrum of N. meningitidis .
- a chimeric fHbp may be made to comprise V A ⁇ , V C ⁇ , and V D ⁇ , where epitopes of JAR4, JAR3, and JAR32 reside, respectively.
- a chimeric fHbp may have V D that is derived from 3 progenitor sequences while the rest of the variable segments remain as derivations from ⁇ progenitor sequences.
- Such chimeric fHbp comprises variable segments represented as V A ⁇ , V B ⁇ , V C ⁇ , V D ⁇ , and V E ⁇ ; and its first and second junction points are at I 5 and I 6 , respectively.
- an fHbp belonging to another modular group encompassing non-naturally occurring chimeric fHbp may contain V A ⁇ , V B ⁇ , V C ⁇ , V D ⁇ , and V E ⁇ ; and its junction point resides at Is.
- An additional example of a modular group encompasses non-naturally occurring fHbp that comprises V A ⁇ , V B ⁇ , V C ⁇ , V D ⁇ , and V E ⁇ as the invariable segments.
- examples of non-naturally occurring chimeric fHbps including those described above may be of modular groups represented by the following formula but not limited to:
- V A ⁇ - I 3 - V B ⁇ - I 4 - V C - I 5 - V D - I 6 - V E ;
- V A ⁇ - I 3 - V B ⁇ - I 4 - V C - I 5 - V D - I 6 - V E ;
- variable segment (V A , V B , V C , V D , or V E ) is not followed by an ⁇ or a ⁇ (e.g. V C , V D , and V E in the fifth modular group from the top) represents a variable segment that can be derived from either an ⁇ or a ⁇ progenitor amino acid sequence.
- the formula may also include a variable N-terminal element, its flanking invariable sequences (I 1 and I 2 ), or the most C-terminal invariable segment (I 7 ), omitted in the formula above.
- each variable segment of the fHbps described by the formulas above can be of any allele.
- the chimeric fHbp of the present disclosure also encompass those that contain all a or all 0 segments, in which each of the segments is of an allele such that the combination of all a or all 0 allelic segments is not found in nature.
- non-naturally occurring fHbp of the present disclosure may comprise one or more heterologous variable segments. These heterologous variable segment-containing fHbps may also be described by modular architectures other than those set forth in FIG. 8 , panel A.
- non-naturally occurring fHbp of the present disclosure include those having: a heterologous V A ( ⁇ ), but do not have ⁇ progenitor sequence for all of V B , V C , V D , and V E ; a heterologous V B ( ⁇ ), but do not have a V A of ⁇ progenitor sequence together with V C , V D , and V E of ⁇ progenitor sequence; and a heterologous V E ( ⁇ ), but do not have ⁇ progenitor sequence for all of V A , V B , and V C together with a progenitor sequence for V D .
- non-naturally occurring fHbps are presented by several examples below, each containing one heterologous variable segment.
- non-naturally occurring fHbps are not limited to the examples, e.g. an fHbp may comprise more than one heterologous variable segment.
- a heterologous variable segment-containing fHbp may be one comprising a heterologous V A , such as V A ( ⁇ ) as exemplified by peptide ID 55, in which not all of V B , V C , V D , and V E are of the ⁇ progenitor amino acid sequences.
- a non-naturally occurring fHbp may also comprise V A ( ⁇ ), and in which V B , V C , V D , and V E are independently selected from ⁇ and ⁇ .
- Another exemplary non-naturally occurring fHbp may comprise V B ( ⁇ ) as exemplified by peptide ID 24, in which V A is of a ⁇ progenitor and not all of V C , V D , and V E are of the ⁇ progenitor amino acid sequences.
- a non-naturally occurring fHbp may comprise V B ( ⁇ ), in which V A is of a ⁇ progenitor.
- a non-naturally occurring fHbp may comprise V B ( ⁇ ) in which V A , V C , V D , and V E are independently selected from ⁇ and ⁇ .
- a non-naturally occurring fHbp may comprise a heterologous V E , such as V E ( ⁇ ) seen in peptide ID 82, together with V D ⁇ , in which not all of V A , V B , V C are of the ⁇ progenitor origin.
- a non-naturally occurring fHbp may comprise V E ( ⁇ ) together with V D ⁇ , in which V A , V B , and V C are independently selected from a and ⁇ .
- Another example of a non-naturally occurring fHbp that contains a heterologous variable segment is one that comprises V E ( ⁇ ), in which V A , V B , V C , and V D are independently selected from a and 3.
- the chimeric fHbp of the present disclosure may comprise one or more variable segments in which one or more residues may be mutated relative to the amino acid sequence found in the naturally occurring fHbp so as to introduce an epitope of interest.
- These epitopes are referred to herein “heterologous epitopes” since they are heterologous to the variable segment in which they reside.
- Site-directed mutagenesis may be used to introduce one or more heterologous epitopes for a specific antibody of interest into a variable segment that naturally does not contain such epitope.
- mutations to insert, delete, or substitute one or more amino acid residues may be used to create chimeric fHbp of the present disclosure.
- Various mutations may be also screened for an fHbp that is effective as vaccines or may be immunogenic to elicit bactericidal antibodies.
- an fHbp may comprise an epitope that binds to an antibody JAR13, normally found in V E of a ⁇ progenitor sequence and not in an ⁇ progenitor sequence.
- the epitope may be introduced into a V E ⁇ sequence.
- Selective mutation allows the amino acid sequence of V E to be derived from the ⁇ progenitor type except for a specific site for the JAR13 epitope.
- epitopes may be introduced into the corresponding variable segment to include or maintain regions of desired antigenicity.
- Chimeric fHbps also encompass chimeric fHbp that contain two or more epitopes that elicit antibodies that, when both are bound to their respective epitopes, exhibit enhanced bactericidal activity against N. meningitidis than when either one is bound alone.
- the combination of JAR 4 and JAR 5 mAbs exhibit higher level of bactericidal activity against N. meningitidis than when each is used alone in a human-complement-mediated assay.
- Chimeric fHbp can be designed so as to ensure that such epitopes are maintained or to introduce such combination of epitopes.
- Chimeric fHbps can also be designed to include an epitope(s) that elicits antibodies that, when bound to fHbp, inhibit fH binding.
- an epitope(s) that elicits antibodies that, when bound to fHbp, inhibit fH binding.
- the epitopes bound by the monoclonal antibodies JAR3, JAR 5, JAR11, or JAR32/35 are bound by antibody, binding of fHbp to fH is inhibited.
- the presence of such fH-binding epitopes in the chimeric fHbp polypeptides can provide for production of antibodies that can facilitate protection through this pathway.
- Chimeric polypeptides described herein can include additional heterologous amino acid sequences, e.g., to provide an N-terminal methionine or derivative thereof (e.g., pyroglutamate) as a result of expression in a bacterial host cell (e.g., E. coli ) and/or to provide a chimeric polypeptide having a fusion partner at its N-terminus or C-terminus.
- Fusion partners of interest include, for example, glutathione-S-transferase (GST), maltose binding protein (MBP), His 6 -tag, and the like, as well as leader peptides from other proteins, particularly lipoproteins. Fusion partners can provide for additional features, such as in facilitating isolation and purification of the chimeric polypeptide.
- Native fHbp usually contains an N-terminal cysteine to which a lipid moiety can be covalently attached.
- This cysteine residue is usually lipidated in the naturally-occurring protein, and can be lipidated in the chimeric fHbps disclosed herein.
- reference to “cysteine” or “C” at this position specifically includes reference to both an unmodified cysteine as well as to a cysteine that is lipidated (e.g., due to post-translational modification).
- the chimeric fHbp can be lipidated or non-lipidated.
- lipidated proteins in vitro, (see, e.g., Andersson et al., 2001 J. Immunological Methods 255(1-2):135-48) or in vivo are known in the art.
- lipidated fHbp previously has been purified from the membrane fraction of E. coli protein by detergent extraction (Fletcher et al., 2004 Infection and Immunity 72(4):2088-100), which method may be adapted for the production of lipidated chimeric fHbp.
- Lipidated proteins may be of interest as such can be more immunogenic than soluble protein (see, e.g., Fletcher et al., 2004 Infection and Immunity 72(4):2088-100).
- the chimeric fHbp can be generated using recombinant techniques to manipulate nucleic acids of different fHbps known in the art to provide constructs encoding a chimeric fHbp of interest.
- nucleic acids encoding a variety of different v.1, v.2, and v.3 fHbps of N. meningitidis are available in the art, and their nucleotide sequences are known.
- nucleotide sequences encoding the chimeric fHbps can be modified so as to optimize the codon usage to facilitate expression in a host cell of interest (e.g., E. coli, N. meningitidis , human (as in the case of a DNA-based vaccine), and the like). Methods for production of codon optimized sequences are known in the art.
- the present disclosure also features methods of screening for an immunogenic composition comprising a chimeric fHbp, vaccine against bacterial pathogens, antibodies and nucleic acid encoding the same.
- the methods may involve evaluating the ability of a specific chimeric fHbp to elicit bactericidal antibodies and/or to provide a broad spectrum immunity against bacterial pathogens.
- the methods can involve assessing the ability of antibodies elicited by immunization with a chimeric fHbp of the present disclosure to inhibit fH binding to fHbp of N. meningitidis of diverse variant groups and/or to elicit bactericidal activity.
- the antibody may be elicited in a host animal immunized with an immunogenic composition comprising a chimeric fHbp of the present disclosure or screened in a phage display library for its specific affinity to a candidate chimeric fHbp.
- the methods find particular use in identifying and/or evaluating antibody having bactericidal and/or anti-neoplastic activity.
- a method of evaluating binding of an antibody to a bacterial cell comprises: (a) immunizing a host animal with a composition comprising a chimeric fHbp of the present disclosure, (b) isolating antibodies from the host animal that have binding affinity to the chimeric fHbp, (c) contacting a bacterial cell with the isolated antibodies; and (d) assessing binding of the antibody to the bacterial cell. Additional steps may include assessing the competitive binding of the antibody to fHbp with human factor H; assessing the bactericidal activity against a bacterial pathogen when incubated in vitro with complement; or assessing the ability of the antibody administered to an animal to confer passive protection against infection.
- the antibody is in an antibody population, and the method further comprises: (c) isolating one or more antibodies of the antibody population that bind the bacterial cell.
- a featured aspect is isolated antibody that is bactericidal against the bacterial cell, which may include, for example, complement-mediated bactericidal activity and/or opsonophagocytic activity capable of decreasing the viability of the bacteria in human blood.
- the subject method may also include assessing the susceptibility of a host animal administered with a vaccine comprising a chimeric fHbp to a bacterial pathogen.
- Bacterial pathogen of particular interest are N. meningitidis of any or all fHbp variant groups, of diverse capsular groups, such as N. meningitidis Serogroup B, N. meningitidis Serogroup C, N. meningitidis Serogroup X, N. meningitidis Serogroup Y, N. meningitidis Serogroup W-135, and the like.
- Chimeric fHbps can be produced by any suitable method, including recombinant and non-recombinant methods (e.g., chemical synthesis). Where the chimeric fHbp is produced using recombinant techniques, the methods can involve any suitable construct and any suitable host cell, which can be a prokaryotic or eukaryotic cell, usually a bacterial or yeast host cell, more usually a bacterial cell. Methods for introduction of genetic material into host cells include, for example, transformation, electroporation, conjugation, calcium phosphate methods and the like. The method for transfer can be selected so as to provide for stable expression of the introduced chimeric fHbp-encoding nucleic acid.
- the chimeric fHbp-encoding nucleic acid can be provided as an inheritable episomal element (e.g., plasmid) or can be genomically integrated.
- Suitable vectors for transferring chimeric fHbp-encoding nucleic acid can vary in composition.
- Integrative vectors can be conditionally replicative or suicide plasmids, bacteriophages, and the like.
- the constructs can include various elements, including for example, promoters, selectable genetic markers (e.g., genes conferring resistance to antibiotics (for instance kanamycin, erythromycin, chloramphenicol, or gentamycin)), origin of replication (to promote replication in a host cell, e.g., a bacterial host cell), and the like.
- selectable genetic markers e.g., genes conferring resistance to antibiotics (for instance kanamycin, erythromycin, chloramphenicol, or gentamycin)
- origin of replication to promote replication in a host cell, e.g., a bacterial host cell
- the choice of vector will depend upon a variety of factors such as the type of cell in which propagation is desired and the purpose of propagation.
- vectors are useful for amplifying and making large amounts of the desired DNA sequence.
- Other vectors are suitable for expression in cells in culture.
- Still other vectors are suitable for transfer and expression in cells in a whole animal.
- the choice of appropriate vector is well within the skill of the art. Many such vectors are available commercially.
- the vector can be an expression vector based on episomal plasmids containing selectable drug resistance markers and elements that provide for autonomous replication in different host cells (e.g., in both E. coli and N. meningitidis ).
- episomal plasmids containing selectable drug resistance markers and elements that provide for autonomous replication in different host cells (e.g., in both E. coli and N. meningitidis ).
- a “shuttle vector” is the plasmid pFP10 (Pagotto et al. Gene 2000 244:13-19).
- Constructs can be prepared by, for example, inserting a polynucleotide of interest into a construct backbone, typically by means of DNA ligase attachment to a cleaved restriction enzyme site in the vector.
- the desired nucleotide sequence can be inserted by homologous recombination or site-specific recombination.
- homologous recombination is accomplished by attaching regions of homology to the vector on the flanks of the desired nucleotide sequence, while site-specific recombination can be accomplished through use of sequences that facilitate site-specific recombination (e.g., cre-lox, att sites, etc.).
- Nucleic acid containing such sequences can be added by, for example, ligation of oligonucleotides, or by polymerase chain reaction using primers comprising both the region of homology and a portion of the desired nucleotide sequence.
- Vectors can provide for extrachromosomal maintenance in a host cell or can provide for integration into the host cell genome. Vectors are amply described in numerous publications well known to those in the art, including, e.g., Short Protocols in Molecular Biology, (1999) F. Ausubel, et al., eds., Wiley & Sons. Vectors may provide for expression of the nucleic acids encoding a chimeric fHBP, may provide for propagating the subject nucleic acids, or both.
- vectors examples include but are not limited to those derived from recombinant bacteriophage DNA, plasmid DNA or cosmid DNA.
- plasmid vectors such as pBR322, pUC 19/18, pUC 118, 119 and the M13 mp series of vectors may be used.
- pET21 is also an expression vector that may be used.
- Bacteriophage vectors may include ⁇ gt10, ⁇ gt11, ⁇ gt18-23, ⁇ ZAP/R and the EMBL series of bacteriophage vectors.
- vectors that may be utilized include, but are not limited to, pJB8, pCV 103, pCV 107, pCV 108, pTM, pMCS, pNNL, pHSG274, COS202, COS203, pWE15, pWE16 and the charomid 9 series of vectors.
- an expression cassette may be employed for expression of a chimeric fHbp of interest.
- the expression vector provides transcriptional and translational regulatory sequences, and may provide for inducible or constitutive expression, where the coding region is operably linked under the transcriptional control of the transcriptional initiation region, and a transcriptional and translational termination region. These control regions may be native to an fHbp from which the chimeric fHbp is derived, or may be derived from exogenous sources.
- transcriptional and translational regulatory sequences may include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
- Promoters can be either constitutive or inducible, and can be a strong constitutive promoter (e.g., T7, and the like).
- Expression vectors generally have convenient restriction sites located near the promoter sequence to provide for the insertion of nucleic acid sequences encoding proteins of interest.
- a selectable marker operative in the expression host may be present to facilitate selection of cells containing the vector.
- the expression construct may include additional elements.
- the expression vector may have one or two replication systems, thus allowing it to be maintained in organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.
- the expression construct may contain a selectable marker gene to allow the selection of transformed host cells. Selection genes are well known in the art and will vary with the host cell used.
- chimeric fHbp of the present disclosure may comprise additional elements, such as a detectable label, e.g., a radioactive label, a fluorescent label, a biotin label, an immunologically detectable label (e.g., an HA tag, a poly-Histidine tag) and the like. Additional elements of chimeric fHbp can be provided to facilitate isolation (e.g., biotin tag, immunologically detectable tag) through various methods (e.g., affinity capture, etc.). Chimeric fHbp can optionally be immobilized on a support through covalent or non-covalent attachment.
- a detectable label e.g., a radioactive label, a fluorescent label, a biotin label, an immunologically detectable label (e.g., an HA tag, a poly-Histidine tag) and the like.
- Additional elements of chimeric fHbp can be provided to facilitate isolation (e.g., biotin tag, immunologically detect
- chimeric fHbp can be isolated from a lysate of cells genetically modified to express a chimeric fHbp, or from a synthetic reaction mix, by immunoaffinity purification, which generally involves contacting the sample with an anti-chimeric fHbp antibody (e.g., an anti-chimeric fHBP mAb, such as a JAR 5 mAb or other appropriate JAR mAb described herein), washing to remove non-specifically bound material, and eluting specifically bound chimeric fHbp.
- Isolated chimeric fHbp can be further purified by dialysis and other methods normally employed in protein purification methods.
- the chimeric fHbp can be isolated using metal chelate chromatography methods.
- chimeric fHbp Any of a number of suitable host cells can be used in the production of chimeric fHbp.
- the chimeric fHbp described herein may be expressed in prokaryotes or eukaryotes, usually bacteria, more usually E. coli or Neisseria (e.g., N. meningitidis ) in accordance with conventional techniques.
- the present disclosure further provides a genetically modified host cell, which contains a nucleic acid encoding a chimeric fHBP.
- Host cells for production (including large scale production) of a chimeric fHBP can be selected from any of a variety of available host cells.
- Exemplary host cells for expression include those of a prokaryotic or eukaryotic unicellular organism, such as bacteria (e.g., Escherichia coli strains), yeast (e.g., S. cerevisiae, Pichia spp., and the like), and may include host cells originally derived from a higher organism such as insects, vertebrates, particularly mammals, (e.g. CHO, HEK, and the like). Generally bacterial host cells and yeast are of particular interest for chimeric fHBP production.
- bacteria e.g., Escherichia coli strains
- yeast e.g., S. cerevisiae, Pichia spp., and the like
- host cells originally derived from a higher organism such as insects, vertebrates, particularly mammals, (e.g. CHO, HEK, and the like).
- Generally bacterial host cells and yeast are of particular interest for chimeric fHBP production.
- Chimeric fHbps can be prepared in substantially pure or substantially isolated form (i.e., substantially free from other Neisserial or host cell polypeptides) or substantially isolated form.
- the chimeric fHbp is present in a composition that is enriched for the polypeptide relative to other components that may be present (e.g., other polypeptides or other host cell components).
- Purified chimeric fHbp can be provided such that the polypeptide is present in a composition that is substantially free of other expressed polypeptides, e.g., less than 90%, usually less than 60% and more usually less than 50% of the composition is made up of other expressed polypeptides.
- a Neisserial host cell is genetically modified to express a chimeric fHbp.
- Any of a variety of Neisseria spp. strains can be modified to produce a chimeric fHbp, and, optionally, which produce or can be modified to produce other antigens of interest, such as PorA, can be used in the methods disclosed herein.
- Strong promoters particularly constitutive strong promoters are of particular interest.
- Exemplary promoters include the promoters of porA, porB, lbpB, tbpB, p110, hpuAB, lgtF, opa, p110, 1st, hpuAB. and rmp.
- Neisserial spp. or strains derived from pathogenic Neisseria spp., particularly strains pathogenic for humans or derived from strains pathogenic or commensal for humans, are of particular interest for use in membrane vesicle production.
- Neisserial spp. include N. meningitidis, N. flavescens, N. gonorrhoeae, N. lactamica, N. polysaccharea, N. cinerea, N. mucosa, N. subflava, N. sicca, N. elongata , and the like.
- N. meningitidis strains are of particular interest for genetic modification to express a chimeric fHbp and for use in vesicle production.
- the strain used for vesicle production can be selected according to a number of different characteristics that may be desired.
- the strain may be selected according to: a desired PorA type (a “serosubtype”, as described above), capsular group, serotype, and the like; decreased capsular polysaccharide production; and the like.
- the production strain can produce any desired PorA polypeptide, and may express one or more PorA polypeptides (either naturally or due to genetic engineering).
- strains include those that produce a PorA polypeptide which confers a serosubtype of P1.7,16; P1.19,15; P1.7,1; P1.5,2; P1.22a,14; P1.14; P1.5,10; P1.7,4; P1.12,13; as well as variants of such PorA polypeptides which may or may not retain reactivity with conventional serologic reagents used in serosubtyping.
- PorA polypeptides characterized according to PorA variable region (VR) typing (see, e.g., Russell et al.
- the production strain can be a capsule deficient strain.
- Capsule deficient strains can provide vesicle-based vaccines that provide for a reduced risk of eliciting a significant autoantibody response in a subject to whom the vaccine is administered (e.g., due to production of antibodies that cross-react with sialic acid on host cell surfaces).
- “Capsule deficient” or “deficient in capsular polysaccharide” as used herein refers to a level of capsular polysaccharide on the bacterial surface that is lower than that of a naturally-occurring strain or, where the strain is genetically modified, is lower than that of a parental strain from which the capsule deficient strain is derived.
- a capsule deficient strain includes strains that are decreased in surface capsular polysaccharide production by at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90% or more, and includes strains in which capsular polysaccharide is not detectable on the bacterial surface (e.g., by whole cell ELISA using an anti-capsular polysaccharide antibody).
- Capsule deficient strains include those that are capsule deficient due to a naturally-occurring or recombinantly-generated genetic modification.
- Naturally-occurring capsule deficient strains see, e.g., Dolan-Livengood et al. J. Infect. Dis. (2003) 187(10):1616-28), as well as methods of identifying and/or generating capsule-deficient strains (see, e.g., Fisseha et al. (2005) Infect. Immun. 73(7):4070-4080; Stephens et al. (1991) Infect Immun 59(11):4097-102; Frosch et al. (1990) Mol Microbiol. 1990 4(7):1215-1218) are known in the art.
- Modification of a Neisserial host cell to provide for decreased production of capsular polysaccharide may include modification of one or more genes involved in capsule synthesis, where the modification provides for, for example, decreased levels of capsular polysaccharide relative to a parent cell prior to modification.
- Such genetic modifications can include changes in nucleotide and/or amino acid sequences in one or more capsule biosynthesis genes rendering the strain capsule deficient (e.g., due to one or more insertions, deletions, substitutions, and the like in one or more capsule biosynthesis genes).
- Capsule deficient strains can lack or be non-functional for one or more capsule genes.
- strains that are deficient in sialic acid biosynthesis are deficient in sialic acid biosynthesis.
- Such strains can provide for production of vesicles that have reduced risk of eliciting anti-sialic acid antibodies that cross-react with human sialic acid antigens, and can further provide for improved manufacturing safety.
- Strains having a defect in sialic acid biosynthesis can be defective in any of a number of different genes in the sialic acid biosynthetic pathway.
- strains that are defective in a gene product encoded by the N-acetylglucosamine-6-phosphate 2-epimerase gene known as synX AAF40537.1 or siaA AAA20475
- a capsule deficient strain is generated by disrupting production of a functional synX gene product (see, e.g., Swartley et al. (1994) J Bacteriol. 176(5):1530-4).
- Capsule-deficient strains can also be generated from naturally-occurring strains using non-recombinant techniques, e.g., by use of bactericidal anti-capsular antibodies to select for strains that reduced in capsular polysaccharide.
- the strains can be selected so as to differ in one or more strain characteristics, e.g., to provide for vesicles that differ in the chimeric fHbp used, PorA, and the like.
- the antigenic compositions contemplated by the present disclosure generally include vesicles prepared from Neisserial cells that express a chimeric fHbp.
- vesicles is meant to encompass outer membrane vesicles as well as microvesicles (which are also referred to as blebs).
- the antigenic composition can contain outer membrane vesicles (OMV) prepared from the outer membrane of a cultured strain of Neisseria meningitidis spp. genetically modified to express a chimeric fHbp.
- OMVs may be obtained from Neisseria meningitidis grown in broth or solid medium culture, preferably by separating the bacterial cells from the culture medium (e.g. by filtration or by a low-speed centrifugation that pellets the cells, or the like), lysing the cells (e.g. by addition of detergent, osmotic shock, sonication, cavitation, homogenization, or the like) and separating an outer membrane fraction from cytoplasmic molecules (e.g.
- outer membrane fractions may be used to produce OMVs.
- the antigenic composition can contain microvesicles (MV) (or “blebs”) containing chimeric fHbp, where the MV or blebs are released during culture of a Neisseria meningitidis strain genetically modified to express a chimeric fHbp.
- MVs may be obtained by culturing a strain of Neisseria meningitidis in broth culture medium, separating whole cells from the broth culture medium (e.g. by filtration, or by a low-speed centrifugation that pellets only the cells and not the smaller blebs, or the like), and then collecting the MVs that are present in the cell-free culture medium (e.g.
- Strains for use in production of MVs can generally be selected on the basis of the amount of blebs produced in culture (e.g., bacteria can be cultured in a reasonable number to provide for production of blebs suitable for isolation and administration in the methods described herein).
- An example of a strain that produces high levels of blebs is described in PCT Publication No. WO 01/34642.
- strains for use in MV production may also be selected on the basis of NspA production, where strains that produce higher levels of NspA may be of particular interest (for examples of N.
- meningitidis strains having different NspA production levels see, e.g., Moe et al. (1999 Infect. Immun. 67: 5664).
- Other strains of interest for use in production of blebs include strains having an inactivated GN33 gene, which encodes a lipoprotein required for cell separation, membrane architecture and virulence (see, e.g., Adu-Bobie et al. Infect Immun. 2004; 72:1914-1919).
- the antigenic compositions of the present disclosure can contain vesicles from one strain, or from 2, 3, 4, 5 or more strains, which strains may be homologous or heterologous, usually heterologous, to one another.
- the strains may be homologous or heterologous with respect to PorA.
- the vesicles can also be prepared from strains that express more than one chimeric fHbp (e.g., 1, 2, 3, or more chimeric fHbp) which may be composed of fHbp amino acid sequences from different variants (v.1, v.2, or v.3) or subvariants (e.g., a subvariant of v.1, v.2, or v.3).
- the antigenic compositions can contain a mixture of OMVs and MVs presenting the same or different chimeric fHbps, where the chimeric fHbps may optionally present epitopes from different combinations of fHbp variants and/or subvariants and where the OMVs and/or MVs may be from the same or different strains.
- Vesicles from different strains can be administered as a mixture, or can be administered serially.
- the antigentic composition may contain vesicles containing one or more different chimeric fHbp, in which the vesicles and the fHbp are both derived from the same host cells.
- the composition can also be made from vesicles and fHbp that are derived from different host cells so that the vesicles and fHbp are admixed after their separate purification.
- the vesicles are optionally treated to reduce endotoxin, e.g., to reduce toxicity following administration.
- reduction of endotoxin can be accomplished by extraction with a suitable detergent (for example, BRIJ-96, sodium deoxycholate, sodium lauroylsarcosinate, Empigen BB, Triton X-100, TWEEN 20 (sorbitan monolaurate polyoxyethylene), TWEEN 80, at a concentration of 0.1-10%, preferably 0.5-2%, and SDS).
- a suitable detergent for example, BRIJ-96, sodium deoxycholate, sodium lauroylsarcosinate, Empigen BB, Triton X-100, TWEEN 20 (sorbitan monolaurate polyoxyethylene), TWEEN 80, at a concentration of 0.1-10%, preferably 0.5-2%, and SDS.
- a detergent other than deoxycholate it is preferable to use a detergent other than deoxycholate.
- the vesicles of the antigenic compositions can be prepared without detergent, e.g., without use of deoxycholate.
- detergent treatment is useful to remove endotoxin activity, it may deplete the native fHbp lipoprotein and/or chimeric fHbp (including lipidated chimeric fHbp) by extraction during vesicle production.
- it may be particularly desirable to decrease endotoxin activity using technology that does not require a detergent.
- strains that are relatively low producers of endotoxin lipopolysaccharide, LPS
- the vesicles can be prepared from Neisseria mutants in which lipooligosaccharide or other antigens that may be undesirable in a vaccine (e.g. Rmp) is reduced or eliminated.
- Vesicles can be prepared from N. meningitidis strains that contain genetic modifications that result in decreased or no detectable toxic activity of lipid A.
- such strain can be genetically modified in lipid A biosynthesis (Steeghs et al. Infect Immun 1999; 67:4988-93; van der Ley et al. Infect Immun 2001; 69:5981-90; Steeghs et al. J Endotoxin Res 2004; 10:113-9; Fissha et al, Infect Immun 73:4070, 2005).
- the immunogenic compositions may be detoxified by modification of LPS, such as downregulation and/or inactivation of the enzymes encoded by 1p ⁇ L1 or 1p ⁇ L2, respectively.
- Tetra-acylated (1p ⁇ L2 mutant) and penta acylated (1p ⁇ L1 mutant) lipid A are less toxic than the wild-type lipid A. Mutations in the lipid A 4′-kinase encoding gene (1p ⁇ K) also decrease the toxic activity of lipid A.
- vesicles e.g., MV or OMV
- N. meningitidis strains genetically modified so as to provide for decreased or no detectable functional LpxLl-encoded protein.
- Such vesicles provide for reduced toxicity as compared to N. meningitidis strains that are wild-type for LPS production, while retaining immunogenicity of chimeric fHbp.
- LPS toxic activity can also be altered by introducing mutations in genes/loci involved in polymyxin B resistance (such resistance has been correlated with addition of aminoarabinose on the 4′ phosphate of lipid A).
- genes/loci could be pmrE that encodes a UDP-glucose dehydrogenase, or a region of antimicrobial peptide-resistance genes common to many enterobacteriaciae which could be involved in aminoarabinose synthesis and transfer.
- the gene pmrF that is present in this region encodes a dolicol-phosphate manosyl transferase (Gunn J. S., Kheng, B. L., Krueger J., Kim K., Guo L., hackett M., Miller S. I. 1998. Mol. Microbiol. 27: 1171-1182).
- PhoP-PhoQ regulatory system which is a phospho-relay two component regulatory system (e.g., PhoP constitutive phenotype, PhoPc), or low Mg++ environmental or culture conditions (that activate the PhoP-PhoQ regulatory system) lead to the addition of aminoarabinose on the 4′-phosphate and 2-hydroxymyristate replacing myristate (hydroxylation of myristate).
- This modified lipid A displays reduced ability to stimulate E-selectin expression by human endothelial cells and TNF secretion from human monocytes.
- Polymyxin B resistant strains are also suitable for use, as such strains have been shown to have reduced LPS toxicity (see, e.g., van der Ley et al. 1994. In: Proceedings of the ninth international pathogenic Neisseria conference. The Guildhall, Winchester, England).
- synthetic peptides that mimic the binding activity of polymyxin B may be added to the antigenic compositions to reduce LPS toxic activity (see, e.g., Rustici et al. 1993, Science 259:361-365; Porro et al. Prog Clin Biol Res. 1998; 397:315-25).
- Endotoxin can also be reduced through selection of culture conditions. For example, culturing the strain in a growth medium containing 0.1 mg-100 mg of aminoarabinose per liter medium provides for reduced lipid toxicity (see, e.g., WO 02/097646).
- Antigen composition “antigenic composition” or “immunogenic composition” is used herein as a matter of convenience to refer generically to compositions comprising a chimeric fHbp as disclosed herein, which chimeric fHbp may be optionally conjugated to further enhance immunogenicity.
- Compositions useful for eliciting antibodies, particularly antibodies against Neisseria meningitidis group B (NmB), in a human are specifically contemplated by the present disclosure.
- Antigenic compositions can contain 2 or more different chimeric fHbps, where the chimeric fHbps may present epitopes from different combinations of fHbp variants and/or subvariants.
- Antigenic compositions generally comprise an immunologically effective amount of chimeric fHbp, and may further include other compatible components, as needed.
- immunologically effective amount is meant that the administration of that amount to an individual, either in a single dose, as part of a series of the same or different antigenic compositions, is effective to elicit an antibody response effective for treatment or prevention of a symptom of, or disease caused by, for example, infection by Neisseria , particularly N. meningitidis , more particularly Group B N. meningitidis .
- This amount varies depending upon the health and physical condition of the individual to be treated, age, the capacity of the individual's immune system to produce antibodies, the degree of protection desired, the formulation of the vaccine, the treating clinician's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
- Dosage regimen may be a single dose schedule or a multiple dose schedule (e.g., including booster doses) with a unit dosage form of the antigenic composition administered at different times.
- unit dosage form refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of the antigenic compositions of the present disclosure in an amount sufficient to produce the desired effect, which compositions are provided in association with a pharmaceutically acceptable excipient (e.g., pharmaceutically acceptable diluent, carrier or vehicle).
- the antigenic composition may be administered in conjunction with other immunoregulatory agents.
- Antigenic compositions can be provided in a pharmaceutically acceptable excipient, which can be a solution such as a sterile aqueous solution, often a saline solution, or they can be provided in powder form. Such excipients can be substantially inert, if desired.
- the antigenic compositions can further comprise an adjuvant.
- suitable adjuvants that can be used in humans include, but are not necessarily limited to, alum, aluminum phosphate, aluminum hydroxide, MF59 (4.3% w/v squalene, 0.5% w/v Tween 80TM, 0.5% w/v Span 85), CpG-containing nucleic acid (where the cytosine is unmethylated), QS21, MPL, 3DMPL, extracts from Aquilla, ISCOMS, LT/CT mutants, poly(D,L-lactide-co-glycolide) (PLG) microparticles, Quil A, interleukins, and the like.
- thr-MDP N-acetyl-muramyl-L-threonyl-D-isoglutamine
- CGP 11637 N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine
- nor-MDP N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dip-almitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine
- CGP 19835A referred to as MTP-PE
- RIBI which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion.
- the effectiveness of an adjuvant may be determined by measuring the amount of antibodies directed against
- adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59TM (WO 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds.
- Span 85 (optionally containing MTP-PE) formulated into submicron particles using a microfluidizer, (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RIBITM adjuvant system (RAS), (Ribi Immunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components such as monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (DetoxTM); (2) saponin adjuvants, such as QS21 or StimulonTM (Cambridge
- cytokines such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-O-deacylated MPL (3dMPL) e.g.
- MPL monophosphoryl lipid A
- 3dMPL 3-O-deacylated MPL
- WO 99/52549 (9) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol (WO 01/21207) or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (WO 01/21152); (10) a saponin and an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide) (WO 00/62800); (11) an immunostimulant and a particle of metal salt e.g. WO 00/23105; (12) a saponin and an oil-in-water emulsion e.g.
- WO 99/11241 (13) a saponin (e.g. QS21)+3dMPL+IM2 (optionally+a sterol) e.g. WO 98/57659; (14) other substances that act as immunostimulating agents to enhance the efficacy of the composition.
- Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-25 acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutarninyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc.
- Adjuvants suitable for administration to a human are of particular interest.
- the antigen compositions may comprise other components, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like.
- the compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
- the concentration of chimeric fHbp in a formulation can vary widely (e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight) and will usually be selected primarily based on fluid volumes, viscosities, and patient-based factors in accordance with the particular mode of administration selected and the patient's needs.
- Chimeric fHBP-containing formulations can be provided in the form of a solution, suspension, tablet, pill, capsule, powder, gel, cream, lotion, ointment, aerosol or the like. It is recognized that oral administration can require protection of the compositions from digestion. This is typically accomplished either by association of the composition with an agent that renders it resistant to acidic and enzymatic hydrolysis or by packaging the composition in an appropriately resistant carrier. Means of protecting from digestion are well known in the art.
- Chimeric fHbp-containing formulations can also be provided so as to enhance serum half-life of chimeric fHBP following administration.
- the chimeric fHbp may be provided in a liposome formulation, prepared as a colloid, or other conventional techniques for extending serum half-life.
- a variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728 and 4,837,028.
- the preparations may also be provided in controlled release or slow-release forms.
- the chimeric fHbp-containing antigenic compositions are generally administered to a human subject that is at risk of acquiring a Neisserial disease so as to prevent or at least partially arrest the development of disease and its complications.
- An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for therapeutic use will depend on, e.g., the antigenic composition, the manner of administration, the weight and general state of health of the patient, and the judgment of the prescribing physician.
- Single or multiple doses of the antigenic compositions may be administered depending on the dosage and frequency required and tolerated by the patient, and route of administration.
- the chimeric fHbp-containing antigenic compositions are generally administered in an amount effective to elicit an immune response, particularly a humoral immune response, in the host.
- amounts for immunization will vary, and can generally range from about 1 Vag to 100 ⁇ g per 70 kg patient, usually 5 ⁇ g to 50 ag/70 kg.
- Substantially higher dosages e.g. 10 mg to 100 mg or more
- the initial administration can be followed by booster immunization of the same of different chimeric fHbp-containing antigenic composition.
- vaccination involves at least one booster, more usually two boosters.
- immunization can be accomplished by administration by any suitable route, including administration of the composition orally, nasally, nasopharyngeally, parenterally, enterically, gastrically, topically, transdermally, subcutaneously, intramuscularly, in tablet, solid, powdered, liquid, aerosol form, locally or systemically, with or without added excipients.
- parenterally administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980).
- An anti-chimeric fHbp immune response can be assessed by known methods (e.g. by obtaining serum from the individual before and after the initial immunization, and demonstrating a change in the individual's immune status, for example an immunoprecipitation assay, or an ELISA, or a bactericidal assay, or a Western blot, or flow cytometric assay, or the like).
- known methods e.g. by obtaining serum from the individual before and after the initial immunization, and demonstrating a change in the individual's immune status, for example an immunoprecipitation assay, or an ELISA, or a bactericidal assay, or a Western blot, or flow cytometric assay, or the like).
- the antigenic compositions can be administered to a human subject that is immunologically naive with respect to Neisseria meningitidis .
- the subject is a human child about five years or younger, and preferably about two years old or younger, and the antigenic compositions are administered at any one or more of the following times: two weeks, one month, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 months, or one year or 15, 18, or 21 months after birth, or at 2, 3, 4, or 5 years of age.
- Hybridomas producing the JAR 4, JAR 5, JAR 11, and JAR 32 monoclonal antibodies were deposited under the terms of the Budapest Treaty with the American Type Culture Collection, 10801 University Boulevard., Manassas, Va. 20110-2209, USA (ATCC) on the date indicated in the table below, and were assigned the designations set out in the table below.
- JAR 5 mAb specifically binds to an epitope that at least overlaps with the epitope specifically bound by JAR 3 mAb
- JAR 32 mAb specifically binds to an epitope that at least overlaps with the epitope specifically bounds by JAR 35 mAb.
- the fHbp gene was amplified from genomic DNA prepared with the DNeasy Tissue kit (Qiagen, Valencia, Calif.) by polymerase chain reaction using primers A1 and B2 and cycling parameters described previously (Masignani et al. J Exp Med 2003, 197:789-99).
- the PCR products were purified using QiaQuick PCR purification kit (Qiagen) and were eluted in 30 ⁇ l of sterile deionized H 2 O.
- the fHbp DNA sequences were determined by a commercial sequencing facility using the primers A1 and 22 described previously (Masignani et al., 2003).
- Protein sequences analyzed in the first study were encoded by 69 fHbp genes from Neisseria meningitidis case isolates from the United States (Beernink et al. J Infect Dis 2007, 195:1472-9), Europe (Beernink and Granoff Infect Immun 2008, 76:2568-2575; Beernink et al. Infect Immun 2008, 76:4232-4240) and Africa (Beernink et al., J Infect Dis 2009, doi: 10.1086/597806). This data set included 48 sequences determined as part of our previous studies and 21 new sequences performed for the present study.
- fHbp gene sequences were obtained from Genbank (www.ncbi.nlm.nih.gov) by performing translated BLAST (tblastn) searches with fHbp amino acid sequences from strains MC58 (variant 1/sub-family B) and M1239 (variant 3/sub-family A).
- Genbank www.ncbi.nlm.nih.gov
- BLAST tblastn
- the protein identification (ID) numbers from the peptide database at the Neisseria.org website were employed.
- Expression plasmids were constructed by PCR amplification of fHbp genes from genomic DNA as described previously (Masignani et al. (2003) J Exp Med 197:789-99). The genes encoded fHbp ID 1 (Modular group I), 28 (group II), 22 (group III), 15 (group IV), 79 (group V) and 77 (group VI). C-terminal hexahistidine-tagged recombinant fHbps were expressed in Escherichia coli BL21(DE3) (Novagen, Madison, Wis., US), and purified as described elsewhere (Beernink P T et al. (2008) Infect Immun 76:2568-75).
- mice Groups of five-week-old CD-1 female mice (10 mice per group) were obtained from Charles River (Wilmington, Md., US). The mice were immunized via the intraperitoneal route (IP) with three doses of vaccine given at 3-week intervals. Each 100-01 dose contained 20 D g of recombinant protein mixed with Freund's adjuvant (FA) (Sigma-Aldrich, St. Louis, Mo., US). (Complete FA for the first dose and incomplete for subsequent doses). Terminal blood samples were obtained three weeks after the last dose. The animal procedures were performed under a protocol approved by the Institutional Animal Care and Use Committee of the Children's Hospital Oakland Research Institute.
- FA Freund's adjuvant
- the bactericidal assay was performed as described elsewhere, using early log phase bacteria grown for approximately 2 h in Mueller-Hinton broth (BD Biosciences, Franklin Lakes, N.J., US) supplemented with 0.25% glucose (w/v) and 0.02 mM cytidine 5′-monophospho-N-acetylneuraminic acid (Sigma-Aldrich, St, Louis, Mo., US) [11].
- the complement source was serum from a non-immune healthy adult with normal hemolytic complement activity.
- the serum was passed over a protein G Sepharose column (HiTrap Protein G HP, GE Healthcare, Piscataway, N.J., US) to remove IgG antibodies (Beernink P T et al. (2009) J Infect Dis 199:1360-8).
- N. meningitidis cells were grown in broth cultures to early log phase, heat-killed (56° C. for 1 h), collected by centrifugation, and resuspended in PBS to an optical density of 0.6. Proteins in the heat-killed cells (1-4 ⁇ 10 7 CFU) were separated by SDS-PAGE using 4-12% NuPAGE gels (Invitrogen, Carlsbad, Calif., US) as specified by the manufacturer, and were transferred to PVDF membranes (Immobilon-FL; Millipore, Billerica, Mass., US) using a Western blot module (Invitrogen, Carlsbad Calif., US). After blocking overnight at 4° C.
- the membranes were scanned at 800 nm wavelength using an infrared scanner (Li-Cor Odyssey, Lincoln, Nebr., US), and the integrated intensities of the bands were calculated with software provided by the manufacturer (version 3.0.21).
- the results of testing purified, recombinant fHbp from each of the six modular groups indicated that the IR signal intensities were proportional to the log 10 of the quantities loaded in the range of 0.03 to 2 ⁇ g (representative data for control proteins in modular groups I and VI are shown in FIG. 11 ).
- Representative expression data are shown for two strains with fHbp in modular group I, and two strains in modular group VI ( FIG. 11 ).
- fHbp was classified into two sub-families (Fletcher et al. Infect Immun 2004, 72:2088-2100) or three variant groups (Masignani et al., 2003) ( FIG. 3 ).
- the amino acid sequences of two N As described in the Examples section below and shown in FIG. 4 , the amino acid sequences of two N.
- gonorrhoeae orthologs had architectures corresponding to natural chimeras in modular group V ( FIG. 8 ).
- the propensity for Neisseria to transfer genes horizontally (Hotopp et al. Microbiology 2006, 152:3733-3749), coupled with the similar modular architectures of meningococcal and gonococcal fHbp peptides described here, suggests that during evolution, the respective progenitor genes recombined at conserved sequences encoding the invariant blocks of residues hypothesized to be points of junction.
- FIG. 8 Among the 69 distinct meningococcal fHbp peptides, 65 (94%) could be assigned to one of six modular groups ( FIG. 8 ). Nearly 60% of the peptides were in modular groups I or II, which comprised only ⁇ or ⁇ type segments, respectively. The remaining peptides were natural chimeras of ⁇ and ⁇ segments. Modular fHbp groups, III, IV, and V ( FIG. 8 ), could each have been generated from the two progenitor types by a single recombination event. The modular fHbp group VI could have been generated by two recombination events.
- fHbp structural data are available from two recent NMR studies (Cantini et al., J Biol Chem 2009, doi:10.1074/jbc.C800214200; Mascioni et al. J Biol Chem 2009, doi:10.1074/jbc.M808831200) and a crystallographic study of fHbp in a complex with a complement regulatory protein (Cantini et al., 2009; Mascioni et al., 2009; Schneider et al. Nature 2009, doi: 10.1038/nature07769).
- All three fHbp variable segments with fH contact residues also contained amino acids that affected epitopes recognized by bactericidal murine anti-fHbp mAbs ( FIG. 9 ).
- the central locations of the fH contact residues in the amino- or carboxyl-terminal domains appeared to be distinct from the peripheral locations of the residues affecting epitope expression. This reciprocal relationship suggests that the fHbp structures in contact with fH infrequently elicited bactericidal antibodies.
- fHbp as a vaccine candidate is antigenic variability (Beernink & Granoff, 2009; Masignani et al., 2003).
- serum antibodies to recombinant fHbp in the variant 1 group were bactericidal primarily only against strains with variant 1 proteins (Beernink et al. 2007; Fletcher et al. Infect Immun 2004, 72; 2088-2100; Masignani et al. 2003), while antibodies to fHbp in the variant 2 or 3 groups had activity primarily against strains with homologous variant 2 or 3 proteins but had no activity against strains with fHbp in the variant 1 group.
- variable segment A (Beernink et al. 2009b), and elicited cooperative bactericidal activity with second mAbs with epitopes on variable segment C (for example JAR 3 or 5) or variable segment E (for example, JAR 13 or mAb502).
- an ideal meningococcal vaccine should include antigenic targets other than fHbp (Giuliani et al., 2006).
- antigenic targets other than fHbp
- we engineered chimeric fHbp molecules containing the amino-terminal domain of a variant 1 fHbp with the carboxyl-terminal domain of a variant 2 protein using G136 as the junctional point (Beernink & Granoff, 2008).
- the junctional point selected for creation of the recombinant chimeric vaccines was located in an invariant portion of the middle of the variable C segment, which, in the present study, was not identified as a junctional point for any of the natural fHbp chimeric proteins described here.
- the use of natural junctional points that flank the C segment may result in improved recombinant chimeric fHbp vaccines that elicit broad bactericidal antibodies than other vaccines.
- variable segments may also be possible to introduce amino acid mutations in one or more of the variable segments to introduce epitopes from heterologous fHbp variants (Beernink & Granoff 2008; Beernink et al. 2009b).
- fH-binding epitopes in the chimeric fHbp polypeptides can provide for production of antibodies that can facilitate protection against N. meningitidis.
- the analysis herein shows that the overall architecture of fHbp can be defined by a limited number of specific modular combinations of variable segments flanked by invariant sequences.
- the data suggest that recombination occurred between N. meningitidis and N. gonorrhoeae progenitor sequences to generate an antigenically diverse family of meningococcal factor H-binding proteins.
- the data presented in the Examples thus provide insights into the evolution of fHbp variants, and provide a rational basis for classification of groups of peptide variants.
- 69 unique fHbp amino acid sequences were aligned to generate a phylogram shown in FIG. 3 .
- the peptide identification number assigned in fHbp peptide database at neisseria.org is shown and, if known, the multi-locus sequence type (MLST) clonal complex is shown in parentheses.
- the lower left branch shows variant group 1 as defined by Masignani et al 2003 (sub-family B of Fletcher et al 2004); sub-family A contained two branches, variant groups 2 and 3.
- Prototype peptides for each of the variant groups 1, 2 and 3 are indicated with arrows and labeled with the name of the source strain of the respective genes.
- the phylogram was constructed by multiple sequence alignment as described in Methods. The scale bar shown at the bottom indicates 5 amino acid changes per 100 residues.
- Sub-family A contained fHbp sequences in antigenic variant groups 2 and 3, and sub-family B corresponded to fHbps in the antigenic variant group 1 (Masignani et al. 2003).
- strains with fHbp in each of the variant groups for example, for ST-11, peptides 2, 3, 6, 9, 10, 11 and 78 in the variant 1 group, peptides 17, 22, 23 and 27 in the variant 2 group and peptide 59 in the variant 3 group).
- the strains from the ST-32 clonal complex had fHbp in two of the variant groups (peptides 1 and 89 in the variant 1 group and peptide 76 in the variant 3 group) and the ST-8 clonal complex had fHbp only in one variant group (peptides 16, 50, and 77 in the variant 2 group).
- the distribution of fHbp variants in all of the observed clonal complexes is given in Table 2 below. Peptide IDs listed are assigned by the fHbp peptide database at neisseria.org.
- Blocks of two to five invariant residues were identified that separate the proteins into segments of variable residues. See FIG. 4 for detail.
- the invariant residues are shown as vertical rectangles.
- the top three panels show representative architectures of three N. meningitidis fHbp variants in groups 1, 2 and 3 (peptide ids, 1, 16 and 28, respectively).
- Each of the three variants had repetitive amino-terminal elements (N-term), and variable segments A through E, which in some cases differed in length among the variants.
- the amino acid positions of the last residue in each variable segment are shown.
- the blocks of invariant residues appeared to represent natural junctional points for recombination of the respective genes encoding the meningococcal and gonococcal proteins.
- the phylogeny of each the variable segments defined by these junctional points was analyzed.
- the numbering of the amino acid residues is based on the mature fHbp peptide 1 encoded by a gene from MC58 in the variant 1 group (Masignani et al. 2003).
- the numbering for the respective variant 2 and 3 proteins differ from that of the variant 1 protein by ⁇ 1 and +7, respectively ( FIG. 4 ).
- the mature fHbp began with a cysteine residue that is lipidated by signal peptidase II, which was followed by three invariant amino acid residues, SSG.
- This invariant sequence was followed by a repetitive variable sequence consisting of 1 to 6 glycine and/or serine residues and then by two invariant glycine residues ( FIG. 4 ).
- the variable portion of the amino-terminal element consisted of a single glycine residue for 34 of the 69 peptides (nearly all in the variant 1 group, Table 3 shown below), or GG residues for 12 of the peptides (all in the variant 2 group).
- the other common variable sequence was GGGSGG (8 in the variant 1 group and 7 in the variant 3 group).
- variable segments There were five variable segments, which we designated A, B, C, D or E ( FIG. 4 ). Based on the presence of certain signature amino acid residues and sequence similarity (Table 4), each of the five segments could be segregated into one of two types. One of the types had signature amino acid residues and sequence similarity to peptides in the antigenic variant 1 group. The other type had signature amino acid residues and sequence similarity to peptides in the antigenic variant 3 group, which also were similar to those of the gonococcal ortholog (see FIG. 4 ). Also see Table 4 presented below.
- the first group of segments is designated as a types and the second group as 0 types.
- the amino acid identity of the respective segments within an ⁇ or ⁇ type ranges from 80 to 100% (Table 4).
- the identity of segments between types ranged from 69-78% for segment A, which was located in a conserved region of the N-terminal portion of the molecule, to 32-45% in the C segment, which encompassed resides 98-159 in a much less conserved region of the protein (Table 4).
- distinct sequence variants were assigned a unique identifier beginning with a letter, A through E, to represent the variable segment; followed by an ⁇ or ⁇ to indicate the presence of residues with the respective types described above, followed by a number for each distinct sequence (listed in FIG. 2A-2E (Table 8)).
- Segment A began at amino acid residue 8 immediately after the invariant GG sequence and extended to position 73 (Table 4).
- segment A contained 16 distinctive ⁇ sequence variants, and 9 distinctive ⁇ sequence variants ( FIG. 5 ).
- the number of peptides is given in parentheses.
- the scale bar indicates 5 amino acid changes per 100 residues.
- the most common ⁇ variant was designated A. ⁇ .1, which was present in 6 peptides, all in the variant 3 group.
- Segment B began at position 79 immediately after an invariant SRFDF sequence and extended to position 93 (Table 4). Among the 69 fHbp peptides, segment B contained 7 different ⁇ variant sequences and a single ⁇ sequence ( FIG. 5 ). The phylogenic analysis showed that the B segments of fHbp peptides in the variant 1 and 2 groups clustered together ( FIG. 5 ), which were distinct from those in the variant ⁇ group. The most common B segment, B. ⁇ .1, was present in 40 fHbp peptides (28 in the variant 1 group and 12 in the variant 2 group).
- the respective C (residues 98-159) and E (residues 186-253) segments of fHbp in the variant 2 and 3 groups clustered together and were separated from those of fHbps in the variant 1 group 1 ( FIG. 6 ).
- All of the D segments (residues 162-180) of strains with fHbp in the variant group 1 were ⁇ types while those of fHbp peptides in the variant 2 or 3 groups were ⁇ or ⁇ ( FIG. 7 ).
- the most common D segment, D. ⁇ .1 (N 39), was present in 21 fHbp v.1 peptides, 9 v.2 peptides and 9 v.3 peptides.
- a representative peptide in each modular group is indicated by the peptide identification number from the fHbp database at neisseria.org.
- the number of unique sequences observed within each fHbp modular group is indicated at the right. This analysis excluded four peptides sequences with exceptional junctional points at one of their segments.
- amino-terminal repetitive segment described above was not used to define the modular fHbp groups, the majority (88 to 100%) of modular group I, III and VI peptides sequences had amino-terminal repetitive elements of 1 or 2 glycine residues (Table 3). In contrast, the majority (75 to 100%) of the peptides in modular groups II, IV and V had amino-terminal elements of 3 to 6 glycine and serine residues. The length of this amino-terminal element may affect the distance of the protein from the bacterial membrane and surface-accessibility of certain epitopes.
- FIG. 4 shows the fHbp variant groups as described by Masignani et al. (2003) J Exp Med 1997:789-99 for each of the modular groups. The variant groups were assigned based on the relatedness of the overall amino acid sequences of the respective proteins.
- fHbp sequences had modular structures similar to those described above except that one of the junctional points between two of the segments utilized alternative invariant sequences.
- fHbp peptide 55 was similar to peptides in modular group IV ( FIG. 8 ) except that the A segment switched from a ⁇ type sequence to an ⁇ type sequence at an invariant AQGAE starting at residue 50 rather than at SRFDF starting at residue 74.
- This A segment was designated A. ⁇ .9 ( ⁇ because of its higher sequence identity to other ⁇ type A segments than to the ⁇ type A segments; FIG. 5 ).
- Two other fHbp peptides, 24 and 25 ( FIG. 2A-2E (Table 8)), had modular structures similar to peptides in modular group III ( FIG.
- variable and invariant segments of fHbp were mapped onto a molecular model based on the published coordinates from the fHbp crystal structure ( FIG. 9 ) (Schneider et al. 2009).
- the amino- and carboxyl-termini, labeled N and C, respectively, in panel A are in identical positions in panels B and C.
- the figure was constructed with PyMol (pymol.org).
- the models in the center of panels A, B and C have been rotated 180 degrees on the Y-axis from the corresponding models on the far left, while the models on the far right have been rotated 90 degrees on the X-axis as compared with the models in the middle.
- the ribbon models in panel A show the two previously described major domains of fHbp (Cantini et al. 2009; Mascioni et al. 2009; Schneider et al. 2009), each containing independently folded beta-structures, which are connected together by a structured, four amino acid residue linker located in variable segment C.
- the amino-terminal domain which begins at residue 8 and extends to residue 136, includes variable segments A and B and part of C (note that the first 14 residues of the mature protein are not present in the crystal structure).
- the carboxyl-terminal domain which extends from residue 141 to 255, includes the carboxyl-terminal portion of the C and the entire D and E variable segments.
- Panel B shows the corresponding space-filled models.
- the amino acid residues previously reported to be in contact with fH based on the structure of the fHbp-fH complex are depicted in black. These residues form clusters on variable segments A, C and E and are visible in the models shown in the middle and far right of panel B. Since fH is known to bind to fHbp on live bacteria (Madico et al. 2006; Schneider et la. 2006), this binding site must be surface-exposed. The invariant blocks of residues that flank each of the five variable segments, are localized on the opposite face of the protein and shown in white in panels B and C (far left model).
- the invariant residues are predicted to be located entirely on the surface of the molecule anchored to the cell wall.
- the presence of these invariant sequences on the membrane-associated surface suggests that there are structural constraints, perhaps a requirement for a partner protein, for anchoring and/or orienting fHbp on the bacterial cell membrane.
- the amino acids affecting the epitopes generally were located on the periphery of the amino- and carboxyl-terminal domains of fHbp whereas the residues in contact with fH were located in clusters in the central portions of each of the two domains.
- the epitopes of certain mAbs such as JAR 3, 5 or 13, which were previously reported to inhibit binding of fH to fHbp (Beernink et al. 2008; Beernink et al. 2009b), involved amino acids located in proximity to some of the fH contact residues. However, there was no example of overlap between the two sets of residues.
- Isolates in variant 1 group of Masignani consisted of modular groups I, IV and VII.
- Modular group I strains which have entirely ⁇ -type segments, predominated in all three countries (54 to 64 percent of all isolates).
- 23% of all isolates were modular group IV, which are natural chimeras of ⁇ - and ⁇ -type segments ( FIG. 8 ), as compared with ⁇ 1% in the two U.S. collections, and 3 percent of isolates from France (P ⁇ 0.001 by chi square). Since there was only one isolate in modular group VII (France), the frequency of this modular group is not shown in FIG. 12 .
- Isolates in variant 2 group included modular groups III and VI, which are all natural chimeras of ⁇ - and ⁇ -type segments. Modular groups III or VI were present in approximately equal proportions of isolates in the two U.S. collections, while modular group VI predominated among variant 2 isolates from the UK and France.
- Isolates with variant 3 group included modular group II (entirely 3-type segments) and modular groups V, VIII and IX, which are chimeras.
- modular group V accounted for the majority of the isolates with variant 3 fHbp, while in the two U.S. collections there were approximately equal numbers of modular group II or V proteins.
- Modular groups VIII and IX accounted for ⁇ 0.1% of the isolates. Because of the low percentages, these groups are not shown on FIG. 12 .
- FIG. 13 depicts human complement bactericidal titers of serum pools from mice immunized with recombinant fHbp vaccines representative of modular groups I-VI.
- the heights of the bars represent the respective median titers of each of the six antisera (3 to 4 pools per modular group) when tested against the specific test strain.
- the upper left panel shows the data for strain H44/76, which is a high expresser of fHbp in modular group I (relative expression is designated by +++; actual values are shown in Table 5 below).
- the median bactericidal titer of the homologous anti-fHbp modular group I antiserum was ⁇ 1:6000.
- the respective titers of the five heterologous anti-fHbp modular group antisera (white bars) against strain H44/76 were 1 to 2 log 10 lower, ranging from ⁇ 1:10 (antisera to modular group II) to ⁇ 1:200 (antisera to modular group IV).
- the corresponding median titers of the anti-modular group II and IV antisera when tested against control strains with homologous fHbp modular groups II (strain SK104 in the Variant 3 panel) or IV (NM452 in the Variant 1 panel) were >1:2000.
- these and the other heterologous antisera had high antibody activity when measured against control strains with the respective homologous fHbp modular groups.
- the resistant strain was killed by a control anti-PorA mAb at a concentration of 0.15 ag/ml, which was identical to that of an anti-PorA mAb required for killing of the anti-fHbp susceptible 961-5945 strain.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Mycology (AREA)
- Zoology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Chimeric fHbps that can elicit antibodies that are bactericidal for different fHbp variant strains of N. meningitidis, and methods of use, are provided.
Description
- This application claims priority to U.S. Provisional Application No. 61/174,424 filed Apr. 30, 2009, which is incorporated herein by reference in its entirety and for all purposes.
- This invention was made with government support under Public Health Service grant nos. R01 AI46464 and C06 RR16226. The government has certain rights in this invention.
- This invention relates to vaccines for diseases caused by Neisseria meningitidis.
- Neisseria meningitidis is a Gram-negative bacterium which colonizes the human upper respiratory tract and is responsible for worldwide sporadic and cyclical epidemic outbreaks of, most notably, meningitis and sepsis. The attack and morbidity rates are highest in children under 2 years of age. Like other Gram-negative bacteria, Neisseria meningitidis typically possess a cytoplasmic membrane, a peptidoglycan layer, an outer membrane which together with the capsular polysaccharide constitute the bacterial wall, and pili, which project into the outside environment. Encapsulated strains of Neisseria meningitidis are a major cause of bacterial meningitis and septicemia in children and young adults. The prevalence and economic importance of invasive Neisseria meningitidis infections have driven the search for effective vaccines that can confer immunity across different strains, and particularly across genetically diverse group B strains with different serotypes or serosubtypes.
- Factor H Binding Protein (fHbp, also referred to in the art as lipoprotein 2086 (Fletcher et al, Infect Immun 2004; 72:2088-2100), Genome-derived Neisserial antigen (GNA) 1870 (Masignani et al. J Exp Med 2003; 197:789-99) or “741”) is an N. meningitidis protein which is expressed in the bacterium as a surface-exposed lipoprotein. An important function of fHbp is to bind human complement fH, which down-regulates complement activation. Binding of fH to the bacterial surface is an important mechanism by which the pathogen survives in non-immune human serum or blood and evades innate host defenses.
- From analysis of 71 N. meningitidis strains in the first study, and more than 200 strains in the second study, representative of its genetic and geographic diversity, N. meningitidis strains have been sub-divided into three fHbp variant groups (referred to as variant 1 (v.1), variant 2 (v.2), and variant 3 (v.3)) based on amino acid sequence variability and immunologic cross-reactivity (Masignani et al. J Exp Med 2003; 197:789-99). Other workers (Fletcher et al, 2004) have subdivided the protein into two sub-families designated A (which includes v.2 and v.3 of Masignani) and B (v.1).
Variant 1 strains account for about 60% of disease-producing group B isolates (Masignani et al. 2003, supra). Within each variant group, there is on the order of about 92% or greater conservation of amino acid sequence. Specifically, conservation within each variant group ranges between 89 and 100%, while between the variant groups (e.g., between v.1 and v.2) the conservation can be as low as 59%. The protein is expressed by all known strains of N. meningitidis. - There remains a need for a single fHbp polypeptide that can elicit bactericidal antibody responses that are effective against a broad spectrum of strains expressing different fHbp variants.
- Chimeric fHbps that can elicit antibodies that are bactericidal for different fHbp variant strains of N. meningitidis, and methods of use, are provided.
-
FIG. 1A-1G is Table 7 that lists the source strains and characteristics of about 69 unique factor H binding proteins. -
FIG. 2A-2E is Table 8 that lists unique sequences in fHbp variable segment A through E and number of unique peptides from each variant group containing the segment ID. Segment ID is an identifier for each variable segment. Distinct sequence variants were assigned a unique identifier beginning with a letter, A through E, to represent the segment; followed by an α or β to indicate homology of the segment with either the corresponding fHbp segment from peptide ID 1 (fHbp v.1) or peptide ID 28 (fHbp v.3), respectively, followed by a number for each distinct sequence. Numbers invariant groups -
FIG. 3 is a phylogram of fHbp based on 69 unique amino acid sequences. -
FIG. 4 , panel A is a schematic representation of fHbp showing positions of linkers, which are also referred herein as invariant segment (I), shown as vertical rectangles, together with variable segments (V). Panel B is a table listing the amino acid sequence for each invariant segment. -
FIG. 5 is a phylogram of unique fHbp amino acid sequences in variable segments A (residues 8-73) (panel A) and B (residues 79-93) (panel B). -
FIG. 6 is a phylogram of unique fHbp amino acid sequences in variable segments C (residues 98-159) (panel A) and D (residues 162-180) (panel B). -
FIG. 7 is a phylogram of unique fHbp amino acid sequences in variable segment E (residues 186-253). -
FIG. 8 , panel A is a schematic representation of 9 fHbp modular architectures deduced from phylogenic analysis, including the more common 6 modular group types. Gray segments represent α progenitor sequences homologous topeptide ID 1 while white segments represent β progenitor sequences homologous topeptide 28. About 94% of the unique fHbp amino acid sequences analyzed herein belong to one of the first six modular group types (I, II, III, IV, V, and VI). Panel B, Four of the analyzed fHbps are classified as one of three modular architectures shown. The architectures contain junction points within a variable segment, designated by arrows. Panel C is a table listing the amino acid residues at which an α progenitor sequence switches to a β or vice versa (J1, J2, and J3) within a variable segment. -
FIG. 9 presents structural models of factor H binding protein based on the coordinates of fHbp in a complex with a fragment of human factor H (Schneider et al. (2009) Nature 458:890-3). Left models in each of the following panels show fHbps facing membrane side; center models are facing exposed side; and the right models depict membrane side of the fHbp down. Panel A, Cartoon representation depicting the two structural domains. B, Space-filling model with factor H-binding residues depicted in black and the amino acid residues of the invariant segments in white. C, Space-filling model with the amino acid residues of the invariant segments depicted in white as in panel B, and the residues affecting the epitopes of anti-fHbp mAbs shown in black. -
FIG. 10A-10I is Table 9 that lists certain characteristics of unique factor H binding protein variants use in an analysis that include 275 peptide IDs. Sequence identifiers for N-terminal variable sequences are as follows: GGGS (SEQ ID NO: 7), SGSGG (SEQ ID NO: 8), GGGSGG (SEQ ID NO:9), GGGSGS (SEQ ID NO:10), GSGG (SEQ ID NO:11), GGGSGGGG (SEQ ID NO:12), GGGSGGGSGG (SEQ ID NO:13), and GGSGG (SEQ ID NO:14). -
FIG. 11 shows fHbp expression measured by immunoblotting with infrared detection. Panels A and C, Recombinant proteins in modular groups I (ID 1) or VI (ID 77), or heat-killed bacterial cells from strains expressing fHbp in the corresponding modular groups. The modular group I proteins were detected with murineanti-fHbp mAb JAR 5, which recognizes nearly all fHbps in modular groups I and IV. The modular group VI proteins were detected withanti-fHbp mAb JAR 31, which recognizes nearly all proteins in modular groups II, III, V and VI (See Table 6 in example section). Panels B and D, Standard curves from the corresponding binding of the recombinant proteins shown in Panels A and C. -
FIG. 12 shows the frequencies of fHbp modular groups among systematically collected N. meningitidis group B case isolates. Data are from sequences of isolates collected in the United States (N=432), United Kingdom (N=536) and France (N=244) reported by Murphy et al [16], and newly obtained sequences of 143 additional U.S. isolates from California (2003-2004), Maryland (1995 and 2005), and pediatric hospitals in 9 states (2001-2005). -
FIG. 13 shows serum bactericidal activities of serum pools from mice immunized with fHbps from modular groups I to VI. The black bars represent the median titers of 3 to 4 serum pools for each modular group tested against homologous test strains. The white bars represent the median titer of the respective heterologous serum pools against the test strain. +, refers to relative expression of fHbp by each of the strains; strains with +/− representing low fHbp-expressing strains (see values in Table 5 in example section) - Before the present invention and specific exemplary embodiments of the invention are described, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
- Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the invention. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges is also encompassed within the invention, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either both of those included limits are also included in the invention.
- Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, the preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited.
- It must be noted that as used herein and in the appended claims, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “an antigen” includes a plurality of such antigens and reference to “the protein” includes reference to one or more proteins, and so forth.
- The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention. Further, the dates of publication provided may be different from the actual publication dates which may need to be independently confirmed.
- The present disclosure provides chimeric fHbps that can elicit antibodies that are bactericidal for different fHBP variant strains of N. meningitidis, and methods of use.
- “Factor H Binding Protein” (fHbp), which is also known in the literature as GNA1870, GNA 1870, ORF2086, LP2086 (lipoprotein 2086), and “741” refers to a polypeptide of N. meningitidis that is a lipoprotein presented on the surface of the bacterium. N. meningitidis strains have been sub-divided into three fHbp variant groups (referred to as variant 1 (v.1), variant 2 (v.2), and variant 3 (v.3) in some reports (Masignani et al. 2003, supra) and Family A and B in other reports (see, e.g., Fletcher et al. 2004 Infect Immun 2088-2100)) based on amino acid sequence variability and immunologic cross-reactivity (Masignani et al.
J Exp Med 2003; 197:789-99). Each unique fHbp found in N. meningitidis is also assigned a peptide ID according to neisseria.org, as shown inFIGS. 1A-1G (Table 7) andFIGS. 10A-10I (Table 9). For clarity, the present disclosure uses the v.1, v.2 and v.3 terminology. Because the length of variant 2 (v.2) fHbp protein (fromstrain 8047, peptide ID 77) and variant 3 (v.3) fHBP (from strain M1239, peptide ID 28) differ by −1 and +7 amino acid residues, respectively, from that of MC58 (peptide ID 1), the numbering used to refer to residues for v.2 and v.3 fHbp proteins differs from numbering based on the actual amino acid sequences of these proteins. Thus, for example, reference to a leucine residue (L) atposition 166 of the v.2 or v.3 fHBP sequence refers to the residue atposition 165 of the v.2 protein and atposition 173 in the v.3 protein. - The term “heterologous” or “chimeric” refers to two components that are defined by structures derived from different sources. For example, where “heterologous” is used in the context of a chimeric polypeptide, the chimeric polypeptide includes operably linked amino acid sequences that can be derived from different polypeptides of different phylogenic groupings (e.g., a first component from an α and a second component from a β progenitor amino acid sequences). Similarly, “heterologous” in the context of a polynucleotide encoding a chimeric polypeptide includes operably linked nucleic acid sequence that can be derived from different genes (e.g., a first component from a nucleic acid encoding a fHbp v.1 polypeptide and a second component from a nucleic acid encoding a fHbp v.2 polypeptide). Such chimeric polypeptides as described herein provide for presentation of epitopes in a single polypeptide that are normally found in different polypeptides. Other exemplary “heterologous” nucleic acids include expression constructs in which a nucleic acid comprising a coding sequence is operably linked to a regulatory element (e.g., a promoter) that is from a genetic origin different from that of the coding sequence (e.g., to provide for expression in a host cell of interest, which may be of different genetic origin relative to the promoter, the coding sequence or both). For example, a T7 promoter operably linked to a polynucleotide encoding an fHbp polypeptide or domain thereof is said to be a heterologous nucleic acid. “Heterologous” in the context of recombinant cells can refer to the presence of a nucleic acid (or gene product, such as a polypeptide) that is of a different genetic origin than the host cell in which it is present. For example, a Neisserial amino acid or nucleic acid sequence of one strain is heterologous to a Neisserial host of another strain.
- “Derived from” in the context of an amino acid sequence or polynucleotide sequence (e.g., an amino acid sequence “derived from” a v.1 fHbp) is meant to indicate that the polypeptide or nucleic acid has a sequence that is based on that of a reference polypeptide or nucleic acid (e.g., a naturally occurring fHbp protein or encoding nucleic acid), and is not meant to be limiting as to the source or method in which the protein or nucleic acid is made. “Derived from” in the context of bacterial strains is meant to indicate that a strain was obtained through passage in vivo, or in in vitro culture, of a parental strain and/or is a recombinant cell obtained by modification of a parental strain.
- “Conservative amino acid substitution” refers to a substitution of one amino acid residue for another sharing chemical and physical properties of the amino acid side chain (e.g., charge, size, hydrophobicity/hydrophilicity). “Conservative substitutions” are intended to include substitution within the following groups of amino acid residues: gly, ala; val, ile, leu; asp, glu; asn, gln; ser, thr; lys, arg; and phe, tyr. Conservative amino acid substitutions in the context of a chimeric fHBP disclosed herein are selected so as to preserve presentation of an epitope of interest. Guidance for such substitutions can be drawn from alignments of amino acid sequences of polypeptides presenting the epitope of interest.
- The term “protective immunity” means that a vaccine or immunization schedule that is administered to a mammal induces an immune response that prevents, retards the development of, or reduces the severity of a disease that is caused by Neisseria meningitidis, or diminishes or altogether eliminates the symptoms of the disease. Protective immunity can be accompanied by production of bactericidal antibodies. It should be noted that production of bactericidal antibodies against Neisseria meningitidis is accepted in the field as predictive of a vaccine's protective effect in humans. (Goldschneider et al., 1969, J. Exp. Med. 129:1307; Borrow et al. 2001 Infect Immun. 69:1568).
- The phrase “a disease caused by a strain of capsular group B of Neisseria meningitidis” encompasses any clinical symptom or combination of clinical symptoms that are present in an infection of a human with a member of capsular group B of Neisseria meningitidis. These symptoms include but are not limited to: colonization of the upper respiratory tract (e.g. mucosa of the nasopharynx and tonsils) by a pathogenic strain of capsular group B of Neisseria meningitidis, penetration of the bacteria into the mucosa and the submucosal vascular bed, septicemia, septic shock, inflammation, haemmorrhagic skin lesions, activation of fibrinolysis and of blood coagulation, organ dysfunction such as kidney, lung, and cardiac failure, adrenal hemorrhaging and muscular infarction, capillary leakage, edema, peripheral limb ischaemia, respiratory distress syndrome, pericarditis and meningitis.
- The phrase “broad spectrum protective immunity” means that a vaccine or immunization schedule elicits “protective immunity” against at least more than one strain (and can be against at least two, at least three, at least four, at least five, against at least eight, or more strains) of Neisseria meningitidis, wherein each of the strains expresses a different fHbp subvariant or fHbp variant. The present disclosure specifically contemplates and encompasses a vaccine or vaccination regimen that confers protection against a disease caused by a member of any capsular group (e.g., A, B, or C), with protection against disease caused by a capsular group B strain of Neisseria meningitidis being of interest due to the epidemiological prevalence of strains causing disease with this capsular group and lack of broadly effective group B vaccines.
- The phrase “specifically binds to an antibody” or “specifically immunoreactive with”, in the context of an antigen (e.g., a polypeptide antigen) refers to a binding reaction which is based on and/or is probative of the presence of the antigen in a sample which may also include a heterogeneous population of other molecules. Thus, under designated conditions, the specified antibody or antibodies bind(s) to a particular antigen or antigens in a sample and do not bind in a significant amount to other molecules present in the sample. “Specifically binds to an antibody” or “specifically immunoreactive with” in the context of an epitope of an antigen (e.g., an epitope of a polypeptide) refers to a binding reaction which is based on and/or is probative of the presence of the epitope in an antigen (e.g., polypeptide) which may also include a heterogeneous population of other epitopes, as well as a heterogeneous population of antigens. Thus, under designated conditions, the specified antibody or antibodies bind(s) to a particular epitope of an antigen and do not bind in a significant amount to other epitopes present in the antigen and/or in the sample.
- The phrase “in a sufficient amount to elicit an immune response” means that there is a detectable difference between an immune response indicator measured before and after administration of a particular antigen preparation. Immune response indicators include but are not limited to: antibody titer or specificity, as detected by an assay such as enzyme-linked immunoassay (ELISA), bactericidal assay, flow cytometry, immunoprecipitation, Ouchter-Lowny immunodiffusion; binding detection assays of, for example, spot, Western blot or antigen arrays; cytotoxicity assays, etc.
- A “surface antigen” is an antigen that is present in a surface structure of Neisseria meningitidis (e.g. the outer membrane, capsule, pili, etc.).
- “Isolated” refers to an entity of interest that is in an environment different from that in which the compound may naturally occur. “Isolated” is meant to include compounds that are within samples that are substantially enriched for the compound of interest and/or in which the compound of interest is partially or substantially purified.”
- “Enriched” means that a sample is non-naturally manipulated (e.g., by an experimentalist or a clinician) so that a compound of interest is present in a greater concentration (e.g., at least a three-fold greater, at least 4-fold greater, at least 8-fold greater, at least 64-fold greater, or more) than the concentration of the compound in the starting sample, such as a biological sample (e.g., a sample in which the compound naturally occurs or in which it is present after administration), or in which the compound was made (e.g., as in a bacterial polypeptide, antibody, chimeric polypeptide, and the like)
- A “knock-out” or “knockout” of a target gene refers to an alteration in the sequence of the gene that results in a decrease of function of the target gene, e.g., such that target gene expression is undetectable or insignificant, and/or the gene product is not functional or not significantly functional. For example, a “knockout” of a gene involved in LPS synthesis indicates means that function of the gene has been substantially decreased so that the expression of the gene is not detectable or only present at insignificant levels and/or a biological activity of the gene product (e.g., an enzymatic activity) is significantly reduced relative to prior to the modification or is not detectable. “Knock-outs” encompass conditional knock-outs, where alteration of the target gene can occur upon, for example, exposure to a predefined set of conditions (e.g., temperature, osmolarity, exposure to substance that promotes target gene alteration, and the like. A “knock-in” or “knockin” of a target gene refers to a genetic alteration in a host cell genome that that results in an increase in a function provided by the target gene.
- “Non-naturally occurring”, as used herein, refers to a protein (e.g. fHbp) that is not normally found in nature and is instead artificially produced and/or modified by a human. A non-naturally occurring subject fHbp can be made via chemical synthesis or recombinant methods. For example, “non-naturally occurring chimeras” refers to “man-made chimeras” and encompass fHbp with heterologous components that are not found in nature.
- fHBP and fHBP-Encoding Nucleic Acids
- Before describing further exemplary chimeric fHbps contemplated by the present disclosure, it is helpful to describe naturally-occurring fHbps.
- For convenience and clarity, the native amino acid sequence of the v.1 fHBP of the N. meningitidis strain MC58 (peptide ID 1) was arbitrarily selected as a reference sequence for all native v.1, v.2, and v.3 fHbp amino acid sequences, as well as for the chimeric fHbps described herein. Unless otherwise noted, amino acid residue positions are also referred herein with reference to
peptide ID 1. The sequence ofpeptide ID 1 is presented below: -
(SEQ ID NO: 1) CSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAA QGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYK QSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRA TYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKP DGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIG LAAKQ - Despite the diversity of variant groups and other classification schemes for the sequences listed in
FIGS. 1A-1G (Table 7) andFIGS. 10A-10I (Table 9), a first analysis of 69 unique fHbp sequences and a second analysis of all 275 peptide IDs, as described in the Examples below revealed that several different stretches of amino acid sequences within the fHbps are conserved among all the fHbps analyzed. As shown by the phylogenic studies presented in the Examples section below, these conserved amino acid sequences separate fHbp into modular segments of amino acid sequences that cluster in the phylogram to define two progenitor sequences from which each variable segment may be derived. As illustrated inFIGS. 5-7 , each of the variable segments in fHbps can be classified as being of one of the two progenitor amino acid sequences: designated for convenience, a or 3. - The nomenclature architecture used to characterize fHbp based on modular segments is illustrated in
FIG. 4 , panel A. The rectangles inFIG. 4 , panel A represent the conserved sequences (I) and the variable segments are designated as the N-terminal element, VA, VB, VC, VD, or VE segments. The amino acid sequence of the conserved sequences are listed inFIG. 4 , panel B. - As such, naturally occurring fHbps can be defined by the formula: I1-Nte-I2-VA-I3-VB-I4-VC-I5-VD-I6-VE-I7, wherein “Nte” refers to the N-terminal element, “I” refers to an “invariant” segment, and “V” refers to a variable segment of either an α or a β progenitor type.
- As disclosed below in more detail, the non-naturally occurring chimeric fHbps of the present disclosure can be constructed by various combinations of the V segments which are flanked by I segments. The invariant and variable segments which can be used in construction of such chimeric fHbps are described from N-terminus to C-terminus in more detail below. This modular classification can also be found on the Neisseria.org website (neisseria.org/perl/agdbnet/agdbnet.pl?file=nm_fhbp.xml). On the website the progenitor groups α and β as described below are referred to 1 and 2, respectively. For example, VAα2-VBα1-VCβ5-VDα5-VEα8 becomes A1.2-B1.1-C2.5-D1.5-E1.8.
- Invariant Segments
- fHbps contain amino acid sequences that are conserved among all fHbp amino acid sequences analyzed herein. The conserved sequences flank variable segments that are derived from either the α or β progenitor amino acid sequences. These conserved sequences are referred to herein as “invariant sequences” or “invariant segments”, and may serve as sites of recombination in naturally-occurring fHbps. Where these invariant segments are flanked by variable segments, the invariant segments may be referred to as “linker” sequences. While these sequences exhibit amino acid sequence identity between the fHbps disclosed herein, such amino acid sequences may still tolerate certain conservative amino acid substitutions. As such, the term “invariant segment” as used herein should not be construed to be limited to the specific amino acid sequences described herein, and may at least contain one or more conservative amino acid substitutions.
- As illustrated in
FIG. 4 , the most N-terminal invariant segment found in naturally-occurring fHbps starts atresidue 1 and is of the amino acid sequence CSSG (SEQ ID NO:2). Immediately C-terminal to the first invariant segment CSSG (I1) is a variable N-terminal element of about 1 to about 6 glycine or serine residues. The various N-terminal elements are listed inFIG. 1A-1G (Table 7) andFIGS. 10A-10I (Table 9). The second invariant segment (I2) is of the amino acid sequence GG, which is positioned C-terminal to the N-terminal element and starts atresidue peptide ID 28 ofvariant 3, I2 starts at residue 11). The next invariant segment, I3, is defined by the amino acid sequence of SRFDF (SEQ ID NO:3) and is positioned atresidue 74, C-terminal to I2 and a variable segment. I4, which is C-terminal to I3, is defined by the amino acid sequence GEFQ (SEQ ID NO:4) and is positioned atresidue 94. I5 is defined by the amino acid sequence DD and is C-terminal to I4 atresidue 159. I6, positioned C-terminal to Is, is defined by IEHLK (SEQ ID NO:5) or IEHLE (SEQ ID NO: 6) and starts atresidue 180. Lastly, I7, the most C-terminal invariant segment in naturally-occurring fHbps, starts atresidue 252 and is defined by the amino acid sequence of KQ. - The residue position listed above at which each invariant segment starts may be shifted from 1 to 8 residues depending on the length of the N-terminal element and the amino acid sequence of the variable segments. As noted above, for convenience and clarity residue numbering used in reference to non-naturally occurring chimeric fHbps throughout the present disclosure is based on the amino acid sequence numbering of the fHbp of MC58 (peptide ID 1), which is a
variant 1 strain. - Based on the sequences analyzed herein, the length of the invariant segments ranges from about 2 amino acid residues to about 5 amino acid residues.
- Variable Segments
- As noted above, variable segments (V) are flanked by linkers, also referred herein as invariant segments (I). In addition to a variable N-terminal element, there are five variable segments in an fHbp and they are designated from N-terminus to C-terminus as VA, VB, VC, VD, and VE, each flanked by the invariant segments discussed above. As mentioned previously, each of the variable segments may be classified as being of one of the two progenitor amino acid sequences: α or β. For example, VAα indicates that variable segment A is derived from an α progenitor amino acid sequence while VAβ refers to a variable segment A derived from a β progenitor amino acid sequence. In a more specific example, VAα1 denotes that the variable segment A is of the amino acid sequence set forth as Segment ID A.α.1 in
FIG. 2A (Table 8, segment A), which is one allele of the α progenitor sequences of variable segment A. As described below, the chimeric fHbp of the present disclosure contain a non-naturally occurring combination of variable segments in which each segment may be independently selected from either an α and a β progenitor type and/or a non-naturally occurring combination of any alleles of the corresponding segment shown inFIGS. 2A-2E , Table 8. - The α and β progenitor variable segments are each defined by certain signature amino acid residues. In addition, the α progenitor variable segments exhibit sequence similarity to fHbp of
variant 1 group (e.g. peptide ID 1), while the β progenitor variable segments exhibit sequence similarity to fHbp ofvariant 3 group (e.g. peptide ID 28). Signature amino acid residues of α or β progenitors for each variable segment are be discussed below. - In addition to being defined by their corresponding amino acid signature sequence, variable segments of the same progenitor type share amino acid sequence identity of at least 80%, at least 85%, at least 90%, at least 95%, and can be 100%. When amino acid sequences of the same variable segments of different progenitor types are compared, the amino acid sequence identity drops by at least 10% to 40%.
- See Table 4 in Example section below for amino acid identities within and between sequence groups by segment.
- Various alleles for each variable segment and their sequences are presented in
FIG. 2A-2E (Table 8) and are described in detail below. - The most N-terminal variable segment is referred to herein as the N-terminal element (Nte) (
FIG. 4 ). The various N-terminal elements found in the fHbps analyzed are listed inFIGS. 1A-1G (Table 7) and also inFIGS. 10A-10I (Table 9). They range in length from 1 to 6 residues of glycine or a combination of glycine and serine. - The variable segment VA starts at
residue 7, C-terminal to 12, and ends atresidue 73, N-terminal to I3. VA of an α progenitor (VA) comprises an amino acid sequence that is about 89 to 100% identical to Segment ID A.α.1 as presented inFIG. 2A (Table 8): VAADIGAGLA DALTAPLDHK DKSLQSLTLD QSVRKNEKLK LAAQGAEKTY GNGDSLN TGKLKNDKV (SEQ ID NO: 15). VAα is further characterized by signature amino acid residues QSV, bolded in sequence. Certain residues that may have alternative amino acid residues among VAα of different fHbps are underlined. - VA of a β progenitor (VAβ) comprises an amino acid sequence that is about 89 to 100% identical to Segment ID A.β.1 as set forth in
FIG. 2A (Table 8): VAADIGTGLA DALTAPLDHK DKGLKSLTLE DSIPQNGTLT LSAQGAEKTF KAGDKDNSLN TGKLKNDKI (SEQ ID NO:67). VAβ is further characterized by signature amino acid residues DSI and/or KDN, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among VAβ of different fHbps are underlined. - The variable segment VB starts at
residue 79, and ends N-terminal to where I4 is located, atresidue 93. VB of an α progenitor (VBα) comprises an amino acid sequence that is about 80% to 100% identical to Segment ID B.α.1 as set forth inFIG. 2B (Table 8): IRQIEVDGQL ITLES (SEQ ID NO:85). VBα is further characterized by signature amino acid residues IRQ, bolded in the sequence. Certain residues that have alternative or deleted amino acid residues among VBα of different fHbps are underlined. - VB of a β progenitor (VBβ) comprises an amino acid sequence that is about 100% identical to Segment ID B.β.1 as set forth in
FIG. 2B (Table 8): VQKIEVDGQT ITLAS (SEQ ID NO:95). VBβ is further characterized by signature amino acid residues VQK, bolded in the sequence. - The variable segment VC starts around
residue 98, C-terminal to I4 and ends atresidue 158, N-terminal to I5. VC of an α progenitor (VCα) comprises an amino acid sequence that is about 85 to 100% identical to Segment ID C.α.1 as presented inFIG. 2C (Table 8): VYKQSHSALT ALQTEQVQDS EHSGKMVAKR QFRIGDIAGE HTSFDKLPEG GRATYRGTAF GS (SEQ ID NO:96). VCα is further characterized by signature amino acid residues QDS, bolded in the sequence. Certain residues that have alternative or deleted amino acid residues among VCα of different fHbps are underlined. - VC of a β progenitor (VCβ) comprises an amino acid sequence that is about 93 to 100% identical to Segment ID C.β.1 as presented in
FIG. 2C (Table 8): IYKQDHSAVV ALQIEKINNP DKIDSLINQR SFLVSGLGGE HTAFNQLPG GKAEYHGKAF SS (SEQ ID NO:152). VCβ is further characterized by signature amino acid residues NNP, bolded in sequence. This signature is found in all of VCβ amino acid sequences. Certain residues that have alternative or deleted amino acid residues among VCβ of different fHbps are underlined. - The variable segment VD starts at
residue 161, C-terminal to I5 and ends atresidue 179, N-terminal to I6. VD of an α progenitor (VDα) comprises an amino acid sequence that is about 89 to 100% identical to Segment ID D.α.1 as presented inFIG. 2D (Table 8): AGGKLTYTID FAAKQGHGK (SEQ ID NO: 174). VDα is further characterized by signature amino acid residues AG or AS, of which AG is bolded in sequence. Certain residues that have alternative or deleted amino acid residues among VDα of different fHbps are underlined. - VD of a β progenitor (VDβ) comprises an amino acid sequence that is about 84 to 100% identical to Segment ID D.β.1 as presented in
FIG. 2D (Table 8): PNGRLHYSID FTKKQGYGR (SEQ ID NO: 192). VDβ is further characterized by signature amino acid residues PN, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among VDβ of different fHbps are underlined. - The variable segment VE starts around
residue 185, C-terminal to I6 and ends atresidue 253, N-terminal to I7. VE of an α progenitor (VEα) comprises an amino acid sequence that is about 86 to 100% identical to Segment ID E.α.1 as presented inFIG. 2E (Table 8): SPELNVDLAA AYIKPDEKHH AVISGSVLYN QAEKGSYSLG IFGGKAQEVA GSAEVKTVNG IRHIGLAA (SEQ ID NO:195). VEα is further characterized by signature amino acid residues SLGI, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among VEα of different fHbps are underlined. - VE of a β progenitor (VEβ) comprises an amino acid sequence that is about 94 to 100% identical to Segment ID E.β.1 as set forth in
FIG. 2E (Table 8): TPEQNVELAS AELKADEKSH AVILGDTRYG GEEKGTYHLA LFGDRAQEIA GSATVKIREK VHEIGIAG (SEQ ID NO:262). VEβ is further characterized by signature amino acid residues HLAL, bolded in sequence. Certain residues that have alternative or deleted amino acid residues among VEβ of different fHbps are underlined. - As noted above, for convenience and clarity residue numbering used in reference to non-naturally occurring chimeric fHbps throughout the present disclosure is based on the amino acid sequence numbering of the fHbp of MC58 (peptide ID 1). In addition, the residue position listed above at which each variable segment starts and ends may be shifted from 1 to 8 residues depending on the length of the N-terminal element and the amino acid sequence of the variable segments.
- fHbp Modular Groups
- Naturally occurring fHbp amino acid sequences can be described according to a modular architecture based on a combination of α or β progenitor segments flanked by invariable segments, as shown in
FIG. 1A-1G (Table 7) andFIGS. 10A-10I (Table 9). As described in the Examples below, naturally occurring fHbps exhibit particular combinations of modular segments, and can be classified accordingly into nine modular group types as shown inFIG. 8 , where gray variable segments correspond to the α progenitor sequences and white segments correspond to the β progenitor sequences. - The Type I modular group is characterized by variable segments, all of which are derived from the α progenitor amino acid sequences. FHbps classified as belonging to the Type I modular group may be represented by the following formula: I1-Nte-I2-VAα-I3-VBα-I4-VCα-I5-VDα-I6-VEα-I7. An example of a fHbp that is of the Type I modular group is
peptide ID 1 from strain MC58. As noted above, peptide ID is from the factor H-binding protein database at Neisseria.org. - The Type II modular group is characterized by variable segments, all of which are derived from the β progenitor. FHbps classified as belonging to the Type II modular group may be represented by the following formula: I1-Nte-I2-VAβ-I3-VBβ-I4-VCβ-I5-VDβ-I6-VEβ-I7. An example of a fHbp that is of the Type II modular group is
peptide ID 28 from strain M1239. Nearly 60% of the fHbps inFIG. 1A-1G (Table 7) belong in either Type I or II modular group. - Some fHbp, however, have variable segments from both α and β progenitors. One modular group defined by variable segments derived from both progenitors is Type III, in which variable segments VA and VB are derived from the α progenitor and the rest of the variable segments from the β progenitor. FHbps classified as belonging to the Type III modular group may be represented by the following formula: I1-Nte-I2-VAα-I3-VB-I4-VCβ-I3-VDβ-I6-VEβ-I7. One example of a fHbp that belongs to the Type III modular group is
peptide ID 22 from strain RM1090. - Another modular group defined by variable segments derived from both progenitors is Type IV. Type IV is a modular group that has a variable segment VA derived from the β progenitor and the rest of the variable segments from the α progenitor. FHbps classified as belonging to the Type IV modular group may be represented by the following formula: I1-Nte-I2-VAβ-I3-VBα-I4-VCα-I5-VDα-I6-VEα-I7. One example of a fHbp that belongs to the Type IV modular group is
peptide ID 15 from strain NM452. - An additional modular group is Type V, in which the variable segment VD is derived from the α progenitor and the rest of the variable segments from the β progenitor. FHbps classified as belonging to the Type V modular group may be represented by the following formula: I1-Nte-I2-VAβ-I3-VBβ-I4-VCβ-I5-VD-I6-VEβ-I7. One example of a fHbp that belongs to the Type V modular group is
peptide ID 79 from strain S3032. - Another modular group set forth in
FIG. 8 is Type VI, in which variable segments VC and VE are derived from the β progenitor and the rest of the variable segments from the α progenitor. FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I1-Nte-I2-VAα-I3-VBα-I4-VCβ-I5-VDα-I6-VEβ-I7. One example of a fHbp that belongs to the Type VI modular group ispeptide ID 16 from strain 961-5945. - Another modular group set forth in
FIG. 8 is Type VII, in which variable segment VE are derived from the β progenitor and the rest of the variable segments from the α progenitor. FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I1-Nte-I2-VAα-I3-VBα-I4-VCβ-I5-VDα-I6-VEβ-I7. One fHbp found to have the Type VI modular group ispeptide ID 207 from strain 0167/03. - Another modular group set forth in
FIG. 8 is Type VIII, in which variable segments VB is derived from the α progenitor and the rest of the variable segments from the β progenitor. FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I1-Nte-I2-VAβ-I3-VBα-I4-VCβ-I5-VDβ-I6-VEβ-I7. One fHbp found to have the Type VIII modular group ispeptide ID 67 from strain MA-5756. - The last modular group set forth in
FIG. 8 is Type IX, in which variable segments VB and VD are derived from the α progenitor and the rest of the variable segments from the β progenitor. FHbps classified as belonging to the Type VI modular group may be represented by the following formula: I1-Nte-I2-VAβ-I3-VBα-I4-VCβ-I5-VDα-I6-VEβ-I7. One Example of a fHbp that belongs to the Type IX modular group ispeptide ID 175 from strain 19498. - More than 98% of the unique fHbp amino acid sequences analyzed herein belong to one of the first six types of modular groups (I, II, III, IV, V, and VI) described above and schematically presented in
FIG. 8 . The numbers of unique fHbp that belong to each of the modular groups are also listed on the right of the schematic inFIG. 8 . - Four naturally occurring fHbps vary at least slightly from this nomenclature, and do not precisely fit into the first six modular group types set forth in
FIG. 8 , panel A. These four fHbps “switch” from one progenitor amino acid sequence to another at a residue position that is within a canonical variable segment as described above. As a result, they each contain a heterologous variable segments and their junction points deviate from junction points of the rest of the fHbps found to be at I3, I4, I5, or I6 defined above. SeeFIG. 8 , panel B for the modular architecture of these four fHbps along with the arrow pointing at the junction point for each. However, the junction points of these four naturally occurring fHbps still reside at conserved residue(s) found within the variable segment. See table inFIG. 8 , panel C. - One such fHbp is a naturally occurring fHbp derived from strain CDC-1573 (peptide ID 55), in which the junction point where VAβ switches to VAα resides in the middle of VA. The heterologous VA of
peptide ID 55 may be represented as VA(β→α), signifying that the variable segment A comprises a β progenitor amino acid sequence starting at the N-terminus and switches to an α progenitor amino acid sequence toward the C-terminus. The junction point (J1) ofpeptide ID 55 resides at a sequence of AQGAE (SEQ ID NO:278) conserved among all the VA sequences, which starts atresidue position 50. Two other fHbps, which contain junction points that are not in the residue position of I3, I4, I5, or I6, arepeptide ID 24 andpeptide ID 25, derived fromstrain M08 240117 andstrain 6275, respectively. Their junction points (J2) at which VBα switches to VBβ reside in the middle of VB (residue 82), at which there is an amino acid sequence of IEV) conserved among all VBs. The VB ofpeptide ID peptide ID 82 from strain MD1475 switches from VEα to VEβ at residue A196 (J3), which is conserved among all VE. The variable segment E ofpeptide ID 82 may be represented as VE(α→β). - As will be discussed in detail below, chimeric fHbps can be constructed using the invariant and variable segments of this modular architecture to produce amino acid sequences not found in nature.
- Nucleic Acids Encoding fHbp Segments
- fHbp polypeptides, and encoding nucleic acids, from which segments of the chimeric fHbps of the present disclosure can be derived may be from any suitable N. meningitidis strain. As is known in the art, N. meningitidis strains are divided into serologic groups (capsular groups), serotypes (PorB phenotypes) and subtypes (PorA phenotypes) on the basis of reactions with polyclonal (Frasch, C. E. and Chapman, 1973, J. Infect. Dis. 127: 149-154) or monoclonal antibodies that interact with different surface antigens. Capsular grouping traditionally has been based on immunologically detectable variations in the capsular polysaccharide but is being replaced by PCR of genes encoding specific enzymes responsible for the biosynthesis of the structurally different capsular polysaccharides. About 12 capsular groups (including A, B, C, X, Y, Z, 29-E, and W-135) are known. Strains of the capsular groups A, B, C, Y and W-135 account for nearly all meningococcal disease. Serotyping traditionally has been based on monoclonal antibody defined antigenic differences in an outer membrane protein called Porin B (PorB). Antibodies defining about 21 serotypes are currently known (Sacchi et al., 1998, Clin. Diag. Lab. Immunol. 5:348). Serosubtyping has been based on antibody defined antigenic variations on an outer membrane protein called Porin A (PorA). Both serotyping and serosubtyping are being replaced by PCR and/or DNA sequencing for identification of genes encoding the variable regions of PorB and PorA, respectively that are associated with mAb reactivity (e.g. Sacchi, Lemos et al., supra; Urwin et al., 1998, Epidem. and Infect. 120:257).
- While N. meningitidis strains of any capsular group may be used, N. meningitidis strains of capsular group B are of particular interest as sources from which nucleic acid encoding fHbp and domains thereof are derived.
- While the specification provides the amino acid sequence of examples of fHbps from which the chimeric fHbp can be derived, this is not intended to be limiting. For example, the chimeric fHbp can contain amino acid sequences that are at least 80%, at least 85%, at least 90%, or at least 95% identical to an amino acid sequence of a naturally occurring fHbp.
- Nucleic acids encoding fHbp polypeptides for use in construction of chimeric fHbps contemplated herein are known in the art. Examples of fHbp polypeptides are described in, for example, WO 2004/048404; Masignani et al. 2003 J Exp Med 197:789-799; Fletcher et al. Infect
Immun 2004 2088-2100; Welsch et al.J Immunol 2004 172:5606-5615; and WO 99/57280. Nucleic acid (and amino acid sequences) for fHbp variants and subvariants are also provided in GenBank as accession nos.: NC_003112, GeneID: 904318 (NCBI Ref. NP_274866),peptide ID 1 from N. meningitidis strain MC58; AY548371 (AAT01290.1) (from N. meningitidis strain CU385); AY548370 (AAT01289.1) (from N. meningitidis strain H44/76); AY548377 (AAS56920.1)peptide ID 4 from N. meningitidis strain M4105; AY548376 (AAS56919.1) (from N. meningitidis strain M1390); AY548375 (AAS56918.1) (from N. meningitidis strain NZ98/254); AY548374 (AAS56917.1) (from N. meningitidis strain M6190); AY548373 (AAS56916.1) (from N. meningitidis strain 4243); and AY548372 (AAS56915.1) (from N. meningitidis strain BZ83). - For purposes of identifying relevant amino acid sequences contemplated for use in the chimeric fHbps disclosed herein, it should be noted that the immature fHbp protein includes a leader sequence of about 19 residues. Furthermore, when provided an amino acid sequence the ordinarily skilled person can readily envision the sequences of nucleic acid that can encode for, and provide for expression of, a polypeptide having such an amino acid sequence.
- In addition to the specific amino acid sequences and nucleic acid sequences provided herein, the disclosure also contemplates polypeptides and nucleic acids having sequences that are at least 80%, at least 85%, at least 90%, or at least 95% identical in sequence to the amino acid and nucleic acids. The terms “identical” or percent “identity,” in the context of two or more polynucleotide sequences, or two or more amino acid sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical over a specified region), when compared and aligned for maximum correspondence over a designated region, e.g., a VE or a region at least about 40, 45, 50, 55, 60, 65 or more amino acids or nucleotides in length, and can be up to the full-length of the reference amino acid or nucleotide sequence (e.g., a full-length fHbp). The disclosure specifically contemplates both naturally-occurring polymorphisms and synthetically produced amino acid sequences and their encoding nucleic acids.
- For sequence comparison, typically one sequence acts as a reference sequence (e.g., a naturally-occurring fHbp polypeptide sequence), to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer program, sequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Examples of algorithms that are suitable for determining percent sequence identity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1977) Nucleic Acids Res. 25: 3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov). Further exemplary algorithms include ClustalW (Higgins D., et al. (1994) Nucleic Acids Res 22: 4673-4680), available at www.ebi.ac.uk/Tools/clustalw/index.html.
- In one embodiment, residue positions which are not identical differ by conservative amino acid substitutions. Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains. For example, a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur-containing side chains is cysteine and methionine.
- Sequence identity between two nucleic acids can also be described in terms of hybridization of two molecules to each other under stringent conditions. The hybridization conditions are selected following standard methods in the art (see, for example, Sambrook, et al., Molecular Cloning: A Laboratory Manual, Second Edition, (1989) Cold Spring Harbor, N.Y.). An example of stringent hybridization conditions is hybridization at 50° C. or higher and 0.1×SSC (15 mM sodium chloride/1.5 mM sodium citrate). Another example of stringent hybridization conditions is overnight incubation at 42° C. in a solution: 50% formamide, 5×SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH7.6), 5×Denhardt's solution, 10% dextran sulfate, and 20 mg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1×SSC at about 65° C. Stringent hybridization conditions are hybridization conditions that are at least as stringent as the above representative conditions, where conditions are considered to be at least as stringent if they are at least about 80% as stringent, typically at least 90% as stringent as the above specific stringent conditions.
- The chimeric fHbps of the present disclosure are described in more detail below in the context of modular architecture described above.
- The chimeric fHbp of the present disclosure refers to non-naturally occurring chimeric fHbp, including fHbps that may be described by a modular architecture as those set forth in
FIG. 8 , panels A and B and a modular architecture not shown inFIG. 8 , panels A and B. The term “chimeric factor H binding protein” or “chimeric fHbp” refers to a polypeptide comprising, from N-terminus to C-terminus, a group of five variable segments represented by VA, VB, VC, VD, and VE, in which the combination of α/β progenitor segments and/or combination of alleles of which is not found in nature. One example of the chimeric fHbps of the present disclosure can contain at least one or more of the variable segments derived from a different progenitor than at least one other variable segment in the chimeric fHbp. In other words, the chimeric fHbp contains at least one variable segment of an α progenitor amino acid sequences and at least one variable segment of a β progenitor, such that the combination is not found in nature. In another example, the fHbp may also be of a modular architecture shown inFIG. 8 , panel A (e.g. modular I or II in which all variable segments are α or β, respectively), in which each segment is of an allele such that the combination of the alleles is not found in nature. - The variable segments may be flanked by invariant segments (I2, I3, I4, I5, I6, I7), which can act as linkers for the variable segments. Accordingly, the chimeric fHbps of the present disclosure can be described by the formula:
-
V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E - wherein each of the variable segments (VA, VB, VC, VD, and VE) can be derived from either an α or a β progenitor amino acid sequence.
- Chimeric fHbp can optionally include a leader sequence, e.g., to provide for expression of the chimeric fHbp on a cell surface of a bacterial host cell. Chimeric fHbp may also include about 1, 5, 10, or more residues as an N-terminal element (Nte) and/or C-terminal element (Cte). For example, the Nte may comprise 1, 2, or 6 glycine residues, or about 6 residues of a mixture of glycines and serines following the N-terminal most invariant segment (I1).
- In addition, chimeric fHbps of the present disclosure can optionally include an N-terminal element, one or both of invariant segments that flank the N-terminal element, and/or most C-terminal invariant segment (17). A chimeric fHbp comprising one or more of these optional features can be described by the following formula:
-
I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E; -
Nte-I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E; -
I 1-Nte-I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E; -
V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E-I 7; -
I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E-I 7; -
Nte-I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E-I 7; and -
I 1-Nte-I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E-I 7. - in which the variable segments (VA, VB, VC, VD, and VE) can be derived from either an α or β progenitor amino acid sequence.
- In addition to having various combinations of variable segments, each derived from either an α or β progenitor amino acid sequence, chimeric fHbp of the present disclosure may also contain one or more variable segments that are heterologous with respect to α and β progenitor amino acid sequences. A heterologous variable segment refers to a variable segment that comprises both a contiguous α and a contiguous β progenitor amino acid sequences, with the point at which the amino acid sequence “switches” to the other progenitor sequence referred to herein as a “junction point”. E.g. See VA of
peptide ID 55, VB ofpeptide ID 24 andID 25, and VE ofpeptide ID 82. Particularly, one or more of the junction points (J1, J2, or J3) within a variable segment described above forpeptide ID FIG. 8 , panel C for the conserved residues in each variable segment that serve as junction points. - Variable segments of the non-naturally occurring chimeric fHbps of the present disclosure may have an amino acid sequence of at least 80%, at least 85%, at least 90%, at least 95% identical to a corresponding segment in a naturally occurring fHbp, and can be 100% identical in amino acid sequence.
- Examples of chimeric fHbps include those containing one or more of the following variable segments. Each segment can be independently selected from any alleles in the corresponding segment shown in
FIGS. 2A-2E , Table 8. The variable segments are described in more detail below using certain alleles as examples. - VA contains a contiguous amino acid sequence that is at least 85%, at least 90%, or at least 95% identical to Segment ID A.α.1 or A.β.1 (SEQ ID NO:15 or NO:67) shown in
FIG. 2A (Table 8), e.g., at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown inFIG. 2A (Table 8) for Segment A. - VB contains a contiguous amino acid sequence that is at least 75%, at least 80%, at least 90%, or at least 95% identical to Segment ID B.α.1 or B.β.1 (SEQ ID NO:85 or NO:95) shown in
FIG. 2B (Table 8), e.g., at least 75%, at least 80%, at least 90%, or at least 95% identical to one of the amino acid sequences shown inFIG. 2B (Table 8) for Segment B. - VC contains s a contiguous amino acid sequence that is at least 80%, at least 85%, at least 90%, or at least 95% identical to Segment ID C.α.1 or C.β.1 (SEQ ID NO:96 or NO:152) shown in
FIG. 2C (Table 8), e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown inFIG. 2C (Table 8) for Segment C. - VD contains a contiguous amino acid sequence that is at least 80%, at least 85%, at least 90%, or at least 95% identical to Segment ID D.α.1 or D.β.1 (SEQ ID NO:174 or NO:192) shown in
FIG. 2D (Table 8), e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown inFIG. 2D (Table 8) for Segment D. - VE contains a contiguous amino acid sequence that is at least 80%, at least 85%, at least 90%, or at least 95% identical to Segment ID E.α.1 or E.β.1 (SEQ ID NO: 195 or NO:262) shown in
FIG. 2E (Table 8), e.g., at least 80%, at least 85%, at least 90%, or at least 95% identical to one of the amino acid sequences shown inFIG. 2E (Table 8) for Segment E. - The variable segments in the chimeric fHbp of the present disclosure may also be of the similar length as the corresponding segments listed in
FIG. 2A-2E (Table 8). For example, a variable segment may be no more than about 50, 30, 20, 10, 5, or 1 amino acid residues less or more than one of the corresponding amino acid sequences shown inFIG. 2A-2E (Table 8). - The chimeric fHbps of the present disclosure have a full length amino acid sequence that is not found in a naturally occurring fHbp. Most of the naturally occurring fHbps which contain only α or only β progenitor sequences or combinations thereof fall into one of the following modular groups: I, II, III, IV, V, VI, VII, VIII, or IX (see
FIG. 8 ). Non-naturally occurring fHbps of the present disclosure can also be of a modular group other than I, II, III, IV, V, VI, VII, VIII, or IX. The non-naturally occurring fHbps of the present disclosure can be described by new modular groups encompassing non-naturally occurring amino acid sequences that are built based on the modular architecture described herein. Some examples of chimeric fHbps of the present disclosure are presented below. - Examples of Chimeric fHbps
- The chimeric fHbps of the present disclosure encompass those that can be described in terms of one or more of, for example, the invariant and variable segments and their progenitor type, the presence or absence of an epitope(s) specifically bound by a mAb, or any combination of such features that may be present in the chimeric fHbps.
- Many combinations may be generated by switching α or β segments in and out of various segments for a different type of modular group. Any alleles of α or β segments can also be independently chosen from those shown
FIG. 2A-2E (Table 8). Modular group may also be designed to maintain or include certain antibody epitopes. Certain antibodies are found to be bactericidal against a specific variant of N. meningitidis but not a different variant. If a chimeric fHbp of a modular group contains variable segments that present multiple epitopes, each specific for an antibody bactericidal against a different variant, the chimeric fHbp may be useful to elicit antibodies or immune response effective against a broad spectrum of N. meningitidis. For example, in a case where epitopes for JAR4, JAR3, and JAR32 antibodies are known and are desirable to be incorporated into an fHbp, a chimeric fHbp may be made to comprise VAα, VCα, and VDβ, where epitopes of JAR4, JAR3, and JAR32 reside, respectively. - For example, a chimeric fHbp may have VD that is derived from 3 progenitor sequences while the rest of the variable segments remain as derivations from α progenitor sequences. Such chimeric fHbp comprises variable segments represented as VAα, VBα, VCα, VDβ, and VEα; and its first and second junction points are at I5 and I6, respectively. In a different example, an fHbp belonging to another modular group encompassing non-naturally occurring chimeric fHbp may contain VAα, VBα, VCα, VDβ, and VEβ; and its junction point resides at Is. An additional example of a modular group encompasses non-naturally occurring fHbp that comprises VAα, VBα, VCα, VDα, and VEβ as the invariable segments.
- Accordingly, examples of non-naturally occurring chimeric fHbps including those described above may be of modular groups represented by the following formula but not limited to:
-
V Aα-I 3-V Bα-I 4-V Cα-I 5-VDβ-I 6-V Eα; -
V Aα-I 3-V Bα-I 4-V Cα-I 5-V Dβ-I 6-V Eβ; -
V Aα-I 3-V Bα-I 4-V Cα-I 5-V Dα-I 6-V Eβ; -
V Aα-I 3-V Bα-I 4-V Cα-I 5-V D-I 6-V Eα; -
V Aα-I 3-V Bβ-I 4-V C-I 5-V D-I 6-V E; -
V Aβ-I 3-V Bα-I 4-V Cα-I 5-V Dα-I 6-V Eβ; -
V Aβ-I 3-V Bα-I 4-V Cα-I 5-V Dβ-I 6-V Eα; -
V Aβ-I 3-V Bα-I 4-V C-I 5-V D-I 6-V E; -
V Aβ-I 3-V B-I 4-V C-I 5-V Dα-I 6-V Eα; or -
V Aβ-I 3-V Bβ-I 4-V C-I 5-V Dβ-I 6-V Eα; - In any group shown above in which a variable segment (VA, VB, VC, VD, or VE) is not followed by an α or a β (e.g. VC, VD, and VE in the fifth modular group from the top) represents a variable segment that can be derived from either an α or a β progenitor amino acid sequence. The formula may also include a variable N-terminal element, its flanking invariable sequences (I1 and I2), or the most C-terminal invariable segment (I7), omitted in the formula above. As noted above for fHbp of the present disclosure, each variable segment of the fHbps described by the formulas above can be of any allele.
- In another example, the chimeric fHbp of the present disclosure also encompass those that contain all a or all 0 segments, in which each of the segments is of an allele such that the combination of all a or all 0 allelic segments is not found in nature.
- Chimeric fHbp Comprising Heterologous Variable Segment
- In certain cases, non-naturally occurring fHbp of the present disclosure may comprise one or more heterologous variable segments. These heterologous variable segment-containing fHbps may also be described by modular architectures other than those set forth in
FIG. 8 , panel A. Thus, for example, non-naturally occurring fHbp of the present disclosure include those having: a heterologous VA(β→α), but do not have α progenitor sequence for all of VB, VC, VD, and VE; a heterologous VB(α→β), but do not have a VA of α progenitor sequence together with VC, VD, and VE of β progenitor sequence; and a heterologous VE(α→β), but do not have β progenitor sequence for all of VA, VB, and VC together with a progenitor sequence for VD. Exemplary non-naturally occurring fHbps are presented by several examples below, each containing one heterologous variable segment. However, non-naturally occurring fHbps are not limited to the examples, e.g. an fHbp may comprise more than one heterologous variable segment. - For example, a heterologous variable segment-containing fHbp may be one comprising a heterologous VA, such as VA(β→α) as exemplified by
peptide ID 55, in which not all of VB, VC, VD, and VE are of the α progenitor amino acid sequences. A non-naturally occurring fHbp may also comprise VA(α→β), and in which VB, VC, VD, and VE are independently selected from α and β. Another exemplary non-naturally occurring fHbp may comprise VB(α→β) as exemplified bypeptide ID 24, in which VA is of a α progenitor and not all of VC, VD, and VE are of the β progenitor amino acid sequences. A non-naturally occurring fHbp may comprise VB(αβ), in which VA is of a β progenitor. A non-naturally occurring fHbp may comprise VB(β→α) in which VA, VC, VD, and VE are independently selected from α and β. Additionally, a non-naturally occurring fHbp may comprise a heterologous VE, such as VE(αβ) seen inpeptide ID 82, together with VDα, in which not all of VA, VB, VC are of the β progenitor origin. A non-naturally occurring fHbp may comprise VE(αβ) together with VDβ, in which VA, VB, and VC are independently selected from a and β. Another example of a non-naturally occurring fHbp that contains a heterologous variable segment is one that comprises VE(β→α), in which VA, VB, VC, and VD are independently selected from a and 3. - Chimeric fHbp Having Modified Epitope(s)
- The chimeric fHbp of the present disclosure may comprise one or more variable segments in which one or more residues may be mutated relative to the amino acid sequence found in the naturally occurring fHbp so as to introduce an epitope of interest. These epitopes are referred to herein “heterologous epitopes” since they are heterologous to the variable segment in which they reside. Site-directed mutagenesis may be used to introduce one or more heterologous epitopes for a specific antibody of interest into a variable segment that naturally does not contain such epitope. As such, mutations to insert, delete, or substitute one or more amino acid residues may be used to create chimeric fHbp of the present disclosure. Various mutations may be also screened for an fHbp that is effective as vaccines or may be immunogenic to elicit bactericidal antibodies.
- For example, an fHbp may comprise an epitope that binds to an antibody JAR13, normally found in VE of a β progenitor sequence and not in an α progenitor sequence. To generate a fHbp that includes VEα while at the same time contains the JAR13 epitope, the epitope may be introduced into a VEα sequence. Selective mutation allows the amino acid sequence of VE to be derived from the α progenitor type except for a specific site for the JAR13 epitope. As such, regardless of the amino acid sequence used to derive the sequences of the variable segments of the chimeric fHbp, epitopes may be introduced into the corresponding variable segment to include or maintain regions of desired antigenicity.
- Chimeric fHbps also encompass chimeric fHbp that contain two or more epitopes that elicit antibodies that, when both are bound to their respective epitopes, exhibit enhanced bactericidal activity against N. meningitidis than when either one is bound alone. For example, the combination of
JAR 4 andJAR 5 mAbs exhibit higher level of bactericidal activity against N. meningitidis than when each is used alone in a human-complement-mediated assay. Chimeric fHbp can be designed so as to ensure that such epitopes are maintained or to introduce such combination of epitopes. Chimeric fHbps can also be designed to include an epitope(s) that elicits antibodies that, when bound to fHbp, inhibit fH binding. For example, when the epitopes bound by the monoclonal antibodies JAR3,JAR 5, JAR11, or JAR32/35 are bound by antibody, binding of fHbp to fH is inhibited. Thus, the presence of such fH-binding epitopes in the chimeric fHbp polypeptides can provide for production of antibodies that can facilitate protection through this pathway. - The antibodies that bind epitopes that may be of interest to introduce or maintain in the segments of a chimeric fHbp are disclosed in WO 09/114485, the disclosure of which is incorporated in its entirety by reference. Certain epitopes of interest with a corresponding JAR mAbs are presented in the table 1 below and pointed out in
FIG. 9 , panel C. -
TABLE 1 Antibodies and their corresponding epitopes. (Immunogen) Antibody Reactive Residue(s) fHbp variant bound mAb 502 R204 1 JAR 3G121 and K122 1 JAR 4DHK (starting at 25); v.1, v.2 (high reactivity) YGN (starting at 57) and v.3 (lower reactivity) JAR 5G121 and K122 v.1 JAR 10K180 and E192 v.1 (subset), v.2 (subset) and v.3 (subset) JAR 11A174 v.2 (subset) and v.3 (subset) JAR 13S216 v.2 (subset) and v.3 (all) JAR 32K174 v.3 and v.2 (subset) JAR 33E180 and R192 v.3 and v.2 (subset) JAR 35K174 v.3 and v.2 (subset) - Other Features of Interest
- Chimeric polypeptides described herein can include additional heterologous amino acid sequences, e.g., to provide an N-terminal methionine or derivative thereof (e.g., pyroglutamate) as a result of expression in a bacterial host cell (e.g., E. coli) and/or to provide a chimeric polypeptide having a fusion partner at its N-terminus or C-terminus. Fusion partners of interest include, for example, glutathione-S-transferase (GST), maltose binding protein (MBP), His6-tag, and the like, as well as leader peptides from other proteins, particularly lipoproteins. Fusion partners can provide for additional features, such as in facilitating isolation and purification of the chimeric polypeptide.
- Native fHbp usually contains an N-terminal cysteine to which a lipid moiety can be covalently attached. This cysteine residue is usually lipidated in the naturally-occurring protein, and can be lipidated in the chimeric fHbps disclosed herein. Thus, in the amino acid sequences described herein (including those presented in any Sequence Listing), reference to “cysteine” or “C” at this position specifically includes reference to both an unmodified cysteine as well as to a cysteine that is lipidated (e.g., due to post-translational modification). Thus, the chimeric fHbp can be lipidated or non-lipidated. Methods for production of lipidated proteins in vitro, (see, e.g., Andersson et al., 2001 J. Immunological Methods 255(1-2):135-48) or in vivo are known in the art. For example, lipidated fHbp previously has been purified from the membrane fraction of E. coli protein by detergent extraction (Fletcher et al., 2004 Infection and Immunity 72(4):2088-100), which method may be adapted for the production of lipidated chimeric fHbp. Lipidated proteins may be of interest as such can be more immunogenic than soluble protein (see, e.g., Fletcher et al., 2004 Infection and Immunity 72(4):2088-100).
- Nucleic Acid Encoding Chimeric fHBP
- The chimeric fHbp can be generated using recombinant techniques to manipulate nucleic acids of different fHbps known in the art to provide constructs encoding a chimeric fHbp of interest. As noted above, nucleic acids encoding a variety of different v.1, v.2, and v.3 fHbps of N. meningitidis are available in the art, and their nucleotide sequences are known.
- Amino acid and nucleic acid sequences of the naturally occurring fHbps are provided in
FIG. 2A-2E (Table 5) and available in the art. It will be appreciated that the nucleotide sequences encoding the chimeric fHbps can be modified so as to optimize the codon usage to facilitate expression in a host cell of interest (e.g., E. coli, N. meningitidis, human (as in the case of a DNA-based vaccine), and the like). Methods for production of codon optimized sequences are known in the art. - The present disclosure also features methods of screening for an immunogenic composition comprising a chimeric fHbp, vaccine against bacterial pathogens, antibodies and nucleic acid encoding the same. The methods may involve evaluating the ability of a specific chimeric fHbp to elicit bactericidal antibodies and/or to provide a broad spectrum immunity against bacterial pathogens. The methods can involve assessing the ability of antibodies elicited by immunization with a chimeric fHbp of the present disclosure to inhibit fH binding to fHbp of N. meningitidis of diverse variant groups and/or to elicit bactericidal activity. The antibody may be elicited in a host animal immunized with an immunogenic composition comprising a chimeric fHbp of the present disclosure or screened in a phage display library for its specific affinity to a candidate chimeric fHbp. Among other aspects, the methods find particular use in identifying and/or evaluating antibody having bactericidal and/or anti-neoplastic activity.
- In one embodiment, a method of evaluating binding of an antibody to a bacterial cell is provided. The method comprises: (a) immunizing a host animal with a composition comprising a chimeric fHbp of the present disclosure, (b) isolating antibodies from the host animal that have binding affinity to the chimeric fHbp, (c) contacting a bacterial cell with the isolated antibodies; and (d) assessing binding of the antibody to the bacterial cell. Additional steps may include assessing the competitive binding of the antibody to fHbp with human factor H; assessing the bactericidal activity against a bacterial pathogen when incubated in vitro with complement; or assessing the ability of the antibody administered to an animal to confer passive protection against infection. In some embodiments, the antibody is in an antibody population, and the method further comprises: (c) isolating one or more antibodies of the antibody population that bind the bacterial cell. A featured aspect is isolated antibody that is bactericidal against the bacterial cell, which may include, for example, complement-mediated bactericidal activity and/or opsonophagocytic activity capable of decreasing the viability of the bacteria in human blood. The subject method may also include assessing the susceptibility of a host animal administered with a vaccine comprising a chimeric fHbp to a bacterial pathogen.
- Bacterial pathogen of particular interest are N. meningitidis of any or all fHbp variant groups, of diverse capsular groups, such as N. meningitidis Serogroup B, N. meningitidis Serogroup C, N. meningitidis Serogroup X, N. meningitidis Serogroup Y, N. meningitidis Serogroup W-135, and the like.
- Chimeric fHbps can be produced by any suitable method, including recombinant and non-recombinant methods (e.g., chemical synthesis). Where the chimeric fHbp is produced using recombinant techniques, the methods can involve any suitable construct and any suitable host cell, which can be a prokaryotic or eukaryotic cell, usually a bacterial or yeast host cell, more usually a bacterial cell. Methods for introduction of genetic material into host cells include, for example, transformation, electroporation, conjugation, calcium phosphate methods and the like. The method for transfer can be selected so as to provide for stable expression of the introduced chimeric fHbp-encoding nucleic acid. The chimeric fHbp-encoding nucleic acid can be provided as an inheritable episomal element (e.g., plasmid) or can be genomically integrated.
- Suitable vectors for transferring chimeric fHbp-encoding nucleic acid can vary in composition. Integrative vectors can be conditionally replicative or suicide plasmids, bacteriophages, and the like. The constructs can include various elements, including for example, promoters, selectable genetic markers (e.g., genes conferring resistance to antibiotics (for instance kanamycin, erythromycin, chloramphenicol, or gentamycin)), origin of replication (to promote replication in a host cell, e.g., a bacterial host cell), and the like. The choice of vector will depend upon a variety of factors such as the type of cell in which propagation is desired and the purpose of propagation. Certain vectors are useful for amplifying and making large amounts of the desired DNA sequence. Other vectors are suitable for expression in cells in culture. Still other vectors are suitable for transfer and expression in cells in a whole animal. The choice of appropriate vector is well within the skill of the art. Many such vectors are available commercially.
- The vector can be an expression vector based on episomal plasmids containing selectable drug resistance markers and elements that provide for autonomous replication in different host cells (e.g., in both E. coli and N. meningitidis). One example of such a “shuttle vector” is the plasmid pFP10 (Pagotto et al.
Gene 2000 244:13-19). - Constructs can be prepared by, for example, inserting a polynucleotide of interest into a construct backbone, typically by means of DNA ligase attachment to a cleaved restriction enzyme site in the vector. Alternatively, the desired nucleotide sequence can be inserted by homologous recombination or site-specific recombination. Typically homologous recombination is accomplished by attaching regions of homology to the vector on the flanks of the desired nucleotide sequence, while site-specific recombination can be accomplished through use of sequences that facilitate site-specific recombination (e.g., cre-lox, att sites, etc.). Nucleic acid containing such sequences can be added by, for example, ligation of oligonucleotides, or by polymerase chain reaction using primers comprising both the region of homology and a portion of the desired nucleotide sequence.
- Vectors can provide for extrachromosomal maintenance in a host cell or can provide for integration into the host cell genome. Vectors are amply described in numerous publications well known to those in the art, including, e.g., Short Protocols in Molecular Biology, (1999) F. Ausubel, et al., eds., Wiley & Sons. Vectors may provide for expression of the nucleic acids encoding a chimeric fHBP, may provide for propagating the subject nucleic acids, or both.
- Examples of vectors that may be used include but are not limited to those derived from recombinant bacteriophage DNA, plasmid DNA or cosmid DNA. For example, plasmid vectors such as pBR322,
pUC 19/18,pUC pCV 103,pCV 107,pCV 108, pTM, pMCS, pNNL, pHSG274, COS202, COS203, pWE15, pWE16 and thecharomid 9 series of vectors. - For expression of a chimeric fHbp of interest, an expression cassette may be employed. Thus, the present disclosure provides a recombinant expression vector comprising a subject nucleic acid. The expression vector provides transcriptional and translational regulatory sequences, and may provide for inducible or constitutive expression, where the coding region is operably linked under the transcriptional control of the transcriptional initiation region, and a transcriptional and translational termination region. These control regions may be native to an fHbp from which the chimeric fHbp is derived, or may be derived from exogenous sources. In general, the transcriptional and translational regulatory sequences may include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences. Promoters can be either constitutive or inducible, and can be a strong constitutive promoter (e.g., T7, and the like).
- Expression vectors generally have convenient restriction sites located near the promoter sequence to provide for the insertion of nucleic acid sequences encoding proteins of interest. A selectable marker operative in the expression host may be present to facilitate selection of cells containing the vector. In addition, the expression construct may include additional elements. For example, the expression vector may have one or two replication systems, thus allowing it to be maintained in organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification. In addition the expression construct may contain a selectable marker gene to allow the selection of transformed host cells. Selection genes are well known in the art and will vary with the host cell used.
- It should be noted that chimeric fHbp of the present disclosure may comprise additional elements, such as a detectable label, e.g., a radioactive label, a fluorescent label, a biotin label, an immunologically detectable label (e.g., an HA tag, a poly-Histidine tag) and the like. Additional elements of chimeric fHbp can be provided to facilitate isolation (e.g., biotin tag, immunologically detectable tag) through various methods (e.g., affinity capture, etc.). Chimeric fHbp can optionally be immobilized on a support through covalent or non-covalent attachment.
- Isolation and purification of chimeric fHbp can be accomplished according to methods known in the art. For example, chimeric fHbp can be isolated from a lysate of cells genetically modified to express a chimeric fHbp, or from a synthetic reaction mix, by immunoaffinity purification, which generally involves contacting the sample with an anti-chimeric fHbp antibody (e.g., an anti-chimeric fHBP mAb, such as a
JAR 5 mAb or other appropriate JAR mAb described herein), washing to remove non-specifically bound material, and eluting specifically bound chimeric fHbp. Isolated chimeric fHbp can be further purified by dialysis and other methods normally employed in protein purification methods. In one embodiment, the chimeric fHbp can be isolated using metal chelate chromatography methods. - Host Cells
- Any of a number of suitable host cells can be used in the production of chimeric fHbp. In general, the chimeric fHbp described herein may be expressed in prokaryotes or eukaryotes, usually bacteria, more usually E. coli or Neisseria (e.g., N. meningitidis) in accordance with conventional techniques. Thus, the present disclosure further provides a genetically modified host cell, which contains a nucleic acid encoding a chimeric fHBP. Host cells for production (including large scale production) of a chimeric fHBP can be selected from any of a variety of available host cells. Exemplary host cells for expression include those of a prokaryotic or eukaryotic unicellular organism, such as bacteria (e.g., Escherichia coli strains), yeast (e.g., S. cerevisiae, Pichia spp., and the like), and may include host cells originally derived from a higher organism such as insects, vertebrates, particularly mammals, (e.g. CHO, HEK, and the like). Generally bacterial host cells and yeast are of particular interest for chimeric fHBP production.
- Chimeric fHbps can be prepared in substantially pure or substantially isolated form (i.e., substantially free from other Neisserial or host cell polypeptides) or substantially isolated form. In certain embodiments, the chimeric fHbp is present in a composition that is enriched for the polypeptide relative to other components that may be present (e.g., other polypeptides or other host cell components). Purified chimeric fHbp can be provided such that the polypeptide is present in a composition that is substantially free of other expressed polypeptides, e.g., less than 90%, usually less than 60% and more usually less than 50% of the composition is made up of other expressed polypeptides.
- Host Cells for Vesicle Production
- Where a chimeric fHbp is to be provided in a membrane vesicle (as discussed in more detail below), a Neisserial host cell is genetically modified to express a chimeric fHbp. Any of a variety of Neisseria spp. strains can be modified to produce a chimeric fHbp, and, optionally, which produce or can be modified to produce other antigens of interest, such as PorA, can be used in the methods disclosed herein.
- Methods and vectors to provide for genetic modification of Neisserial strains and expression of a desired polypeptide are known in the art. Examples of vectors and methods are provided in WO 02/09746 and O'Dwyer et al. Infect
Immun 2004; 72:6511-80. - Strong promoters, particularly constitutive strong promoters are of particular interest.
- Exemplary promoters include the promoters of porA, porB, lbpB, tbpB, p110, hpuAB, lgtF, opa, p110, 1st, hpuAB. and rmp.
- Pathogenic Neisseria spp. or strains derived from pathogenic Neisseria spp., particularly strains pathogenic for humans or derived from strains pathogenic or commensal for humans, are of particular interest for use in membrane vesicle production. Examples of Neisserial spp. include N. meningitidis, N. flavescens, N. gonorrhoeae, N. lactamica, N. polysaccharea, N. cinerea, N. mucosa, N. subflava, N. sicca, N. elongata, and the like.
- N. meningitidis strains are of particular interest for genetic modification to express a chimeric fHbp and for use in vesicle production. The strain used for vesicle production can be selected according to a number of different characteristics that may be desired. For example, the strain may be selected according to: a desired PorA type (a “serosubtype”, as described above), capsular group, serotype, and the like; decreased capsular polysaccharide production; and the like. For example, the production strain can produce any desired PorA polypeptide, and may express one or more PorA polypeptides (either naturally or due to genetic engineering). Examples of strains include those that produce a PorA polypeptide which confers a serosubtype of P1.7,16; P1.19,15; P1.7,1; P1.5,2; P1.22a,14; P1.14; P1.5,10; P1.7,4; P1.12,13; as well as variants of such PorA polypeptides which may or may not retain reactivity with conventional serologic reagents used in serosubtyping. Also of interest are PorA polypeptides characterized according to PorA variable region (VR) typing (see, e.g., Russell et al. Emerging Infect
Dis 2004 10:674-678; Sacchi C T, et al, Clin Diagn Lab Immunol 1998; 5:845-55; Sacchi et al, J. InfectDis 2000; 182:1169-1176). A substantial number of distinct VR types have been identified, which can be classified into VR1 and VR2 family “prototypes”. A web-accessible database describing this nomenclature and its relationship to previous typing schemes is found at neisseria.org/nm/typing/pora. Alignments of exemplary PorA VR1 and VR2 types are provided in Russell et al. Emerging InfectDis 2004 10:674-678. - Alternatively or in addition, the production strain can be a capsule deficient strain. Capsule deficient strains can provide vesicle-based vaccines that provide for a reduced risk of eliciting a significant autoantibody response in a subject to whom the vaccine is administered (e.g., due to production of antibodies that cross-react with sialic acid on host cell surfaces). “Capsule deficient” or “deficient in capsular polysaccharide” as used herein refers to a level of capsular polysaccharide on the bacterial surface that is lower than that of a naturally-occurring strain or, where the strain is genetically modified, is lower than that of a parental strain from which the capsule deficient strain is derived. A capsule deficient strain includes strains that are decreased in surface capsular polysaccharide production by at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 75%, 80%, 85%, 90% or more, and includes strains in which capsular polysaccharide is not detectable on the bacterial surface (e.g., by whole cell ELISA using an anti-capsular polysaccharide antibody).
- Capsule deficient strains include those that are capsule deficient due to a naturally-occurring or recombinantly-generated genetic modification. Naturally-occurring capsule deficient strains (see, e.g., Dolan-Livengood et al. J. Infect. Dis. (2003) 187(10):1616-28), as well as methods of identifying and/or generating capsule-deficient strains (see, e.g., Fisseha et al. (2005) Infect. Immun. 73(7):4070-4080; Stephens et al. (1991) Infect Immun 59(11):4097-102; Frosch et al. (1990) Mol Microbiol. 1990 4(7):1215-1218) are known in the art.
- Modification of a Neisserial host cell to provide for decreased production of capsular polysaccharide may include modification of one or more genes involved in capsule synthesis, where the modification provides for, for example, decreased levels of capsular polysaccharide relative to a parent cell prior to modification. Such genetic modifications can include changes in nucleotide and/or amino acid sequences in one or more capsule biosynthesis genes rendering the strain capsule deficient (e.g., due to one or more insertions, deletions, substitutions, and the like in one or more capsule biosynthesis genes). Capsule deficient strains can lack or be non-functional for one or more capsule genes.
- Of particular interest are strains that are deficient in sialic acid biosynthesis.
- Such strains can provide for production of vesicles that have reduced risk of eliciting anti-sialic acid antibodies that cross-react with human sialic acid antigens, and can further provide for improved manufacturing safety. Strains having a defect in sialic acid biosynthesis (due to either a naturally occurring modification or an engineered modification) can be defective in any of a number of different genes in the sialic acid biosynthetic pathway. Of particular interest are strains that are defective in a gene product encoded by the N-acetylglucosamine-6-phosphate 2-epimerase gene (known as synX AAF40537.1 or siaA AAA20475), with strains having this gene inactivated being of especial interest. For example, in one embodiment, a capsule deficient strain is generated by disrupting production of a functional synX gene product (see, e.g., Swartley et al. (1994) J Bacteriol. 176(5):1530-4).
- Capsule-deficient strains can also be generated from naturally-occurring strains using non-recombinant techniques, e.g., by use of bactericidal anti-capsular antibodies to select for strains that reduced in capsular polysaccharide.
- Where the disclosure involves use of two or more strains (e.g., to produce antigenic compositions containing a chimeric fHbp-presenting vesicles from different strains), the strains can be selected so as to differ in one or more strain characteristics, e.g., to provide for vesicles that differ in the chimeric fHbp used, PorA, and the like.
- Preparation of Vesicles
- The antigenic compositions contemplated by the present disclosure generally include vesicles prepared from Neisserial cells that express a chimeric fHbp. As referred to herein “vesicles” is meant to encompass outer membrane vesicles as well as microvesicles (which are also referred to as blebs).
- The antigenic composition can contain outer membrane vesicles (OMV) prepared from the outer membrane of a cultured strain of Neisseria meningitidis spp. genetically modified to express a chimeric fHbp. OMVs may be obtained from Neisseria meningitidis grown in broth or solid medium culture, preferably by separating the bacterial cells from the culture medium (e.g. by filtration or by a low-speed centrifugation that pellets the cells, or the like), lysing the cells (e.g. by addition of detergent, osmotic shock, sonication, cavitation, homogenization, or the like) and separating an outer membrane fraction from cytoplasmic molecules (e.g. by filtration; or by differential precipitation or aggregation of outer membranes and/or outer membrane vesicles, or by affinity separation methods using ligands that specifically recognize outer membrane molecules; or by a high-speed centrifugation that pellets outer membranes and/or outer membrane vesicles, or the like); outer membrane fractions may be used to produce OMVs.
- The antigenic composition can contain microvesicles (MV) (or “blebs”) containing chimeric fHbp, where the MV or blebs are released during culture of a Neisseria meningitidis strain genetically modified to express a chimeric fHbp. For example, MVs may be obtained by culturing a strain of Neisseria meningitidis in broth culture medium, separating whole cells from the broth culture medium (e.g. by filtration, or by a low-speed centrifugation that pellets only the cells and not the smaller blebs, or the like), and then collecting the MVs that are present in the cell-free culture medium (e.g. by filtration, differential precipitation or aggregation of MVs, or by a high-speed centrifugation that pellets the blebs, or the like). Strains for use in production of MVs can generally be selected on the basis of the amount of blebs produced in culture (e.g., bacteria can be cultured in a reasonable number to provide for production of blebs suitable for isolation and administration in the methods described herein). An example of a strain that produces high levels of blebs is described in PCT Publication No. WO 01/34642. In addition to bleb production, strains for use in MV production may also be selected on the basis of NspA production, where strains that produce higher levels of NspA may be of particular interest (for examples of N. meningitidis strains having different NspA production levels, see, e.g., Moe et al. (1999 Infect. Immun. 67: 5664). Other strains of interest for use in production of blebs include strains having an inactivated GN33 gene, which encodes a lipoprotein required for cell separation, membrane architecture and virulence (see, e.g., Adu-Bobie et al. Infect Immun. 2004; 72:1914-1919).
- The antigenic compositions of the present disclosure can contain vesicles from one strain, or from 2, 3, 4, 5 or more strains, which strains may be homologous or heterologous, usually heterologous, to one another. For example, the strains may be homologous or heterologous with respect to PorA. The vesicles can also be prepared from strains that express more than one chimeric fHbp (e.g., 1, 2, 3, or more chimeric fHbp) which may be composed of fHbp amino acid sequences from different variants (v.1, v.2, or v.3) or subvariants (e.g., a subvariant of v.1, v.2, or v.3).
- The antigenic compositions can contain a mixture of OMVs and MVs presenting the same or different chimeric fHbps, where the chimeric fHbps may optionally present epitopes from different combinations of fHbp variants and/or subvariants and where the OMVs and/or MVs may be from the same or different strains. Vesicles from different strains can be administered as a mixture, or can be administered serially. The antigentic composition may contain vesicles containing one or more different chimeric fHbp, in which the vesicles and the fHbp are both derived from the same host cells. The composition can also be made from vesicles and fHbp that are derived from different host cells so that the vesicles and fHbp are admixed after their separate purification.
- Where desired (e.g., where the strains used to produce vesicles are associated with endotoxin or particular high levels of endotoxin), the vesicles are optionally treated to reduce endotoxin, e.g., to reduce toxicity following administration. Although less desirable as discussed below, reduction of endotoxin can be accomplished by extraction with a suitable detergent (for example, BRIJ-96, sodium deoxycholate, sodium lauroylsarcosinate, Empigen BB, Triton X-100, TWEEN 20 (sorbitan monolaurate polyoxyethylene),
TWEEN 80, at a concentration of 0.1-10%, preferably 0.5-2%, and SDS). Where detergent extraction is used, it is preferable to use a detergent other than deoxycholate. - The vesicles of the antigenic compositions can be prepared without detergent, e.g., without use of deoxycholate. Although detergent treatment is useful to remove endotoxin activity, it may deplete the native fHbp lipoprotein and/or chimeric fHbp (including lipidated chimeric fHbp) by extraction during vesicle production. Thus it may be particularly desirable to decrease endotoxin activity using technology that does not require a detergent. In one approach, strains that are relatively low producers of endotoxin (lipopolysaccharide, LPS) are used so as to avoid the need to remove endotoxin from the final preparation prior to use in humans. For example, the vesicles can be prepared from Neisseria mutants in which lipooligosaccharide or other antigens that may be undesirable in a vaccine (e.g. Rmp) is reduced or eliminated.
- Vesicles can be prepared from N. meningitidis strains that contain genetic modifications that result in decreased or no detectable toxic activity of lipid A. For example, such strain can be genetically modified in lipid A biosynthesis (Steeghs et al. Infect Immun 1999; 67:4988-93; van der Ley et al. Infect Immun 2001; 69:5981-90; Steeghs et al.
J Endotoxin Res 2004; 10:113-9; Fissha et al, Infect Immun 73:4070, 2005). The immunogenic compositions may be detoxified by modification of LPS, such as downregulation and/or inactivation of the enzymes encoded by 1p×L1 or 1p×L2, respectively. Production of a penta-acylated lipid A made in 1p×L1 mutants indicates that the enzyme encoded by 1p×L1 adds the C12 to the N-linked 3-OH C14 at the 2′ position of GlcN II. The major lipid A species found in 1p×L2 mutants is tetra-acylated, indicating the enzyme encoded by 1p×L2 adds the other C12, i.e., to the N-linked 3-OH C14 at the 2 position of GlcN I. Mutations resulting in a decreased (or no) expression of these genes (or decreased or no activity of the products of these genes) result in altered toxic activity of lipid A (van der Ley et al. 2001; 69:5981-90). Tetra-acylated (1p×L2 mutant) and penta acylated (1p×L1 mutant) lipid A are less toxic than the wild-type lipid A. Mutations in thelipid A 4′-kinase encoding gene (1p×K) also decrease the toxic activity of lipid A. Of particular interest for use in production of vesicles (e.g., MV or OMV) are N. meningitidis strains genetically modified so as to provide for decreased or no detectable functional LpxLl-encoded protein. Such vesicles provide for reduced toxicity as compared to N. meningitidis strains that are wild-type for LPS production, while retaining immunogenicity of chimeric fHbp. - LPS toxic activity can also be altered by introducing mutations in genes/loci involved in polymyxin B resistance (such resistance has been correlated with addition of aminoarabinose on the 4′ phosphate of lipid A). These genes/loci could be pmrE that encodes a UDP-glucose dehydrogenase, or a region of antimicrobial peptide-resistance genes common to many enterobacteriaciae which could be involved in aminoarabinose synthesis and transfer. The gene pmrF that is present in this region encodes a dolicol-phosphate manosyl transferase (Gunn J. S., Kheng, B. L., Krueger J., Kim K., Guo L., Hackett M., Miller S. I. 1998. Mol. Microbiol. 27: 1171-1182).
- Mutations in the PhoP-PhoQ regulatory system, which is a phospho-relay two component regulatory system (e.g., PhoP constitutive phenotype, PhoPc), or low Mg++ environmental or culture conditions (that activate the PhoP-PhoQ regulatory system) lead to the addition of aminoarabinose on the 4′-phosphate and 2-hydroxymyristate replacing myristate (hydroxylation of myristate). This modified lipid A displays reduced ability to stimulate E-selectin expression by human endothelial cells and TNF secretion from human monocytes.
- Polymyxin B resistant strains are also suitable for use, as such strains have been shown to have reduced LPS toxicity (see, e.g., van der Ley et al. 1994. In: Proceedings of the ninth international pathogenic Neisseria conference. The Guildhall, Winchester, England). Alternatively, synthetic peptides that mimic the binding activity of polymyxin B may be added to the antigenic compositions to reduce LPS toxic activity (see, e.g., Rustici et al. 1993, Science 259:361-365; Porro et al. Prog Clin Biol Res. 1998; 397:315-25).
- Endotoxin can also be reduced through selection of culture conditions. For example, culturing the strain in a growth medium containing 0.1 mg-100 mg of aminoarabinose per liter medium provides for reduced lipid toxicity (see, e.g., WO 02/097646).
- “Antigen composition”, “antigenic composition” or “immunogenic composition” is used herein as a matter of convenience to refer generically to compositions comprising a chimeric fHbp as disclosed herein, which chimeric fHbp may be optionally conjugated to further enhance immunogenicity. Compositions useful for eliciting antibodies, particularly antibodies against Neisseria meningitidis group B (NmB), in a human are specifically contemplated by the present disclosure. Antigenic compositions can contain 2 or more different chimeric fHbps, where the chimeric fHbps may present epitopes from different combinations of fHbp variants and/or subvariants.
- Antigenic compositions generally comprise an immunologically effective amount of chimeric fHbp, and may further include other compatible components, as needed. By “immunologically effective amount” is meant that the administration of that amount to an individual, either in a single dose, as part of a series of the same or different antigenic compositions, is effective to elicit an antibody response effective for treatment or prevention of a symptom of, or disease caused by, for example, infection by Neisseria, particularly N. meningitidis, more particularly Group B N. meningitidis. This amount varies depending upon the health and physical condition of the individual to be treated, age, the capacity of the individual's immune system to produce antibodies, the degree of protection desired, the formulation of the vaccine, the treating clinician's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
- Dosage regimen may be a single dose schedule or a multiple dose schedule (e.g., including booster doses) with a unit dosage form of the antigenic composition administered at different times. The term “unit dosage form,” as used herein, refers to physically discrete units suitable as unitary dosages for human and animal subjects, each unit containing a predetermined quantity of the antigenic compositions of the present disclosure in an amount sufficient to produce the desired effect, which compositions are provided in association with a pharmaceutically acceptable excipient (e.g., pharmaceutically acceptable diluent, carrier or vehicle). The antigenic composition may be administered in conjunction with other immunoregulatory agents.
- Antigenic compositions can be provided in a pharmaceutically acceptable excipient, which can be a solution such as a sterile aqueous solution, often a saline solution, or they can be provided in powder form. Such excipients can be substantially inert, if desired.
- The antigenic compositions can further comprise an adjuvant. Examples of known suitable adjuvants that can be used in humans include, but are not necessarily limited to, alum, aluminum phosphate, aluminum hydroxide, MF59 (4.3% w/v squalene, 0.5% w/
v Tween 80™, 0.5% w/v Span 85), CpG-containing nucleic acid (where the cytosine is unmethylated), QS21, MPL, 3DMPL, extracts from Aquilla, ISCOMS, LT/CT mutants, poly(D,L-lactide-co-glycolide) (PLG) microparticles, Quil A, interleukins, and the like. For experimental animals, one can use Freund's, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred to as nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1′-2′-dip-almitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835A, referred to as MTP-PE), and RIBI, which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2% squalene/Tween 80 emulsion. The effectiveness of an adjuvant may be determined by measuring the amount of antibodies directed against the immunogenic antigen or antigenic epitope thereof. - Further exemplary adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59™ (WO 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds. Powell & Newman, Plenum Press 1995), containing 5% Squalene, 0.5% Tween 80, and 0.5% Span 85 (optionally containing MTP-PE) formulated into submicron particles using a microfluidizer, (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RIBI™ adjuvant system (RAS), (Ribi Immunochem, Hamilton, Mont.) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components such as monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (Detox™); (2) saponin adjuvants, such as QS21 or Stimulon™ (Cambridge Bioscience, Worcester, Mass.) may be used or particles generated therefrom such as ISCOMs (immunostimulating complexes), which ISCOMS may be devoid of additional detergent e.g. WO 00/07621; (3) Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (IFA); (4) cytokines, such as interleukins (e.g. IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 (WO99/44636), etc.), interferons (e.g. gamma interferon), macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), etc.; (5) monophosphoryl lipid A (MPL) or 3-O-deacylated MPL (3dMPL) e.g. GB-2220221, EP-A-0689454, optionally in the substantial absence of alum when used with pneumococcal saccharides e.g. WO 00/56358; (6) combinations of 3dMPL with, for example, QS21 and/or oil-in-water emulsions e.g. EP-A-0835318, EP-A-0735898, EP-A-0761231; (7) oligonucleotides comprising CpG motifs (Krieg Vaccine 2000, 19, 618-622; Krieg Curr opin Mol Ther2001 3:15-24; Roman et al., Nat. Med, 1997, 3, 849-854; Weiner et al., PNAS USA, 1997, 94, 10833-10837; Davis et al, J. Immunol, 1998, 160, 810-876; Chu et al., J. Exp. Med, 1997, 186, 1623-1631; Lipford et al, Ear. J. Immunol., 1997, 27, 2340-2344; Moldoveami e/al., Vaccine, 1988, 16, 1216-1224, Krieg et al., Nature, 1995, 374, 546-549; Klinman et al., PNAS USA, 1996, 93, 2879-2883; Ballas et al, J. Immunol, 1996, 157, 1840-1845; Cowdery et al, J. Immunol, 1996, 156, 4570-4575; Halpern et al, Cell Immunol, 1996, 167, 72-78; Yamamoto et al, Jpn. J. Cancer Res., 1988, 79, 866-873; Stacey et al, J. Immunol., 1996, 157,2116-2122; Messina et al, J. Immunol, 1991, 147, 1759-1764; Yi et al, J. Immunol, 1996, 157,4918-4925; Yi et al, J. Immunol, 1996, 157, 5394-5402; Yi et al, J. Immunol, 1998, 160, 4755-4761; and Yi et al, J. Immunol, 1998, 160, 5898-5906; International patent applications WO 96/02555, WO 98/16247, WO 98/18810, WO 98/40100, WO 98/55495, WO 98/37919 and WO 98/52581, i.e. containing at least one CG dinucleotide, where the cytosine is unmethylated; (8) a polyoxyethylene ether or a polyoxyethylene ester e.g. WO 99/52549; (9) a polyoxyethylene sorbitan ester surfactant in combination with an octoxynol (WO 01/21207) or a polyoxyethylene alkyl ether or ester surfactant in combination with at least one additional non-ionic surfactant such as an octoxynol (WO 01/21152); (10) a saponin and an immunostimulatory oligonucleotide (e.g. a CpG oligonucleotide) (WO 00/62800); (11) an immunostimulant and a particle of metal salt e.g. WO 00/23105; (12) a saponin and an oil-in-water emulsion e.g. WO 99/11241; (13) a saponin (e.g. QS21)+3dMPL+IM2 (optionally+a sterol) e.g. WO 98/57659; (14) other substances that act as immunostimulating agents to enhance the efficacy of the composition. Muramyl peptides include N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-25 acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutarninyl-L-alanine-2-(1′-2′-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE), etc. Adjuvants suitable for administration to a human are of particular interest.
- The antigen compositions may comprise other components, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium, carbonate, and the like. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
- The concentration of chimeric fHbp in a formulation can vary widely (e.g., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight) and will usually be selected primarily based on fluid volumes, viscosities, and patient-based factors in accordance with the particular mode of administration selected and the patient's needs.
- Chimeric fHBP-containing formulations can be provided in the form of a solution, suspension, tablet, pill, capsule, powder, gel, cream, lotion, ointment, aerosol or the like. It is recognized that oral administration can require protection of the compositions from digestion. This is typically accomplished either by association of the composition with an agent that renders it resistant to acidic and enzymatic hydrolysis or by packaging the composition in an appropriately resistant carrier. Means of protecting from digestion are well known in the art.
- Chimeric fHbp-containing formulations can also be provided so as to enhance serum half-life of chimeric fHBP following administration. For example, where isolated chimeric fHbp are formulated for injection, the chimeric fHbp may be provided in a liposome formulation, prepared as a colloid, or other conventional techniques for extending serum half-life. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728 and 4,837,028. The preparations may also be provided in controlled release or slow-release forms.
- The chimeric fHbp-containing antigenic compositions are generally administered to a human subject that is at risk of acquiring a Neisserial disease so as to prevent or at least partially arrest the development of disease and its complications. An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for therapeutic use will depend on, e.g., the antigenic composition, the manner of administration, the weight and general state of health of the patient, and the judgment of the prescribing physician. Single or multiple doses of the antigenic compositions may be administered depending on the dosage and frequency required and tolerated by the patient, and route of administration.
- The chimeric fHbp-containing antigenic compositions are generally administered in an amount effective to elicit an immune response, particularly a humoral immune response, in the host. As noted above, amounts for immunization will vary, and can generally range from about 1 Vag to 100 μg per 70 kg patient, usually 5 μg to 50 ag/70 kg. Substantially higher dosages (e.g. 10 mg to 100 mg or more) may be suitable in oral, nasal, or topical administration routes. The initial administration can be followed by booster immunization of the same of different chimeric fHbp-containing antigenic composition. Usually vaccination involves at least one booster, more usually two boosters.
- In general immunization can be accomplished by administration by any suitable route, including administration of the composition orally, nasally, nasopharyngeally, parenterally, enterically, gastrically, topically, transdermally, subcutaneously, intramuscularly, in tablet, solid, powdered, liquid, aerosol form, locally or systemically, with or without added excipients. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art and are described in more detail in such publications as Remington's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pa. (1980).
- An anti-chimeric fHbp immune response can be assessed by known methods (e.g. by obtaining serum from the individual before and after the initial immunization, and demonstrating a change in the individual's immune status, for example an immunoprecipitation assay, or an ELISA, or a bactericidal assay, or a Western blot, or flow cytometric assay, or the like).
- The antigenic compositions can be administered to a human subject that is immunologically naive with respect to Neisseria meningitidis. In a particular embodiment, the subject is a human child about five years or younger, and preferably about two years old or younger, and the antigenic compositions are administered at any one or more of the following times: two weeks, one month, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 months, or one year or 15, 18, or 21 months after birth, or at 2, 3, 4, or 5 years of age.
- It may be generally desirable to initiate immunization prior to the first sign of disease symptoms, or at the first sign of possible or actual exposure to infection or disease (e.g., due to exposure or infection by Neisseria).
- Hybridomas producing the
JAR 4,JAR 5,JAR 11, andJAR 32 monoclonal antibodies were deposited under the terms of the Budapest Treaty with the American Type Culture Collection, 10801 University Blvd., Manassas, Va. 20110-2209, USA (ATCC) on the date indicated in the table below, and were assigned the designations set out in the table below. -
ATCC Deposit No. (Deposit Date) Material Deposited PTA-8943 (Feb. 7, 2008) Hybridoma producing JAR 4Monoclonal Antibody PTA-8941 (Feb. 7, 2008) Hybridoma producing JAR 5Monoclonal Antibody PTA-8940 (Feb. 7, 2008) Hybridoma producing JAR 10Monoclonal Antibody PTA-8938 (Feb. 7, 2008) Hybridoma producing JAR 11Monoclonal Antibody PTA-8942 (Feb. 7, 2008) Hybridoma producing JAR 32Monoclonal Antibody PTA-8939 (Feb. 7, 2008) Hybridoma producing JAR 33Monoclonal Antibody - It should be noted that
JAR 5 mAb specifically binds to an epitope that at least overlaps with the epitope specifically bound byJAR 3 mAb, and thatJAR 32 mAb specifically binds to an epitope that at least overlaps with the epitope specifically bounds byJAR 35 mAb. - These deposits were made under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purpose of Patent Procedure and the Regulations there under (Budapest Treaty). This assures maintenance of a viable culture of the deposit for 30 years from the date of deposit and for at least five (5) years after the most recent request for the furnishing of a sample of the deposit received by the depository. The deposits will be made available by ATCC under the terms of the Budapest Treaty, and subject to an agreement between Children's Hospital & Research Center at Oakland and the ATCC (the assignee of the present application) which assures that all restrictions imposed by the depositor on the availability to the public of the deposited material will be irrevocably removed upon the granting of the pertinent U.S. patent, assures permanent and unrestricted availability of the progeny of the culture of the deposit to the public upon issuance of the pertinent U.S. patent or upon laying open to the public of any U.S. or foreign patent application, whichever comes first, and assures availability of the progeny to one determined by the U.S. Commissioner of Patents and Trademarks to be entitled thereto according to 35 U.S.C. §122 and the Commissioner's rules pursuant thereto (including 37 C.F.R. §1.14 with particular reference to 886 OG 638).
- The assignee(s) of the present application has agreed that if a culture of the materials on deposit should die or be lost or destroyed when cultivated under suitable conditions, the materials will be promptly replaced on notification with another of the same. Availability of the deposited material is not to be construed as a license to practice the invention in contravention of the rights granted under the authority of any government in accordance with its patent laws.
- It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
- The following methods and materials were used in the Examples below.
- fHbp Sequencing.
- The fHbp gene was amplified from genomic DNA prepared with the DNeasy Tissue kit (Qiagen, Valencia, Calif.) by polymerase chain reaction using primers A1 and B2 and cycling parameters described previously (Masignani et al.
J Exp Med 2003, 197:789-99). The PCR products were purified using QiaQuick PCR purification kit (Qiagen) and were eluted in 30 μl of sterile deionized H2O. The fHbp DNA sequences were determined by a commercial sequencing facility using the primers A1 and 22 described previously (Masignani et al., 2003). - Source of Data.
- Protein sequences analyzed in the first study were encoded by 69 fHbp genes from Neisseria meningitidis case isolates from the United States (Beernink et al. J Infect Dis 2007, 195:1472-9), Europe (Beernink and Granoff Infect
Immun 2008, 76:2568-2575; Beernink et al. InfectImmun 2008, 76:4232-4240) and Africa (Beernink et al., J InfectDis 2009, doi: 10.1086/597806). This data set included 48 sequences determined as part of our previous studies and 21 new sequences performed for the present study. 95 additional fHbp gene sequences were obtained from Genbank (www.ncbi.nlm.nih.gov) by performing translated BLAST (tblastn) searches with fHbp amino acid sequences from strains MC58 (variant 1/sub-family B) and M1239 (variant 3/sub-family A). Among these 164 nucleotide sequences from our collection and Genbank, which included three genome sequences (Parkhill et al.Nature 2000, 404:502-506; Peng et al.Genomics 2008, 91:78-87; Tettelin et al.Science 2000, 287:1809-1815), fHbp genes that encoded 63 unique protein sequences were identified. These 63, plus 6 additional unique fHbp amino acid sequences obtained from the Neisseria.org fHbp peptide database (neisseria.org), were used for the analysis of 69 unique fHbp peptides. The respective Genbank accession numbers and/or peptide identification numbers and the characteristics of the source strains are listed inFIG. 1A-1G (Table 7). - Thirty-eight (55%) of the 69 peptides were classified in the
variant 1 group of Masignani et al. 2003, 15 (22%) in thevariant 2 group, and 16 (23%) in thevariant 3 group. Of the 69 source strains, one was capsular group A, 57 were group B, seven were group C, two were group W-135, and two were group X. Multi-locus sequence type (MLST) information was available for 58 of the strains of which 15 were from the ST-269 clonal complex, 12 each were from the ST-11, 10 were from the ST-41/44 complexes, four were from the ST-162, five were from the ST-213 complexes, three each were from the ST-8 and ST-32 complexes. Six strains were from other clonal complexes and had sequence types ST-4, ST-35, ST-751, ST-4821, ST-5403 and ST-6874. The 11 strains without MLST information were not available for testing. - In a second study, the dataset further included 172 additional distinctive sequences that were subsequently added to the Neisseria.org database (http://neisseria.org/perl/agdbnet/agdbnet.pl?file=nm_fhbp.xml) as of November 2009. In describing the 242 unique proteins (
FIGS. 10A-10I , Table 9), the protein identification (ID) numbers from the peptide database at the Neisseria.org website were employed. - A combination of approaches for analysis of complete or partial protein sequences was used. Sequences were aligned with MUSCLE (EBI, v3.7, ebi.ac.uk/Tools/muscle/index.html) (Edgar R C. (2004) Nucleic Acids Res. 32:1792-7; Edgar R C (2004) BMC Bioinform. 5:113) configured for highest accuracy. The accuracy of the alignments was confirmed by visual inspection and using the program JALVIEW (Water house A M et al. (2009) Bioinformatics 25:1189-91). Alignments also were performed on the individual modular variable segments between the blocks of invariant residues. Networks were generated using SplitsTree, version 4.0 (Huson D H et al., (2006) Mol Biol Evol 23:254-67), with default parameters. Statistical tests for branch support were performed using the bootstrapping method (1000 replicates).
- Phylogenic Analysis.
- The analysis of complete or partial protein sequences was performed on the platform at www.phylogeny.fr (Dereeper et al.
Nucleic Acids Res 2008, 36:W465-469) and comprised the following steps. Sequences were aligned with MUSCLE (v3.7) (EdgarNucleic Acids Res 2004, 32:1792-1797) configured for highest accuracy. The respective alignments, which contained up to three sites of insertions or deletions, were inspected and verified by adjacent invariant sequences. The phylogenic tree was reconstructed using the maximum likelihood method implemented in the PhyML program (v3.0 aLRT). Reliability for internal branch was assessed using the bootstrapping method (100 bootstrap replicates). Phylograms were displayed with MEGA 4.0 (Tamura et al. Mol Biol Evol 2007, 24:1596-1599). The phylograms were rooted onpeptide 1 for consistency. The percent sequence identities within and between variable segment types of sequences were determined using ClustalW (Larkin et al. Bioinformatics 2007, 23:2947-2948). - Cloning, Expression and Purification of Recombinant Proteins.
- Expression plasmids were constructed by PCR amplification of fHbp genes from genomic DNA as described previously (Masignani et al. (2003) J Exp Med 197:789-99). The genes encoded fHbp ID 1 (Modular group I), 28 (group II), 22 (group III), 15 (group IV), 79 (group V) and 77 (group VI). C-terminal hexahistidine-tagged recombinant fHbps were expressed in Escherichia coli BL21(DE3) (Novagen, Madison, Wis., US), and purified as described elsewhere (Beernink P T et al. (2008) Infect Immun 76:2568-75).
- Mouse Antisera.
- Groups of five-week-old CD-1 female mice (10 mice per group) were obtained from Charles River (Wilmington, Md., US). The mice were immunized via the intraperitoneal route (IP) with three doses of vaccine given at 3-week intervals. Each 100-01 dose contained 20 D g of recombinant protein mixed with Freund's adjuvant (FA) (Sigma-Aldrich, St. Louis, Mo., US). (Complete FA for the first dose and incomplete for subsequent doses). Terminal blood samples were obtained three weeks after the last dose. The animal procedures were performed under a protocol approved by the Institutional Animal Care and Use Committee of the Children's Hospital Oakland Research Institute.
- Bacterial Strains.
- Characteristics of the N. meningitidis strains used to measure serum bactericidal activity are summarized in Tables 7 and 9. Two isolates each was selected from modular groups I to VI. For five of the modular groups, one strain from each pair was a low expresser of fHbp and the other a higher expresser as measured as described below. For modular group V, only strains that expressed intermediate quantities of fHbp were identified and, therefore, used for the assays.
- Complement-Dependent Serum Bactericidal Antibody Activity.
- The bactericidal assay was performed as described elsewhere, using early log phase bacteria grown for approximately 2 h in Mueller-Hinton broth (BD Biosciences, Franklin Lakes, N.J., US) supplemented with 0.25% glucose (w/v) and 0.02
mM cytidine 5′-monophospho-N-acetylneuraminic acid (Sigma-Aldrich, St, Louis, Mo., US) [11]. The complement source was serum from a non-immune healthy adult with normal hemolytic complement activity. The serum was passed over a protein G Sepharose column (HiTrap Protein G HP, GE Healthcare, Piscataway, N.J., US) to remove IgG antibodies (Beernink P T et al. (2009) J Infect Dis 199:1360-8). - Quantitative Western Blotting of fHbp.
- N. meningitidis cells were grown in broth cultures to early log phase, heat-killed (56° C. for 1 h), collected by centrifugation, and resuspended in PBS to an optical density of 0.6. Proteins in the heat-killed cells (1-4×107 CFU) were separated by SDS-PAGE using 4-12% NuPAGE gels (Invitrogen, Carlsbad, Calif., US) as specified by the manufacturer, and were transferred to PVDF membranes (Immobilon-FL; Millipore, Billerica, Mass., US) using a Western blot module (Invitrogen, Carlsbad Calif., US). After blocking overnight at 4° C. in blocking buffer (Li-Cor Biosciences, Lincoln, Nebr., US), fHbp modular groups I and IV (
variant 1 group) were detected withanti-fHbp JAR 5 or,JAR 31, for modular groups II, III, V or VI (variant groups 2 or 3) (Beernink P T et la. (2008) Infect Immun 76:4243-40). The secondary antibody was goat anti-mouse IgG-IRDye800CW (1:10,000, Rockland Immunochemicals, Gilbertsville, Pa., US). - To determine the quantity of bound protein, the membranes were scanned at 800 nm wavelength using an infrared scanner (Li-Cor Odyssey, Lincoln, Nebr., US), and the integrated intensities of the bands were calculated with software provided by the manufacturer (version 3.0.21). The results of testing purified, recombinant fHbp from each of the six modular groups indicated that the IR signal intensities were proportional to the log10 of the quantities loaded in the range of 0.03 to 2 μg (representative data for control proteins in modular groups I and VI are shown in
FIG. 11 ). Representative expression data are shown for two strains with fHbp in modular group I, and two strains in modular group VI (FIG. 11 ). - Statistical Analysis.
- Statistical calculations were performed using
Prism 5 for Mac OSX, version 5.0α (GraphPad Software, La Jolla, Calif., US). The proportion of isolates with fHbp in different modular groups in each country was computed along with the respective 95 percent confidence intervals calculated from the binomial distribution. Differences found in the proportion of isolates in the respective modular groups were compared by Fisher Exact Test (two-tailed) or chi-square analyses. - Based on previous analyses of the sequences of the mature peptide, fHbp was classified into two sub-families (Fletcher et al. Infect
Immun 2004, 72:2088-2100) or three variant groups (Masignani et al., 2003) (FIG. 3 ). Analysis presented herein indicated that the overall architecture of meningococcal fHbp contains a limited number of specific modular combinations of five variable segments, with each segment corresponding to one of two types, designated as a or f, based on sequence similarity to the respective segments of fHbp peptides 1 (variant 1 group) or 28 (variant 3 group). As described in the Examples section below and shown inFIG. 4 , the amino acid sequences of two N. gonorrhoeae orthologs had architectures corresponding to natural chimeras in modular group V (FIG. 8 ). The propensity for Neisseria to transfer genes horizontally (Hotopp et al.Microbiology 2006, 152:3733-3749), coupled with the similar modular architectures of meningococcal and gonococcal fHbp peptides described here, suggests that during evolution, the respective progenitor genes recombined at conserved sequences encoding the invariant blocks of residues hypothesized to be points of junction. - Among the 69 distinct meningococcal fHbp peptides, 65 (94%) could be assigned to one of six modular groups (
FIG. 8 ). Nearly 60% of the peptides were in modular groups I or II, which comprised only α or β type segments, respectively. The remaining peptides were natural chimeras of α and β segments. Modular fHbp groups, III, IV, and V (FIG. 8 ), could each have been generated from the two progenitor types by a single recombination event. The modular fHbp group VI could have been generated by two recombination events. Similarly the four exceptional sequences described in the Examples section could each have been generated through recombination at loci encoding alternative blocks of other conserved residues. For a protein comprising five segments, each of which can be of one of two types, there are 25=32 theoretical independent modular combinations. That we identified only six modular groups suggests that there are functional or structural constraints on the molecule that select for certain combinations of the modules found in the prevalent fHbp modular groups. - fHbp structural data are available from two recent NMR studies (Cantini et al.,
J Biol Chem 2009, doi:10.1074/jbc.C800214200; Mascioni et al.J Biol Chem 2009, doi:10.1074/jbc.M808831200) and a crystallographic study of fHbp in a complex with a complement regulatory protein (Cantini et al., 2009; Mascioni et al., 2009; Schneider et al.Nature 2009, doi: 10.1038/nature07769). In the crystal structure, Schneider et al reported that binding to residues located on the short consensus repeat region 6 (SCR 6) of fH was mediated by charged amino acid residues in the fHbp structure that mimicked portions of sugar molecules known to bind to fH (Schneider et al. 2009). Analysis as presented inFIG. 9 indicated that these fH contact residues were located on three of the five variable segments identified in the present study. Of the 21 fH contact residues, five were invariant among the 69 unique fHbp peptides analyzed in our study and ten other contact residues were conserved. - All three fHbp variable segments with fH contact residues also contained amino acids that affected epitopes recognized by bactericidal murine anti-fHbp mAbs (
FIG. 9 ). The central locations of the fH contact residues in the amino- or carboxyl-terminal domains appeared to be distinct from the peripheral locations of the residues affecting epitope expression. This reciprocal relationship suggests that the fHbp structures in contact with fH infrequently elicited bactericidal antibodies. - One limitation of fHbp as a vaccine candidate is antigenic variability (Beernink & Granoff, 2009; Masignani et al., 2003). Thus, serum antibodies to recombinant fHbp in the
variant 1 group were bactericidal primarily only against strains withvariant 1 proteins (Beernink et al. 2007; Fletcher et al. InfectImmun variant homologous variant variant 1 group. These observations suggest that epitopes in the C and E segments of fHbp, for whichvariant 1 proteins were phylogenetically separated from those ofvariant FIGS. 6 and 7 ), are more important for eliciting bactericidal antibodies than those in the A, B or D segments, wherevariant 1 proteins clustered together withvariant 2 and/or 3 proteins (FIGS. 5 and 6 ). However, all of the variable segments with the exception of segment B contained residues previously identified as affecting epitopes recognized by murine bactericidal anti-fHbp mAbs (Beernink et al. 2008; Beernink et al. Mol Immunol 2009b, doi: 10.1016/j.molimm.2009.02.021; Guiliani et al Infect Immun 2005, 73:1151-1160). Further, some of the mAbs inhibited binding of fH to the bacterial surface (Madico et al.J Immunol 2006, 177:501-510), and some combinations of mAbs that individually were not bactericidal elicited cooperative bactericidal activity (Beernink et al. 2008; Beernink et al. 2009b; Welsch et al. J InfectDis 2008, 197:1053-1061). The latter includedmAb JAR 4, which was specific for an epitope on variable segment A (Beernink et al. 2009b), and elicited cooperative bactericidal activity with second mAbs with epitopes on variable segment C (forexample JAR 3 or 5) or variable segment E (for example,JAR 13 or mAb502). - To minimize the possibility of fHbp escape mutants, an ideal meningococcal vaccine should include antigenic targets other than fHbp (Giuliani et al., 2006). However, there may be limits to the number of recombinant proteins that can be combined in a multicomponent vaccine because of the large dose of total protein required, poor tolerability, or loss of immunogenicity of the individual components. To decrease the number of individual fHbp components, we engineered chimeric fHbp molecules containing the amino-terminal domain of a
variant 1 fHbp with the carboxyl-terminal domain of avariant 2 protein using G136 as the junctional point (Beernink & Granoff, 2008). The resulting chimeric protein expressed epitopes from all three variant groups, and the chimeric fHbp vaccines elicited serum antibodies with bactericidal activity against a panel of genetically diverse strains expressingfHbp variant Granoff 2008; Beernink et al. 2009b). Thus, the presence of such fH-binding epitopes in the chimeric fHbp polypeptides can provide for production of antibodies that can facilitate protection against N. meningitidis. - In conclusion, the analysis herein shows that the overall architecture of fHbp can be defined by a limited number of specific modular combinations of variable segments flanked by invariant sequences. Collectively, the data suggest that recombination occurred between N. meningitidis and N. gonorrhoeae progenitor sequences to generate an antigenically diverse family of meningococcal factor H-binding proteins. The data presented in the Examples thus provide insights into the evolution of fHbp variants, and provide a rational basis for classification of groups of peptide variants. Population-based surveillance studies will be required to define the prevalence of fHbp from different modular groups among strains causing carriage and/or disease, and the relationship between the fHbp modular group and other strain characteristics such as capsular group, clonal complex and PorA variable regions.
- Details of the studies that led to this discovery are set out below.
- 69 unique fHbp amino acid sequences were aligned to generate a phylogram shown in
FIG. 3 . For each sequence, the peptide identification number assigned in fHbp peptide database at neisseria.org is shown and, if known, the multi-locus sequence type (MLST) clonal complex is shown in parentheses. The lower left branch showsvariant group 1 as defined by Masignani et al 2003 (sub-family B of Fletcher et al 2004); sub-family A contained two branches,variant groups variant groups - The analysis showed the two major branches previously designated as sub-families A and B (Fletcher et al. 2004). Sub-family A contained fHbp sequences in
antigenic variant groups peptides variant 1 group,peptides variant 2 group andpeptide 59 in thevariant 3 group). The strains from the ST-32 clonal complex had fHbp in two of the variant groups (peptides variant 1 group andpeptide 76 in thevariant 3 group) and the ST-8 clonal complex had fHbp only in one variant group (peptides variant 2 group). The distribution of fHbp variants in all of the observed clonal complexes is given in Table 2 below. Peptide IDs listed are assigned by the fHbp peptide database at neisseria.org. -
TABLE 2 Distribution of factor H binding protein variants in each clonal complex. Clonal Number in Variant group (peptide ID) Complex Variant 1 Variant 2 Variant 3 Total ST-4 1 (5) 0 0 1 ST-8 0 3 (16, 50, 77) 0 3 ST-11 7 (2, 3, 6, 9, 10, 4 (17, 22, 23, 27) 1 (59) 12 11, 78) ST-32 2 (1, 89) 0 1 (76) 3 ST-35 1 (7) 0 0 1 ST-41/44 6 (4, 8, 12, 14, 2 (19, 20) 2 (28, 84) 10 86, 87) ST-162 1 (88) 1 (21) 2 (29, 82) 4 ST-213 1 (90) 1 (24) 3 (30, 31, 85) 5 ST-269 10 (13, 15, 60-63, 2 (68, 83) 3 (64, 70, 72) 15 65, 66, 69, 71) ST-4821 1 (80) 0 0 1 Unassigned 2 (73, 74) 0 1 (79) 3 Not done 6 (40, 54-58) 2 (25, 49) 3 (45-47) 11 - Blocks of two to five invariant residues were identified that separate the proteins into segments of variable residues. See
FIG. 4 for detail. The invariant residues are shown as vertical rectangles. The top three panels show representative architectures of three N. meningitidis fHbp variants ingroups - With the exception of the amino-terminal element, there were identical respective invariant amino acid sequences and homologous variable segments in two N. gonorrhoeae orthologs (Genbank accession numbers AE004969 and CP001050), which overall had 96% amino acid sequence identity with meningococcal fHbp peptide 79 (
variant 3 meningococcal proteins). In the first study, all 69 fHbp sequence variants had blocks of 2 to 5 invariant residues that flanked five modular variable segments (FIG. 4 ). These invariant residues were also conserved in 170 of the 172 additional fHbp variants analyzed instudy 2. One exception,protein ID 33, had SHFDF instead of SRFDF between the A and B segments, and the other exception, protein,ID 150, had IEHLE instead of IEHLK between the D and A segments (FIG. 4 ). - The blocks of invariant residues appeared to represent natural junctional points for recombination of the respective genes encoding the meningococcal and gonococcal proteins. The phylogeny of each the variable segments defined by these junctional points was analyzed. In the analysis of the 69 distinctive meningococcal fHbp peptide variants described below, the numbering of the amino acid residues is based on the
mature fHbp peptide 1 encoded by a gene from MC58 in thevariant 1 group (Masignani et al. 2003). The numbering for therespective variant variant 1 protein by −1 and +7, respectively (FIG. 4 ). - For all 69 sequences, the mature fHbp began with a cysteine residue that is lipidated by signal peptidase II, which was followed by three invariant amino acid residues, SSG. This invariant sequence was followed by a repetitive variable sequence consisting of 1 to 6 glycine and/or serine residues and then by two invariant glycine residues (
FIG. 4 ). The variable portion of the amino-terminal element consisted of a single glycine residue for 34 of the 69 peptides (nearly all in thevariant 1 group, Table 3 shown below), or GG residues for 12 of the peptides (all in thevariant 2 group). The other common variable sequence was GGGSGG (8 in thevariant 1 group and 7 in thevariant 3 group). -
TABLE 3 Sequence and distribution of amino-terminal repetitive element Variable Number of Peptides in Variant Group Sequence1 Variant 1 Variant 2Variant 3 G 29 3 2 GG 0 12 0 SGG 0 0 1 GGGS 0 0 2 (SEQ ID NO: 7) SGSGG 0 0 1 (SEQ ID NO: 8) GGGSGG 8 0 6 (SEQ ID NO: 9) GGGSGS 1 0 4 (SEQ ID NO: 10) 1The mature fHbp begins with an invariant tetrapeptide, CSSG, which is followed by a repetitive variable sequence consisting of 1 to 6 glycine and/or serine residues, which is then followed by two invariant glycine residues. - There were five variable segments, which we designated A, B, C, D or E (
FIG. 4 ). Based on the presence of certain signature amino acid residues and sequence similarity (Table 4), each of the five segments could be segregated into one of two types. One of the types had signature amino acid residues and sequence similarity to peptides in theantigenic variant 1 group. The other type had signature amino acid residues and sequence similarity to peptides in theantigenic variant 3 group, which also were similar to those of the gonococcal ortholog (seeFIG. 4 ). Also see Table 4 presented below. -
TABLE 4 Amino acid identity within and between sequence groups by segment. α Sequence Types β Sequence Types Identity Identity Identity between α Variable Invariant Signature Range Signature Range and β Types Segment Residue Range1 Block2 residues3 No.4 (%) residues3 No.4 (%)4 (%)4 A 8-73 SRFDF QSV 48 89-100 DSI and 21 89-1005 69-785 KDN B 79-93 GEFQ IRQ 53 80-1005 VQK 16 100 60-665 C 98-159 DD QDS 38 85-100 NNP 31 93-100 32-45 D 162-180 IEHLK AG or 58 89-100 PN 11 84-100 52-63 AS E 186-253 KQ6 SLGI 38 86-100 HLAL 31 94-1005 48-575 1Amino acid numbering based on the mature fHbp from strain MC58. 2Invariant block of residues immediately following each variable segment. The invariant sequence immediately before segment A was GG (See FIG. 4). 3See FIG. 2A-2E: (Table 8) for complete sequences of each variable segment. 4Number of sequences in each sequence type for each variable segment (N = 61 peptides). 5Four fHbp sequences with exceptional junctional positions at other conserved blocks of residues were excluded from the percent identity analyses (see text). 6Corresponds to carboxyl-terminal end of fHbp sequence - For purposes of classification, the first group of segments is designated as a types and the second group as 0 types. The amino acid identity of the respective segments within an α or β type ranges from 80 to 100% (Table 4). In contrast, the identity of segments between types ranged from 69-78% for segment A, which was located in a conserved region of the N-terminal portion of the molecule, to 32-45% in the C segment, which encompassed resides 98-159 in a much less conserved region of the protein (Table 4). For each segment, distinct sequence variants were assigned a unique identifier beginning with a letter, A through E, to represent the variable segment; followed by an α or β to indicate the presence of residues with the respective types described above, followed by a number for each distinct sequence (listed in
FIG. 2A-2E (Table 8)). - Segment A began at
amino acid residue 8 immediately after the invariant GG sequence and extended to position 73 (Table 4). Among the 69 fHbp variants, segment A contained 16 distinctive α sequence variants, and 9 distinctive β sequence variants (FIG. 5 ). Where multiple peptides possessed an identical sequence in a segment, the number of peptides is given in parentheses. The scale bar indicates 5 amino acid changes per 100 residues. Based on the phylogram, the A segments of most of the fHbps in thevariant 1 group (shown inFIG. 5 ) clustered with those in thevariant 2 group, whereas the A segments of fHbps in thevariant 3 group were in a separate cluster. The most common α variant (N=14) was designated A.α.1, which was present in 4 fHbp peptides in thevariant 1 group and 10 in thevariant 2 group. The most common β variant was designated A.β.1, which was present in 6 peptides, all in thevariant 3 group. - Segment B began at
position 79 immediately after an invariant SRFDF sequence and extended to position 93 (Table 4). Among the 69 fHbp peptides, segment B contained 7 different α variant sequences and a single β sequence (FIG. 5 ). The phylogenic analysis showed that the B segments of fHbp peptides in thevariant FIG. 5 ), which were distinct from those in the variant β group. The most common B segment, B.α.1, was present in 40 fHbp peptides (28 in thevariant 1 group and 12 in thevariant 2 group). - In contrast to the A and B segments, the respective C (residues 98-159) and E (residues 186-253) segments of fHbp in the
variant variant 1 group 1 (FIG. 6 ). All of the D segments (residues 162-180) of strains with fHbp in thevariant group 1 were α types while those of fHbp peptides in thevariant FIG. 7 ). The most common D segment, D.α.1 (N=39), was present in 21 fHbp v.1 peptides, 9 v.2 peptides and 9 v.3 peptides. - Based on the phylogenic analysis of the variable segments of fHbp described above, the majority of these different fHbp variants studied were categorized into six distinct fHbp modular groups (I to VI) (
FIG. 8 ). Forty of the 69 fHbp peptides (58%) comprised only α (N=33) or β (N=7) type segments, which were designated fHbp modular groups I and II, respectively (FIG. 8 ). The α segments are shown in gray and the β segments are shown in white. The remaining 29 peptides (42%) could be classified into one of four chimeras derived from recombination of different α or β segments (designated fHbp modular groups III, IV, V or VI; N=25) or, as described below, were other chimeras (N=4) in which one of the five segments used an exceptional junctional position at other conserved blocks of sequences. As seen inFIG. 6 , a representative peptide in each modular group is indicated by the peptide identification number from the fHbp database at neisseria.org. The number of unique sequences observed within each fHbp modular group is indicated at the right. This analysis excluded four peptides sequences with exceptional junctional points at one of their segments. - Although the amino-terminal repetitive segment described above was not used to define the modular fHbp groups, the majority (88 to 100%) of modular group I, III and VI peptides sequences had amino-terminal repetitive elements of 1 or 2 glycine residues (Table 3). In contrast, the majority (75 to 100%) of the peptides in modular groups II, IV and V had amino-terminal elements of 3 to 6 glycine and serine residues. The length of this amino-terminal element may affect the distance of the protein from the bacterial membrane and surface-accessibility of certain epitopes.
- In the second study, all but three of the 172 new fHbp variants could be classified into one of the six modular groups (I to VI,
FIG. 4 , Panel A). The three exceptions (protein ID - Of 242 distinct fHbp variants in the expanded database, 125 proteins were in modular group I (
FIG. 4 ), which contained only α segments, and 20 proteins were in modular group II (entirely β □ segments). The remaining 97 fHbp sequence variants were natural chimeras of α and β segments and were assigned to modular groups III through IX (together, 40 percent of all variants).FIG. 4 shows the fHbp variant groups as described by Masignani et al. (2003) J Exp Med 1997:789-99 for each of the modular groups. The variant groups were assigned based on the relatedness of the overall amino acid sequences of the respective proteins. - Four fHbp sequences had modular structures similar to those described above except that one of the junctional points between two of the segments utilized alternative invariant sequences. For example,
fHbp peptide 55 was similar to peptides in modular group IV (FIG. 8 ) except that the A segment switched from a β type sequence to an α type sequence at an invariant AQGAE starting atresidue 50 rather than at SRFDF starting atresidue 74. This A segment was designated A.β.9 (β because of its higher sequence identity to other β type A segments than to the α type A segments;FIG. 5 ). Two other fHbp peptides, 24 and 25 (FIG. 2A-2E (Table 8)), had modular structures similar to peptides in modular group III (FIG. 8 ) but had B segments that switched from an α type to a β type sequence at an invariant IEV beginning atresidue 82 instead of GEFQ atposition 94. This exceptional B segment, designated B.α.3, was categorized as an α type because of its higher sequence identity to other α type B segments than to the 0 type B segments (FIG. 5 ). The fourth exceptional fHbp modular structure, peptide 82 (FIG. 2A-2E (Table 8)), was similar to type V, except that its E segment, designated E.β.10, switched from an α type sequence to a p type at residue A196 instead of at IEHLK starting at position 181 (FIG. 6 ). - The respective variable and invariant segments of fHbp were mapped onto a molecular model based on the published coordinates from the fHbp crystal structure (
FIG. 9 ) (Schneider et al. 2009). The amino- and carboxyl-termini, labeled N and C, respectively, in panel A are in identical positions in panels B and C. The figure was constructed with PyMol (pymol.org). The models in the center of panels A, B and C have been rotated 180 degrees on the Y-axis from the corresponding models on the far left, while the models on the far right have been rotated 90 degrees on the X-axis as compared with the models in the middle. - The ribbon models in panel A show the two previously described major domains of fHbp (Cantini et al. 2009; Mascioni et al. 2009; Schneider et al. 2009), each containing independently folded beta-structures, which are connected together by a structured, four amino acid residue linker located in variable segment C. The amino-terminal domain, which begins at
residue 8 and extends toresidue 136, includes variable segments A and B and part of C (note that the first 14 residues of the mature protein are not present in the crystal structure). The carboxyl-terminal domain, which extends from residue 141 to 255, includes the carboxyl-terminal portion of the C and the entire D and E variable segments. - Panel B shows the corresponding space-filled models. The amino acid residues previously reported to be in contact with fH based on the structure of the fHbp-fH complex are depicted in black. These residues form clusters on variable segments A, C and E and are visible in the models shown in the middle and far right of panel B. Since fH is known to bind to fHbp on live bacteria (Madico et al. 2006; Schneider et la. 2006), this binding site must be surface-exposed. The invariant blocks of residues that flank each of the five variable segments, are localized on the opposite face of the protein and shown in white in panels B and C (far left model). Since the amino-terminus, which contains the signal anchor, extends from this face of the protein (bottom surface of model at far right, panel B), the invariant residues are predicted to be located entirely on the surface of the molecule anchored to the cell wall. The presence of these invariant sequences on the membrane-associated surface suggests that there are structural constraints, perhaps a requirement for a partner protein, for anchoring and/or orienting fHbp on the bacterial cell membrane.
- Previous studies mapped the epitopes of eleven bactericidal anti-fHbp mAbs (Beernink et al. 2008; Beernink et al. 2009b; Giuliani et al. 2005; Scarselli et al
J Mol Biol 2009, 386:97-108). In panel C (FIG. 9 ), the amino acids affecting expression of each of these epitopes are depicted in black and the previously defined fH contact residues (shown in black as in panel B). With the exception of segment B, all of the variable segments contained epitopes recognized by bactericidal mAbs. The amino acids affecting the epitopes generally were located on the periphery of the amino- and carboxyl-terminal domains of fHbp whereas the residues in contact with fH were located in clusters in the central portions of each of the two domains. The epitopes of certain mAbs such asJAR - The analysis described above provided information on the extent of fHbp modular group diversity. For this following analysis, the fHbp sequence data from systematically collected group B isolates in the U.S. and Europe reported by Murphy et al. (2009) J Infect Dis 200:379-89 were used. The isolates were from cases in the United States between 2001 and 2005 (N=432), and from the United Kingdom (N=536), France (N=244), Norway (N=23) and the Czech Republic (N=27) for the years 2001 to 2006. The U.S. data were supplemented with fHbp sequences of 143 additional isolates that had been systematically collected at multiple sites in the U.S. as part of another study (Beernink P T et al. (2007) J Infect Dis 195:1472-9).
- Among the total of 1405 systematically collected group B isolates, modular group I was found in 59.7%, group II in 1.7%, group III in 8.1%, group IV in 10.6%, group V in 6.1%, and group VI in 13.6%. The new modular groups, VII, VIII and IX, were each found in ≦0.1%. The respective distributions of the fHbp modular groups in the different countries as stratified by the variant group classification of Masignani et al. (2003) J Exp Med 197:789-99 are shown in
FIG. 12 . For this analysis, the data from Norway and Czech Republic were excluded, since the number of isolates in each of these collections was too small for precise estimates of the respective frequencies of the modular groups. The respective percentages of the modular groups in the two U.S. collections are shown separately. - Isolates in
variant 1 group of Masignani consisted of modular groups I, IV and VII. Modular group I strains, which have entirely α-type segments, predominated in all three countries (54 to 64 percent of all isolates). In the UK, however, 23% of all isolates were modular group IV, which are natural chimeras of α- and β-type segments (FIG. 8 ), as compared with <1% in the two U.S. collections, and 3 percent of isolates from France (P<0.001 by chi square). Since there was only one isolate in modular group VII (France), the frequency of this modular group is not shown inFIG. 12 . - Isolates in
variant 2 group included modular groups III and VI, which are all natural chimeras of α- and β-type segments. Modular groups III or VI were present in approximately equal proportions of isolates in the two U.S. collections, while modular group VI predominated amongvariant 2 isolates from the UK and France. - Isolates with
variant 3 group included modular group II (entirely 3-type segments) and modular groups V, VIII and IX, which are chimeras. In France and the UK, modular group V accounted for the majority of the isolates withvariant 3 fHbp, while in the two U.S. collections there were approximately equal numbers of modular group II or V proteins. Modular groups VIII and IX accounted for <0.1% of the isolates. Because of the low percentages, these groups are not shown onFIG. 12 . -
FIG. 13 depicts human complement bactericidal titers of serum pools from mice immunized with recombinant fHbp vaccines representative of modular groups I-VI. The heights of the bars represent the respective median titers of each of the six antisera (3 to 4 pools per modular group) when tested against the specific test strain. For example, the upper left panel shows the data for strain H44/76, which is a high expresser of fHbp in modular group I (relative expression is designated by +++; actual values are shown in Table 5 below). The median bactericidal titer of the homologous anti-fHbp modular group I antiserum (black bar) was ˜1:6000. The respective titers of the five heterologous anti-fHbp modular group antisera (white bars) against strain H44/76 were 1 to 2 log10 lower, ranging from <1:10 (antisera to modular group II) to ˜1:200 (antisera to modular group IV). The corresponding median titers of the anti-modular group II and IV antisera when tested against control strains with homologous fHbp modular groups II (strain SK104 in theVariant 3 panel) or IV (NM452 in theVariant 1 panel) were >1:2000. Thus, these and the other heterologous antisera had high antibody activity when measured against control strains with the respective homologous fHbp modular groups. - There were lower bactericidal titers against low fHbp expressing strains than against high expressing strains (compare respective graphs on the right side of
FIG. 13 showing data for low expressing strains [designated+/−], with those on the left showing higher expressers). For example the anti-modular group I antiserum had a titer of 1:6000 against H44/76, a high fHbp modular group I expressing strain, but a titer of ˜1:100 againststrain 03S-0408, a low fHbp modular group I expresser. (For modular group V, both test strains were intermediate expressers, since a pair of high and low fHbp expressing strains were not available). - There was a trend for lower cross-reactivity of anti-fHbp bactericidal activity against strains with low expression of fHbp from heterologous modular groups than for high expressing strains (see for example, data for low expressing
strains 03S-0408 (modular group I), M01573 (modular group IV), and RM1090 (modular group III), which were killed only by their respective homologous modular group antisera as compared with the broader bactericidal activity against the respective higher fHbp expressing strains (H44/76, NM452, and 03S-0673;FIG. 13 ). Strain NMB (fHbp modular group VI) was completely resistant to anti-fHbp bactericidal activity (titer <1:10), which apparently was a result of low fHbp expression (Table 5). The amino acid sequence of the vaccine used to prepare the anti-modular group VI antisera differed by a single amino acid from fHbp expressed by NMB, and the resulting antisera were bactericidal against a higher expressing strain (961-5945) with fHbp modular group VI. Further, the resistant strain, NMB, was killed by a control anti-PorA mAb at a concentration of 0.15 ag/ml, which was identical to that of an anti-PorA mAb required for killing of the anti-fHbp susceptible 961-5945 strain. -
TABLE 5 Characteristics of N. meningitidis strains used for measuring serum bactericidal activity. Factor H-binding protein Expression Genbank Strain sequence clonal Variant Protein Modular (ng/106 accession name types complex group ID group cells) number H44/76 32 32 1 1 I 31 AY548370 03S-0408 11 11 1 78 I 3 ACF35432 SK104 5748 162 3 99 II 11 GQ219769 M1239 437 41/44 3 28 II 2 ABF82029 03S-0673 1364 32 2 23 III 14 GU056306 RM1090 11 11 2 22 III 2 ABY26518 NM452 283 269 1 15 IV 20 ABL14232 M01573 44 41/44 1 55 IV 1 AAR84481 S3032 6874 n/a 3 79 V 8 ACH48234 MD1475 162 162 3 82 V 7 GQ219772 961-5945 153 8 2 16 VI 5 AAR84453 NMB 8 8 2 50 VI 1 AY330379 - The antibodies used for the quantitative measurement of fHbp and the reactivity of various modular group proteins for each antibody is shown in the Table below.
-
TABLE 6 Anti-fHbp monoclonal antibody reactivity of recombinant proteins used to prepare antisera in relationship to locations of epitopes. JAR 3 orJAR 32Anti-fHbp mAb JAR1 JAR 4 JAR 5JAR 10JAR 11JAR 13JAR 31JAR 35JAR 33Epitope Amino R204 (25-27) G121, K180 A174 S216 Unk6 K174 R180 location acid YGN K122 and and residue(s) (57-59) E1924 E1924 KDN Modular Eα Aα Cα Dα and Dα Eβ UD6 Dβ Dβ and segment Eβ E β Modular Variant Protein Group Group ID No. Reactivity of Recombinant Protein by ELISA5 I 1 1 1 1 1 0 0 0 0 0 0 II 3 28 0 0 0 0 0 1 1 1 1 III 2 22 0 1 0 0 0 0 1 1 1 IV 1 15 0 0 1 0 0 0 0 0 0 V 3 79 0 0 0 1 1 1 1 0 0 VI 2 77 0 1 0 1 1 1 1 0 0 1All of the MAbs were bactericidal when tested in certain combinations with human complement 3Discontinuous epitope; presence of KDN suppresses epitope [1] 4Discontinuous epitope requiring specific combinations of charged residues 5Assigned “1” if Optical density >3 SD above background binding when tested at 1 μg/ml, “0”, negative. 6UD, location of epitope undetermined
Claims (23)
1. A non-naturally occurring fHbp of claim 1 , comprising, from N-terminus to C-terminus:
V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E,
V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E,
wherein the combination of alleles for each of VA, VB, VC, VD, and VE variable segments is not found in nature.
2. The non-naturally occurring fHbp of claim 1 , wherein each of said variable segments is an α progenitor sequence.
3. The non-naturally occurring fHbp of claim 1 , wherein each of said variable segments is a β progenitor sequence.
4. The non-naturally occurring fHbp of claim 1 ,
wherein at least one of VA, VB, VC, VD, and VE is of an α progenitor fHbp amino acid sequence and at least one of VA, VB, VC, VD, and VE is of an β progenitor fHbp amino acid sequence.
5. The non-naturally occurring fHbp of claim 4 , wherein said non-naturally occurring fHbp is not of a modular group Type as set forth in FIG. 8 .
6. The non-naturally occurring fHbp of claim 1 , where said non-naturally occurring fHbp comprises, from N-terminus to C-terminus:
I 1-Nte-I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E-I 7.
I 1-Nte-I 2-V A-I 3-V B-I 4-V C-I 5-V D-I 6-V E-I 7.
7. The non-naturally occurring fHbp of claim 1 , where said non-naturally occurring fHbp comprises, from N-terminus to C-terminus:
V Aα-I 3-V Bα-I 4-V Cα-I 5-V Dβ-I 6-V Eα or
V Aα-I 3-V Bα-I 4-V Cα-I 5-V Dβ-I 6-V Eβ.
V Aα-I 3-V Bα-I 4-V Cα-I 5-V Dβ-I 6-V Eα or
V Aα-I 3-V Bα-I 4-V Cα-I 5-V Dβ-I 6-V Eβ.
8. The non-naturally occurring fHbp of claim 1 , wherein said fHbp comprises an epitope that is bound by a monoclonal antibody set forth in Table 1.
9. A method of eliciting an antibody response in a mammal, the method comprising administering to a mammal a composition comprising a first non-naturally occurring fHbp according to claim 1 .
10. The method of claim 9 , wherein the mammal is a human.
11. The method of claim 9 , wherein said administering provides for production of antibodies that bind to two or more types of fHbp.
12. The method of claim 9 , wherein said non-naturally occurring fHbp is in a preparation comprising outer membrane vesicles (OMVs), microvesicles (MVs), or a mixture of OMVs and MVs.
13. The method of claim 12 , wherein said vesicles are prepared from two or more strains of N. meningitidis, each of which is genetically different from the other.
14. The method of claim 9 , wherein said administering comprises administering a second fHbp, wherein said second fHbp is different from said first non-naturally occurring fHbp.
15. An immunogenic composition comprising a first non-naturally occurring fHbp according to claim 1 , and a pharmaceutically acceptable excipient.
16. The immunogenic composition of claim 15 , further comprising a second fHbp, wherein said second fHbp is different from said first non-naturally occurring fHbp.
17. The immunogenic composition of claim 15 , wherein said non-naturally occurring fHbp is in a vesicle preparation, wherein vesicles are prepared from a Neisseria bacterium.
18. The immunogenic composition of claim 17 , wherein said Neisseria bacterium is genetically modified to disrupt production of an endogenous fHbp polypeptide.
19. The immunogenic composition of claim 15 , wherein said non-naturally occurring fHbp is produced by a Neisseria bacterium that is genetically modified to produce said fHbp.
20. The immunogenic composition of claim 18 , wherein said vesicle preparation is from the same Neisseria meningitidis strain as the strain producing said non-naturally occurring fHbp.
21. The immunogenic composition of claim 18 , wherein said Neisseria bacterium is deficient in capsular polysaccharide synthesis.
22. A nucleic acid encoding the non-naturally occurring fHbp of claim 1 .
23. A host cell containing the nucleic acid of claim 22 .
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/992,872 US20160235833A1 (en) | 2009-04-30 | 2016-01-11 | Chimeric Factor H Binding Proteins (fHBP) and Methods of Use |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17442409P | 2009-04-30 | 2009-04-30 | |
PCT/US2010/033048 WO2010127172A2 (en) | 2009-04-30 | 2010-04-29 | Chimeric factor h binding proteins (fhbp) and methods of use |
US201113259063A | 2011-12-13 | 2011-12-13 | |
US14/992,872 US20160235833A1 (en) | 2009-04-30 | 2016-01-11 | Chimeric Factor H Binding Proteins (fHBP) and Methods of Use |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2010/033048 Continuation WO2010127172A2 (en) | 2009-04-30 | 2010-04-29 | Chimeric factor h binding proteins (fhbp) and methods of use |
US13/259,063 Continuation US9266942B2 (en) | 2009-04-30 | 2010-04-29 | Chimeric factor H binding proteins (fHbp) and methods of use |
Publications (1)
Publication Number | Publication Date |
---|---|
US20160235833A1 true US20160235833A1 (en) | 2016-08-18 |
Family
ID=43032788
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/259,063 Expired - Fee Related US9266942B2 (en) | 2009-04-30 | 2010-04-29 | Chimeric factor H binding proteins (fHbp) and methods of use |
US14/992,872 Abandoned US20160235833A1 (en) | 2009-04-30 | 2016-01-11 | Chimeric Factor H Binding Proteins (fHBP) and Methods of Use |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/259,063 Expired - Fee Related US9266942B2 (en) | 2009-04-30 | 2010-04-29 | Chimeric factor H binding proteins (fHbp) and methods of use |
Country Status (10)
Country | Link |
---|---|
US (2) | US9266942B2 (en) |
EP (1) | EP2424563A4 (en) |
JP (2) | JP5883380B2 (en) |
CN (1) | CN102711814A (en) |
AU (1) | AU2010242905B2 (en) |
BR (1) | BRPI1013902A2 (en) |
CA (1) | CA2759400A1 (en) |
MX (1) | MX2011011512A (en) |
NZ (1) | NZ595361A (en) |
WO (1) | WO2010127172A2 (en) |
Families Citing this family (20)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
MX339524B (en) | 2001-10-11 | 2016-05-30 | Wyeth Corp | Novel immunogenic compositions for the prevention and treatment of meningococcal disease. |
WO2011126863A1 (en) | 2010-03-30 | 2011-10-13 | Children's Hospital & Research Center Oakland | Factor h binding proteins (fhbp) with altered properties and methods of use thereof |
EP3246044B2 (en) | 2010-08-23 | 2024-04-10 | Wyeth LLC | Stable formulations of neisseria meningitidis rlp2086 antigens |
ES2864635T3 (en) | 2010-09-10 | 2021-10-14 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
RU2014135522A (en) | 2012-02-02 | 2016-03-27 | Новартис Аг | Promoters for Enhanced Protein Expression at Meningococcus |
MY167723A (en) | 2012-03-09 | 2018-09-21 | Pfizer | Neisseria meningitidis compositions and methods thereof |
SA115360586B1 (en) | 2012-03-09 | 2017-04-12 | فايزر انك | Neisseria meningitidis compositions and methods thereof |
ES2685894T3 (en) | 2013-03-08 | 2018-10-15 | Pfizer Inc. | Immunogenic fusion polypeptides |
US9619444B2 (en) | 2013-03-15 | 2017-04-11 | International Business Machines Corporation | System and method for web content presentation management |
CN105431167A (en) | 2013-08-02 | 2016-03-23 | 奥克兰儿童医院及研究中心 | Non-naturally occurring factor h binding proteins (FHBP) and methods of use thereof |
WO2015033251A2 (en) | 2013-09-08 | 2015-03-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
CA3212723A1 (en) | 2014-07-23 | 2016-01-28 | Peter T. Beernink | Factor h binding protein variants and methods of use thereof |
US9616114B1 (en) | 2014-09-18 | 2017-04-11 | David Gordon Bermudes | Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity |
KR20190049940A (en) | 2015-02-19 | 2019-05-09 | 화이자 인코포레이티드 | Neisseria meningitidis compositions and methods thereof |
EP3838918B1 (en) * | 2015-05-18 | 2022-08-31 | BiOMVis Srl | Immunogenic compositions containing bacterial outer membrane vesicles and therapeutic uses thereof |
US11129906B1 (en) | 2016-12-07 | 2021-09-28 | David Gordon Bermudes | Chimeric protein toxins for expression by therapeutic bacteria |
US11180535B1 (en) | 2016-12-07 | 2021-11-23 | David Gordon Bermudes | Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria |
AU2018215585B2 (en) | 2017-01-31 | 2022-03-17 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
CN107823638B (en) * | 2017-11-05 | 2020-01-03 | 北京智飞绿竹生物制药有限公司 | Group B meningococcus recombinant chimeric protein vaccine and preparation method thereof |
CN115976088B (en) * | 2022-07-21 | 2023-09-19 | 深圳蓝晶生物科技有限公司 | Low endotoxin content eutrophic rogowski bacteria and application thereof |
Family Cites Families (15)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101293920B (en) | 1998-05-01 | 2012-07-18 | 诺华疫苗和诊断公司 | Neisseria meningitidis antigens and compositions |
IL142282A0 (en) * | 1998-10-16 | 2002-03-10 | Biogen Inc | Compositions containing polymer conjugates of interferon-beta-1a |
GB0121591D0 (en) | 2001-09-06 | 2001-10-24 | Chiron Spa | Hybrid and tandem expression of neisserial proteins |
GB0220194D0 (en) * | 2002-08-30 | 2002-10-09 | Chiron Spa | Improved vesicles |
GB0227346D0 (en) | 2002-11-22 | 2002-12-31 | Chiron Spa | 741 |
CA2512917A1 (en) * | 2003-01-15 | 2004-08-05 | Wyeth Holdings Corporation | Methods for increasing neisseria protein expression |
GB0419408D0 (en) | 2004-09-01 | 2004-10-06 | Chiron Srl | 741 chimeric polypeptides |
JP4993750B2 (en) * | 2005-01-27 | 2012-08-08 | チルドレンズ ホスピタル アンド リサーチ センター アット オークランド | Vesicular vaccine based on GNA1870 for broad protection against diseases caused by Neisseria meningitidis |
GB0524066D0 (en) | 2005-11-25 | 2006-01-04 | Chiron Srl | 741 ii |
US20100150912A1 (en) * | 2007-04-11 | 2010-06-17 | Novartis Ag | Blocking interaction between pathogen factors and factor h to inhibit hemorrhagic syndromes |
US20090035328A1 (en) | 2007-08-02 | 2009-02-05 | Dan Granoff | fHbp- AND LPXL1-BASED VESICLE VACCINES FOR BROAD SPECTRUM PROTECTION AGAINST DISEASES CAUSED BY NEISSERIA MENINGITIDIS |
CN102203276A (en) | 2008-08-27 | 2011-09-28 | 奥克兰儿童医院及研究中心 | Complement factor h-based assays for serum bactericidal activity against neisseria meningitidis |
CA2733943A1 (en) * | 2008-09-03 | 2010-03-11 | Children's Hospital & Research Center At Oakland | Peptides presenting an epitope of an a domain of factor h binding protein and methods of use |
GB0819633D0 (en) | 2008-10-25 | 2008-12-03 | Isis Innovation | Composition |
WO2011126863A1 (en) | 2010-03-30 | 2011-10-13 | Children's Hospital & Research Center Oakland | Factor h binding proteins (fhbp) with altered properties and methods of use thereof |
-
2010
- 2010-04-29 AU AU2010242905A patent/AU2010242905B2/en not_active Ceased
- 2010-04-29 CA CA2759400A patent/CA2759400A1/en not_active Abandoned
- 2010-04-29 BR BRPI1013902A patent/BRPI1013902A2/en not_active IP Right Cessation
- 2010-04-29 JP JP2012508750A patent/JP5883380B2/en not_active Expired - Fee Related
- 2010-04-29 EP EP10770375.3A patent/EP2424563A4/en not_active Withdrawn
- 2010-04-29 MX MX2011011512A patent/MX2011011512A/en active IP Right Grant
- 2010-04-29 WO PCT/US2010/033048 patent/WO2010127172A2/en active Application Filing
- 2010-04-29 NZ NZ595361A patent/NZ595361A/en not_active IP Right Cessation
- 2010-04-29 CN CN2010800192887A patent/CN102711814A/en active Pending
- 2010-04-29 US US13/259,063 patent/US9266942B2/en not_active Expired - Fee Related
-
2015
- 2015-10-05 JP JP2015197745A patent/JP2016040289A/en active Pending
-
2016
- 2016-01-11 US US14/992,872 patent/US20160235833A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
CA2759400A1 (en) | 2010-11-04 |
JP2016040289A (en) | 2016-03-24 |
CN102711814A (en) | 2012-10-03 |
US20120121637A1 (en) | 2012-05-17 |
WO2010127172A2 (en) | 2010-11-04 |
NZ595361A (en) | 2013-09-27 |
AU2010242905B2 (en) | 2014-10-23 |
AU2010242905A1 (en) | 2011-10-20 |
BRPI1013902A2 (en) | 2019-09-24 |
EP2424563A2 (en) | 2012-03-07 |
JP5883380B2 (en) | 2016-03-15 |
WO2010127172A3 (en) | 2012-10-04 |
EP2424563A4 (en) | 2013-10-30 |
US9266942B2 (en) | 2016-02-23 |
JP2012525151A (en) | 2012-10-22 |
MX2011011512A (en) | 2012-02-13 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9266942B2 (en) | Chimeric factor H binding proteins (fHbp) and methods of use | |
US10905754B2 (en) | Factor H binding proteins (fHbp) with altered properties and methods of use thereof | |
EP2265640B1 (en) | Chimeric factor h binding proteins (fhbp) containing a heterologous b domain and methods of use | |
US9914756B2 (en) | Non-naturally occurring factor H binding proteins (fHbp) and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |