US20160067351A1 - Specific sites for modifying antibodies to make immunoconjugates - Google Patents

Specific sites for modifying antibodies to make immunoconjugates Download PDF

Info

Publication number
US20160067351A1
US20160067351A1 US14/764,026 US201414764026A US2016067351A1 US 20160067351 A1 US20160067351 A1 US 20160067351A1 US 201414764026 A US201414764026 A US 201414764026A US 2016067351 A1 US2016067351 A1 US 2016067351A1
Authority
US
United States
Prior art keywords
antibody
light chain
positions
heavy chain
antibody fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/764,026
Inventor
Bernhard Hubert GEIERSTANGER
Weijia Ou
Tetsuo Uno
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis AG
Original Assignee
Novartis AG
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Novartis AG filed Critical Novartis AG
Priority to US14/764,026 priority Critical patent/US20160067351A1/en
Assigned to NOVARTIS INTERNATIONAL PHARMACEUTICAL LTD. reassignment NOVARTIS INTERNATIONAL PHARMACEUTICAL LTD. MERGER (SEE DOCUMENT FOR DETAILS). Assignors: IRM LLC
Assigned to NOVARTIS AG reassignment NOVARTIS AG ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: NOVARTIS INTERNATIONAL PHARMACEUTICAL LTD.
Publication of US20160067351A1 publication Critical patent/US20160067351A1/en
Assigned to NOVARTIS INSTITUTE FOR FUNCTIONAL GENOMICS, INC. reassignment NOVARTIS INSTITUTE FOR FUNCTIONAL GENOMICS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: OU, WEIJIA, GEIERSTANGER, Bernhard Hubert, UNO, TETSUO
Assigned to IRM LLC reassignment IRM LLC ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: NOVARTIS INSTITUTE FOR FUNCTIONAL GENOMICS, INC., DBA THE GENOMICS INSTITUTE OF THE NOVARTIS RESEARCH FOUNDATION (GNF)
Abandoned legal-status Critical Current

Links

Images

Classifications

    • A61K47/48646
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • A61K47/48384
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6871Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting an enzyme
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the invention provides specific sites for attaching moieties to antibodies for making modified antibodies, such as for use in preparation of antibody-drug conjugates (ADCs).
  • ADCs antibody-drug conjugates
  • the selective conjugation sites are located on constant regions of the antibody and thus are useful with various antibodies.
  • Heterogeneity of a pharmaceutical active ingredient is typically undesirable because it compounds the unpredictability of administering a drug to a heterogeneous population of subjects: it is far preferable to administer a homogeneous product, and far more difficult to fully characterize and predict behavior of a heterogeneous one.
  • Site-specific conjugation of a cytotoxic drug to an antibody through, for example, engineered cysteine residues results in homogenous immunoconjugates that exhibit improved therapeutic index (Junutula et al., (2008) Nat Biotechnol. 26(8):925-932)).
  • Antibodies have been engineered to add certain residues like cysteine in specific positions where these residues can be used for conjugation (Lyons et al., (1990) Protein Eng., 3:703-708), but the value of specific substitutions can vary with certain antibodies, as engineered cysteine might interfere with folding of the antibody and oxidation of the proper intra-molecular disulfide bonds (Voynov et al., (2010) Bioconjug. Chem. 21(2):385-392).
  • cysteines in antibodies expressed in mammalian cells are modified through disulfide bonds with glutathione (GSH) and/or cysteine during their biosynthesis (Chen et al. (2009) mAbs 1:6, 563-571)
  • the modified cysteine(s) in the antibody drug conjugate product as initially expressed is unreactive to thiol reactive reagents.
  • Activation of the engineered cysteine(s) requires reduction of the GSH and/or cysteine adduct (which typically results in reduction of all inter-chain disulfide bonds of the antibody), followed by reoxidation and reformation of the native, inter-chain disulfide bonds prior to conjugation (Junutula et al., (2008) Nat. Biotechnol.
  • site-specifically conjugated immunoconjugates can exhibit improved therapeutic index, thus there remains a need to identify specific privileged sites for cysteine substitution in antibodies that enables conjugation of payloads onto antibodies to form efficiently, and that provide conjugates having high stability.
  • the instant invention provides such privileged cysteine substitution sites that give improved antibodies for conjugation purposes and immunoconjugates comprising such improved antibodies.
  • the invention provides specific sites in the constant region of an antibody or antibody fragment at which cysteine (“Cys”) replacement of the native amino acid on a parental antibody or antibody fragment can be performed in order to provide a Cys residue for attachment of a chemical moiety (e.g., payload/drug moiety) to form an immunoconjugate with good efficiency and stability.
  • Cys cysteine
  • the invention further provides engineered antibodies or antibody fragments having one or more Cys residues in one or more of these specific sites, as well as immunoconjugates made from such engineered antibodies or antibody fragments.
  • the specific privileged sites for Cys replacement of native amino acids in the constant region of a parental antibody or antibody fragment are selected to provide efficient conjugation while minimizing undesired effects.
  • the specific sites for modification are selected so that replacing the native amino acid of a parental antibody or antibody fragment with Cys in one or more of the selected locations provides antibodies or antibody fragments that are readily conjugated on the new cysteine.
  • the specific locations are selected to be sufficiently surface-accessible to allow the sulfhydryl of the cysteine residue to be reactive towards electrophiles in aqueous solutions.
  • the identification of suitable sites for Cys replacement of native amino acids of a parental antibody or antibody fragment involved analyzing surface exposure of the native amino acids based on crystal structure data. Because the sites described herein are sufficiently accessible and reactive, they can be used to form immunoconjugates via chemistry that is well known in the art for modifying naturally-occurring cysteine residues. Conjugation of the replacement Cys residues thus uses conventional methods.
  • Selected modification sites can show a low propensity for reversal of conjugation when thiol-maleimide moieties are used in the conjugation.
  • the thiol-maleimide conjugation reaction is often highly selective and extremely efficient, and may be used either to attach a payload to the thiol of a cysteine residue of a protein or as a linker elsewhere in the linkage between protein and payload.
  • a maleimide can be attached to a protein (e.g., an antibody or antibody fragment), and a payload having an attached thiol can be added to the maleimide to form a conjugate:
  • the protein e.g., an antibody or antibody fragment
  • the immunoconjugate stability information specifically relates to conjugation of the substituted cysteine by reaction with a maleimide group.
  • the thiol is from a cysteine on the protein (e.g., an antibody or antibody fragment), so the double circle represents the protein and the single circle represents a payload.
  • the identification of the advantageous sites for meeting this criterion involved inserting Cys in place of many of the native amino acids having suitable surface exposure, making immunoconjugates containing a thiol-maleimide linkage, and assessing stability of the immunoconjugate in order to eliminate sites where the stability of the conjugate was reduced by the local microenvironment around destabilizing sites. Because of this, the chemistry that can be used to attach linkers and payloads to the replacement Cys residues is not limited by the stability problems associated with the reversibility of thiol-maleimide conjugates that is discussed above. A number of methods can be used to form conjugates at cysteine, including maleimide conjugation.
  • Selected sites can be positioned so as to minimize undesired disulfide formation that may interfere with formation of a homogeneous conjugate.
  • the Cys residues are typically present as disulfides to a free Cys amino acid or to glutathione (Chen et al., (2009) mAbs 16, 353-571).
  • the antibody or antibody fragment needs to be reduced, breaking all of the disulfide bonds. The antibody or antibody fragment is then reoxidized under conditions that facilitate formation of the native disulfides that stabilize the antibody or antibody fragment.
  • cysteine residues that are too prominently exposed on the surface of the antibody or antibody fragment can form disulfides by reaction with Cys on another antibody or antibody fragment (“inter-antibody disulfides”), or by forming undesired intra-antibody disulfides. It has been found that cysteine residues placed in the specific sites described herein are suitably accessible to be available for efficient conjugation, but are sufficiently shielded or suitably positioned to reduce or eliminate formation of inter-antibody and intra-antibody disulfide bonds that would otherwise occur during the reduction/reoxidation procedures typically needed when expressing cys-modified antibodies. Similarly, after re-oxidation some sites were found to produce non-homogenous conjugation products that appear to be due to the location of the new Cys residue engineered into the protein, and the specific sites identified herein are ones where such heterogeneity is minimized.
  • Conjugating drug payloads at sites where they are sequestered from solvent interactions and attachment can increase the hydrophobicity of the antibody upon drug attachment is preferred as reducing hydrophobicity of a protein drug is generally considered beneficial because it might reduce aggregation and clearance from circulation. Selecting attachment sites that result in minimal changes in hydrophobicity might be particularly beneficial when 4, 6 or 8 drugs are attached per antibody, or when particularly hydrophobic payloads are used.
  • Cysteine substitution sites are located in the constant region of an antibody or antibody fragment, and are identified herein using standard numbering conventions. It is well known, however, that portions or fragments of antibodies can be used for many purposes instead of intact full-length antibodies, and also that antibodies can be modified in various ways that affect numbering of sites in the constant region even though they do not substantially affect the functioning of the constant region. For example, insertion of an S6 tag (a short peptide) into a loop region of an antibody has been shown to allow activity of the antibody to be retained, even though it would change the numbering of many sites in the antibody.
  • cysteine substitution sites described herein are identified by a standard numbering system based on intact antibody numbering
  • the invention includes the corresponding sites in antibody fragments or in antibodies containing other modifications, such as peptide tag insertion.
  • the corresponding sites in those fragments or modified antibodies are thus preferred sites for cysteine substitution in fragments or modified antibodies, and references to the cysteine substitution sites by number include corresponding sites in modified antibodies or antibody fragments that retain the function of the relevant portion of the full-length antibody.
  • a corresponding site in an antibody fragment or modified antibody can readily be identified by aligning a segment of the antibody fragment or modified antibody with the full-length antibody to identify the site in the antibody fragment or modified antibody that matches one of the preferred cysteine substitution sites of the invention.
  • Alignment may be based on a segment long enough to ensure that the segment matches the correct portion of the full-length antibody, such as a segment of at least 20 amino acid residues, or at least 50 residues, or at least 100 residues, or at least 150 residues. Alignment may also take into account other modifications that may have been engineered into the antibody fragment or modified antibody, thus differences in sequence due to engineered point mutations in the segment used for alignment, particularly for conservative substitutions, would be allowed.
  • an Fc domain can be excised from an antibody, and would contain amino acid residues that correspond to the cysteine substitution sites described herein, despite numbering differences: sites in the Fc domain corresponding to the cysteine substitution sites of the invention would also be expected to be advantageous sites for cysteine substation in the Fc domain, and are included in the scope of the invention.
  • the invention provides an immunoconjugate of Formula (I):
  • Ab represents an antibody or antibody fragment comprising at least one cysteine residue at one of the preferred cysteine substitution sites described herein;
  • LU is a linker unit as described herein;
  • X is a payload or drug moiety
  • n is an integer from 1 to 16.
  • LU is attached to a cysteine at one of the cysteine substitution sites described herein,
  • X is a drug moiety such as an anticancer drug, and
  • n is 2-8 when Ab is an antibody, or n can be 1-8 when Ab is an antibody fragment.
  • the invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system.
  • the invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is human kappa light chain.
  • the invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 143, 147, 159, 163, and 168 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
  • the invention provides a modified antibody or antibody fragment thereof comprising a substitution of one or more amino acids with cysteine at the positions described herein.
  • the sites for cysteine substitution are in the constant regions of the antibody and are thus applicable to a variety of antibodies, and the sites are selected to provide stable and homogeneous conjugates.
  • the modified antibody or fragment can have two or more cysteine substitutions, and these substitutions can be used in combination with other antibody modification and conjugation methods as described herein.
  • the invention provides pharmaceutical compositions comprising the immunoconjugate disclosed above, and methods to use the immunoconjugates.
  • the invention provides a nucleic acid encoding the modified antibody or antibody fragment described herein having at least one cysteine substitution at a site described herein.
  • the invention further provides host cells comprising these nucleic acids and methods to use the nucleic acid or host cells to express and produce the antibodies or fragments described herein.
  • the invention provides a method to select an amino acid of an antibody that is suitable for replacement by cysteine to provide a good site for conjugation, comprising:
  • the method further comprises a step of determining the melting temperature for the conjugate of each advantaged cysteine substitution site, and eliminating from the set any sites where cysteine substitution and conjugation causes the melting temperature to differ by 5° C. or more from that of the native antibody.
  • the invention provides a method to produce an immunoconjugate, which comprises attaching a Linker Unit (LU) or a Linker Unit-Payload combination (-LU-X) to a cysteine residue in an antibody or antibody fragment, wherein the cysteine is located at a cysteine substitution site selected from 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of a heavy chain of said antibody or antibody fragment, and positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system.
  • LU Linker Unit
  • -LU-X Linker Unit-Payload combination
  • amino acid refers to canonical, synthetic, and unnatural amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the canonical amino acids.
  • Canonical amino acids are proteinogenous amino acids encoded by the genetic code and include alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline serine, threonine, tryptophan, tyrosine, valine, as well as selenocysteine, pyrrolysine and its analog pyrroline-carboxy-lysine.
  • Amino acid analogs refer to compounds that have the same basic chemical structure as a canonical amino acid, i.e., an ⁇ -carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., citrulline, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
  • Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a canonical amino acid.
  • Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a canonical amino acid.
  • the term “unnatural amino acid”, as used herein, is intended to represent amino acid structures that cannot be generated biosynthetically in any organism using unmodified or modified genes from any organism, whether the same or different.
  • such “unnatural amino acids” typically require a modified tRNA and a modified tRNA synthetase (RS) for incorporation into a protein. This tRNA/RS pair preferentially incorporates the unnatural amino acid over canonical amino acids.
  • Such orthogonal tRNA/RS pair is generated by a selection process as developed by Schultz et al.
  • unnatural amino acid does not include the natural occurring 22 nd proteinogenic amino acid pyrrolysine (Pyl) as well as its demethylated analog pyrroline-carboxy-lysine (Pcl), because incorporation of both residues into proteins is mediated by the unmodified, naturally occurring pyrrolysyl-tRNA/tRNA synthetase pair and because Pyl and Pcl are generated biosynthetically (see, e.g., Ou et al., (2011) Proc. Natl. Acad. Sci.
  • antibody refers to a polypeptide of the immunoglobulin family that is capable of binding a corresponding antigen non-covalently, reversibly, and in a specific manner.
  • a naturally occurring IgG antibody is a tetramer comprising at least two heavy (H) chains (also referred to as “antibody heavy chain”) and two light (L) chains (also referred to as “antibody light chain”) inter-connected by disulfide bonds.
  • H heavy
  • L light
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as V H ) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
  • the light chain constant region is comprised of one domain, C L .
  • the V H and V L regions can be further subdivided into regions of hyper variability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each V H and V L is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq
  • antibody includes, but is not limited to, monoclonal antibodies, human antibodies, humanized antibodies, camelid antibodies, chimeric antibodies, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention).
  • the antibodies can be of any isotype/class (e.g., IgG, IgE, IgM, IgD, IgA and IgY), or subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2).
  • variable domains of both the light (V L ) and heavy (V H ) chain portions determine antigen recognition and specificity.
  • the constant domains of the light chain (C L ) and the heavy chain (CH1, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like.
  • the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino-terminus of the antibody.
  • the N-terminus is a variable region and at the C-terminus is a constant region; the CH3 and C L domains actually comprise the carboxy-terminal domains of the heavy and light chain, respectively.
  • antibody fragment refers to either an antigen binding fragment of an antibody or a non-antigen binding fragment (e.g., Fc) of an antibody.
  • antigen binding fragment refers to one or more portions of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen.
  • binding fragments include, but are not limited to, single-chain Fvs (scFv), disulfide-linked Fvs (sdFv), Fab fragments, F(ab′) fragments, a monovalent fragment consisting of the V L , V H , C L and CH1 domains; a F(ab) 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the V H and CH1 domains; a Fv fragment consisting of the V L and V H domains of a single arm of an antibody; a dAb fragment (Ward et al., Nature 341:544-546, 1989), which consists of a V H domain; and an isolated complementarity determining region (CDR), or other epitope-binding fragments of an antibody.
  • scFv single-chain Fvs
  • sdFv disulfide-linked Fvs
  • Fab fragments F(
  • the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (“scFv”); see, e.g., Bird et al., Science 242:423-426, 1988; and Huston et al., Proc. Natl. Acad. Sci. 85:5879-5883, 1988).
  • single chain Fv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term “antigen binding fragment.” These antigen binding fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
  • Antigen binding fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005).
  • Antigen binding fragments can be grafted into scaffolds based on polypeptides such as fibronectin type III (Fn3) (see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies).
  • Fn3 fibronectin type III
  • Antigen binding fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (V H -CH1-V H -CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. 8:1057-1062, 1995; and U.S. Pat. No. 5,641,870).
  • monoclonal antibody or “monoclonal antibody composition” as used herein refers to polypeptides, including antibodies and antibody fragments that have substantially identical amino acid sequence or are derived from the same genetic source. This term also includes preparations of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • human antibody includes antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et al., J. Mol. Biol. 296:57-86, 2000).
  • the human antibodies of the invention may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing).
  • humanized antibody refers to an antibody that retains the reactivity of a non-human antibody while being less immunogenic in humans. This can be achieved, for instance, by retaining the non-human CDR regions and replacing the remaining parts of the antibody with their human counterparts. See, e.g., Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984); Morrison and Oi, Adv. Immunol., 44:65-92 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988); Padlan, Molec. Immun., 28:489-498 (1991); Padlan, Molec. Immun., 31(3):169-217 (1994).
  • epitopes refers to an antibody or antigen binding fragment thereof that finds and interacts (e.g., binds) with its epitope, whether that epitope is linear or conformational.
  • epitope refers to a site on an antigen to which an antibody or antigen binding fragment of the invention specifically binds.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
  • Methods of determining spatial conformation of epitopes include techniques in the art, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
  • affinity refers to the strength of interaction between antibody and antigen at single antigenic sites. Within each antigenic site, the variable region of the antibody “arm” interacts through weak non-covalent forces with antigen at numerous sites; the more interactions, the stronger the affinity.
  • isolated antibody refers to an antibody that is substantially free of other antibodies having different antigenic specificities.
  • An isolated antibody that specifically binds to one antigen may, however, have cross-reactivity to other antigens.
  • an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • conservatively modified variant refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
  • TGG which is ordinarily the only codon for tryptophan
  • “conservatively modified variants” include individual substitutions, deletions or additions to a polypeptide sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
  • the following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
  • the term “conservative sequence modifications” are used to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence.
  • the term “optimized” as used herein refers to a nucleotide sequence has been altered to encode an amino acid sequence using codons that are preferred in the production cell or organism, generally a eukaryotic cell, for example, a yeast cell, a Pichia cell, a fungal cell, a Trichoderma cell, a Chinese Hamster Ovary cell (CHO) or a human cell.
  • the optimized nucleotide sequence is engineered to retain completely or as much as possible the amino acid sequence originally encoded by the starting nucleotide sequence, which is also known as the “parental” sequence.
  • percent identical in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same.
  • Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
  • the identity exists over a region that is at least about 30 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, Adv. Appl. Math. 2:482c (1970), by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol.
  • BLAST and BLAST 2.0 algorithms Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402, 1977; and Altschul et al., J. Mol. Biol. 215:403-410, 1990, respectively.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra).
  • initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
  • the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always ⁇ 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: The cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787, 1993).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • the percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci. 4:11-17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch, J. Mol. Biol.
  • nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below.
  • a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
  • Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below.
  • Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
  • nucleic acid is used herein interchangeably with the term “polynucleotide” and refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form.
  • the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides.
  • Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
  • nucleic acid sequence also implicitly encompasses silent variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
  • degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., (1991) Nucleic Acid Res. 19:5081; Ohtsuka et al., (1985) J. Biol. Chem. 260:2605-2608; and Rossolini et al., (1994) Mol. Cell. Probes 8:91-98).
  • operably linked in the context of nucleic acids refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence.
  • a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system.
  • promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting.
  • some transcriptional regulatory sequences, such as enhancers need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
  • polypeptide and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to canonical amino acid polymers as well as to non-canonical amino acid polymers. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.
  • immunoconjugate or “antibody conjugate” as used herein refers to the linkage of an antibody or an antibody fragment thereof with another agent, such as a chemotherapeutic agent, a toxin, an immunotherapeutic agent, an imaging probe, a spectroscopic probe, and the like.
  • the linkage can be through one or multiple covalent bonds, or non-covalent interactions, and can include chelation.
  • linkers many of which are known in the art, can be employed in order to form the immunoconjugate.
  • the immunoconjugate can be provided in the form of a fusion protein that may be expressed from a polynucleotide encoding the immunoconjugate.
  • fusion protein refers to proteins created through the joining of two or more genes or gene fragments which originally coded for separate proteins (including peptides and polypeptides). Fusion proteins may be created by joining at the N- or C-terminus, or by insertions of genes or gene fragments into permissible regions of one of the partner proteins. Translation of the fusion gene results in a single protein with functional properties derived from each of the original proteins.
  • subject includes human and non-human animals.
  • Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, and reptiles. Except when noted, the terms “patient” or “subject” are used herein interchangeably.
  • cytotoxin refers to any agent that is detrimental to the growth and proliferation of cells and may act to reduce, inhibit, or destroy a cell or malignancy.
  • anti-cancer agent refers to any agent that can be used to treat a cell proliferative disorder such as cancer, including but not limited to, cytotoxic agents, chemotherapeutic agents, radiotherapy and radiotherapeutic agents, targeted anti-cancer agents, and immunotherapeutic agents.
  • drug moiety or “payload” are used interchangeably and refers to a chemical moiety that is conjugated to the antibody or antibody fragment of the invention, and can include any moiety that is useful to attach to an antibody or antibody fragment.
  • a drug moiety or payload can be an anti-cancer agent, an anti-inflammatory agent, an antifungal agent, an antibacterial agent, an anti-parasitic agent, an anti-viral agent, an anesthetic agent.
  • a drug moiety is selected from a V-ATPase inhibitor, a HSP90 inhibitor, an IAP inhibitor, an mTor inhibitor, a microtubule stabilizer, a microtubule destabilizers, an auristatin, a dolastatin, a maytansinoid, a MetAP (methionine aminopeptidase), an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor, an inhibitor of phosphoryl transfer reactions in mitochondria, a protein synthesis inhibitor, a kinase inhibitor, a CDK2 inhibitor, a CDK9 inhibitor, a proteasome inhibitor, a kinesin inhibitor, an HDAC inhibitor, a DNA damaging agent, a DNA alkylating agent, a DNA intercalator, a DNA minor groove binder and a DHFR inhibitor.
  • a MetAP methionine aminopeptidase
  • an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor an inhibitor of phosphoryl transfer reactions in mitochondria
  • Suitable examples include auristatins such as MMAE and MMAF; calicheamycins such as gamma-calicheamycin; and maytansinoids such as DM1 and DM4.
  • auristatins such as MMAE and MMAF
  • calicheamycins such as gamma-calicheamycin
  • maytansinoids such as DM1 and DM4.
  • a payload can be a biophysical probe, a fluorophore, a spin label, an infrared probe an affinity probe, a chelator, a spectroscopic probe, a radioactive probe, a lipid molecule, a polyethylene glycol, a polymer, a spin label, DNA, RNA, a protein, a peptide, a surface, an antibody, an antibody fragment, a nanoparticle, a quantum dot, a liposome, a PLGA particle, a saccharide or a polysaccharide, a reactive functional group, or a binding agent that can connect the conjugate to another moiety, surface, etc.
  • drug antibody ratio refers to the number or payload or drug moieties linked to an antibody of the immunoconjugate.
  • a drug antibody of ratio of 2 means that average of two drug moieties bound to an each antibody in a sample of immunoconjugates.
  • the DAR in a sample of immunoconjugates can be “homogenous”.
  • a “homogenous conjugation sample” is a sample with a narrow distribution of DAR.
  • a homogenous conjugation sample having a DAR of 2 can contain within that sample antibodies that are not conjugated, and some antibodies having more than two moieties conjugated at about a DAR of two.
  • “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to two moieties.
  • a homogenous conjugation sample having a DAR of 4 can contain within that sample antibodies that have more or fewer than four moieties conjugated at about a DAR of four.
  • “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to four moieties.
  • in a homogenous conjugation sample having a DAR of 6 can contain within that sample antibodies that are have more or fewer than six moieties conjugated at about a DAR of six.
  • “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to six moieties.
  • a homogenous conjugation sample having a DAR of 8 can contain within that sample antibodies that has some antibodies having fewer or more than eight moieties conjugated at about a DAR of four. “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to eight moieties.
  • An immunoconjugate having a “drug antibody ratio of about 2” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 1.6-2.4 moieties/antibody, 1.8-2.3 moieties/antibody, or 1.9-2.1 moieties/antibody.
  • An immunoconjugate having a “drug antibody ratio of about 4” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 3.6-4.4 moieties/antibody, 3.8-4.3 moieties/antibody, or 3.9-4.1 moieties/antibody.
  • An immunoconjugate having a “drug antibody ratio of about 6” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 5.6-6.4 moieties/antibody, 5.8-6.3 moieties/antibody, or 5.9-6.1 moieties/antibody.
  • An immunoconjugate having a “drug antibody ratio of about 8” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 7.6-84 moieties/antibody, 7.8-8.3 moieties/antibody, or 7.9-8.1 moieties/antibody.
  • Tumor refers to neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • anti-tumor activity means a reduction in the rate of tumor cell proliferation, viability, or metastatic activity.
  • a possible way of showing anti-tumor activity is to show a decline in growth rate of abnormal cells that arises during therapy or tumor size stability or reduction.
  • Such activity can be assessed using accepted in vitro or in vivo tumor models, including but not limited to xenograft models, allograft models, MMTV models, and other known models known in the art to investigate anti-tumor activity.
  • malignancy refers to a non-benign tumor or a cancer.
  • cancer includes a malignancy characterized by deregulated or uncontrolled cell growth.
  • Exemplary cancers include: carcinomas, sarcomas, leukemias, and lymphomas.
  • cancer includes primary malignant tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original tumor) and secondary malignant tumors (e.g., those arising from metastasis, the migration of tumor cells to secondary sites that are different from the site of the original tumor).
  • primary malignant tumors e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original tumor
  • secondary malignant tumors e.g., those arising from metastasis, the migration of tumor cells to secondary sites that are different from the site of the original tumor.
  • an optical isomer or “a stereoisomer” refers to any of the various stereo isomeric configurations which may exist for a given compound of the present invention and includes geometric isomers. It is understood that a substituent may be attached at a chiral center of a carbon atom.
  • the term “chiral” refers to molecules which have the property of non-superimposability on their mirror image partner, while the term “achiral” refers to molecules which are superimposable on their mirror image partner. Therefore, the invention includes enantiomers, diastereomers or racemates of the compound. “Enantiomers” are a pair of stereoisomers that are non-superimposable mirror images of each other.
  • a 1:1 mixture of a pair of enantiomers is a “racemic” mixture.
  • the term is used to designate a racemic mixture where appropriate.
  • “Diastereoisomers” are stereoisomers that have at least two asymmetric atoms, but which are not mirror-images of each other.
  • the absolute stereochemistry is specified according to the Cahn-Ingold-Prelog R-S system. When a compound is a pure enantiomer the stereochemistry at each chiral carbon may be specified by either R or S.
  • Resolved compounds whose absolute configuration is unknown can be designated (+) or ( ⁇ ) depending on the direction (dextro- or levorotatory) which they rotate plane polarized light at the wavelength of the sodium D line.
  • Certain compounds described herein contain one or more asymmetric centers or axes and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)-.
  • the compounds can be present in the form of one of the possible isomers or as mixtures thereof, for example as pure optical isomers, or as isomer mixtures, such as racemates and diastereoisomer mixtures, depending on the number of asymmetric carbon atoms.
  • the present invention is meant to include all such possible isomers, including racemic mixtures, diasteriomeric mixtures and optically pure forms.
  • Optically active (R)- and (S)-isomers may be prepared using chiral synthons or chiral reagents, or may be resolved using conventional techniques. If the compound contains a double bond, the substituent may be E or Z configuration. If the compound contains a disubstituted cycloalkyl, the cycloalkyl substituent may have a cis- or trans-configuration. All tautomeric forms are also intended to be included.
  • salt refers to an acid addition or base addition salt of a compound of the invention.
  • Salts include in particular “pharmaceutical acceptable salts”.
  • pharmaceutically acceptable salts refers to salts that retain the biological effectiveness and properties of the compounds of this invention and, which typically are not biologically or otherwise undesirable.
  • the compounds of the present invention are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.
  • Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids, e.g., acetate, aspartate, benzoate, besylate, bromide/hydrobromide, bicarbonate/carbonate, bisulfate/sulfate, camphorsulfonate, chloride/hydrochloride, chlorotheophyllinate, citrate, ethandisulfonate, fumarate, gluceptate, gluconate, glucuronate, hippurate, hydroiodide/iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulfate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate/hydrogen phosphate/dihydr
  • Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, sulfosalicylic acid, and the like.
  • Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.
  • Inorganic bases from which salts can be derived include, for example, ammonium salts and metals from columns I to XII of the periodic table.
  • the salts are derived from sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, and copper; particularly suitable salts include ammonium, potassium, sodium, calcium and magnesium salts.
  • Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like.
  • Certain organic amines include isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine and tromethamine.
  • the pharmaceutically acceptable salts of the present invention can be synthesized from a basic or acidic moiety, by conventional chemical methods.
  • such salts can be prepared by reacting free acid forms of these compounds with a stoichiometric amount of the appropriate base (such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate or the like), or by reacting free base forms of these compounds with a stoichiometric amount of the appropriate acid.
  • a stoichiometric amount of the appropriate base such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate or the like
  • Such reactions are typically carried out in water or in an organic solvent, or in a mixture of the two.
  • use of non-aqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile is desirable, where practicable.
  • any formula given herein is also intended to represent unlabeled forms as well as isotopically labeled forms of the compounds.
  • Isotopically labeled compounds have structures depicted by the formulas given herein except that one or more atoms are replaced by an atom having a selected atomic mass or mass number.
  • isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as 2 H, 3 H, 11 C, 13 C, 14 C, 15 N, 18 F 31 P, 32 P, 35 S, 36 Cl, 125 I respectively.
  • the invention includes various isotopically labeled compounds as defined herein, for example those into which radioactive isotopes, such as 3 H and 14 C, or those into which non-radioactive isotopes, such as 2 H and 13 C are present.
  • isotopically labeled compounds are useful in metabolic studies (with 14 C), reaction kinetic studies (with, for example 2 H or 3 H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients.
  • PET positron emission tomography
  • SPECT single-photon emission computed tomography
  • an 18 F or labeled compound may be particularly desirable for PET or SPECT studies.
  • Isotopically-labeled compounds of formula (I) can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using an appropriate isotopically-labeled reagents in place of the non-labeled reagent previously employed.
  • isotopic enrichment factor means the ratio between the isotopic abundance and the natural abundance of a specified isotope.
  • a substituent in a compound of this invention is denoted deuterium, such compound has an isotopic enrichment factor for each designated deuterium atom of at least 3500 (52.5% deuterium incorporation at each designated deuterium atom), at least 4000 (60% deuterium incorporation), at least 4500 (67.5% deuterium incorporation), at least 5000 (75% deuterium incorporation), at least 5500 (82.5% deuterium incorporation), at least 6000 (90% deuterium incorporation), at least 6333.3 (95% deuterium incorporation), at least 6466.7 (97% deuterium incorporation), at least 6600 (99% deuterium incorporation), or at least 6633.3 (99.5% deuterium incorporation).
  • the term “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drug stabilizers, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, and the like and combinations thereof, as would be known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.
  • a therapeutically effective amount of a compound of the present invention refers to an amount of the compound of the present invention that will elicit the biological or medical response of a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, slow or delay disease progression, or prevent a disease, etc.
  • the term “a therapeutically effective amount” refers to the amount of a compound of the present invention that, when administered to a subject, is effective to at least partially alleviate, inhibit, prevent and/or ameliorate a condition, or a disorder or a disease, or at least partially inhibit activity of a targeted enzyme or receptor.
  • the term “inhibit”, “inhibition” or “inhibiting” refers to the reduction or suppression of a given condition, symptom, or disorder, or disease, or a significant decrease in the baseline activity of a biological activity or process.
  • the term “treat”, “treating” or “treatment” of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof).
  • “treat”, “treating” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient.
  • “treat”, “treating” or “treatment” refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both.
  • “treat”, “treating” or “treatment” refers to preventing or delaying the onset or development or progression of the disease or disorder.
  • a subject is “in need of” a treatment if such subject would benefit biologically, medically or in quality of life from such treatment.
  • thiol-maleimide as used herein describes a group formed by reaction of a thiol with maleimide, having this general formula
  • Y and Z are groups to be connected via the thiol-maleimide linkage and can be linker units, and can be attached to antibodies or payloads.
  • Y is an engineered antibody according to the invention, and the sulfur atom shown in the formula is from a cysteine at one of the substitution sites described herein; while Z represents a linker unit connected to a payload.
  • Linker Unit refers to a covalent chemical connection between two moieties, such as an antibody and a payload.
  • Each LU can be comprised of one or more components described herein as L 1 , L 2 , L 3 , L 4 , L 5 and L 6 .
  • the linker unit can be selected to provide suitable spacing between the connected moieties, or to provide certain physicochemical properties, or to allow cleavage of the linker unit under certain conditions.
  • “Cleavable” as used herein refers to a linker or linker unit (LU) that connects two moieties by covalent connections, but breaks down to sever the covalent connection between the moieties under physiological conditions. Cleavage may be enzymatic or non-enzymatic, but generally releases a payload from an antibody without degrading the antibody.
  • Non-cleavable refers to a linker or linker unit (LU) that is not susceptible to breaking down under physiological conditions. While the linker may be modified physiologically, it keeps the payload connected to the antibody until the antibody is substantially degraded, i.e., the antibody degradation precedes cleavage of the linker in vivo.
  • Cyclooctyne refers to an 8-membered ring containing a carbon-carbon triple bond (acetylene).
  • the ring is optionally fused to one or two phenyl rings, which may be substituted with 1-4 C 1-4 alkyl, C 1-4 alkoxy, halo, hydroxyl, COOH, COOL 1 , —C(O)NH-L 1 , O-L 1 , or similar groups, and which may contain N, O or S as a ring member.
  • cyclooctyne can be a C 8 hydrocarbon ring, particularly an isolated ring that is saturated aside from the triple bond, and may be substituted with F or Hydroxy, and may be linked to a linker or LU via —O—, —C(O), C(O)NH, or C(O)O.
  • Cyclooctene refers to an 8-membered ring containing at least one double bond, especially a trans-double bond.
  • the ring is optionally fused to one or two phenyl rings, which may be substituted with 1-4 C 1-4 alkyl, C 1-4 alkoxy, halo, hydroxyl, COOH, COOL 1 , —C(O)NH-L 1 , O-L 1 , or similar groups, and which may contain N, O or S as a ring member.
  • cyclooctene can be an isolated C 8 hydrocarbon ring that is saturated aside from the trans double bond and is optionally substituted with F or Hydroxy, and may be linked to a linker or LU via —O—, —C(O), C(O)NH, or C(O)O.
  • FIG. 1 Surface accessibility plot of amino acid residues in human IgG1 heavy chain (A) and kappa light chain (B). Surface accessibility was calculated using Surface Racer 5.0 and is expressed as Angstrom square [ ⁇ 2 ].
  • FIG. 2 Location of selected 92 TAG mutations in the structure of a human IgG1 with a kappa light chain. Selected residues for TAG mutations are shown in black on only one of the two heavy chains and for one of the two kappa light chains (1HZH.pdb). Structures are shown using PyMOL, an open-source molecular modeling package (The PyMOL Molecular Graphics System, Version 1.5.0. Schrödinger. LLC).
  • FIG. 3 The amino acid sequence alignment of the heavy chain constant regions of trastuzumab and antibody 14090. Residues mutated to Cys in the trastuzumab antibody and in antibody 14090 are underlined. Amino acid residues in heavy chain are numbered by Eu numbering system (Edelman et al., 1969).
  • FIG. 4 Amino acid sequence alignment of constant regions of trastuzumab, human IgG1, IgG2, IgG3 and IgG4.
  • FIG. 5 The amino acid sequence alignment of the constant regions of human kappa and lambda light chains.
  • FIG. 6 Analysis of trastuzumab Cys antibodies by non-reducing SDS-PAGE.
  • FIG. 7 Size exclusion chromatography of the trastuzumab LC-S156C mutant antibody (dashed line) and wild-type trastuzumab (solid line).
  • FIG. 8 Analysis of wild-type trastuzumab (A) and the trastuzumab LC-E158C mutant antibody (B) by reverse phase high pressure liquid chromatography (RP-HPLC).
  • FIG. 9 MS analysis of trastuzumab LC-R108C mutant antibody after Protein A purification (intact MS).
  • FIG. 10 Structure of MC-MMAF.
  • FIG. 11 Analysis of conjugation mixtures of trastuzumab Cys antibodies with MC-MMAF by RP-HPLC.
  • RP-HPLC traces of the conjugation mixtures are shown as dashed lines.
  • RP-HPLC traces of unmodified antibodies are shown as solid lines.
  • FIG. 12 Analysis of conjugation mixtures of trastuzumab Cys antibodies with MC-MMAF by RP-HPLC.
  • RP-HPLC traces of the conjugation mixtures are shown as dashed lines.
  • RP-HPLC traces of unmodified antibodies are shown as solid lines.
  • FIG. 13 Analysis of trastuzumab Cys-MMAF ADCs by analytical size-exclusion chromatography (AnSEC).
  • Trastuzumab HC-K290C-MMAF ADC short dashed line
  • trastuzumab LC-R142C-MMAF ADC dashed line
  • trastuzumab LC-L154C-MMAF ADC dotted line
  • solid line unmodified wild-type trastuzumab
  • FIG. 14 Thermal melting curve of unmodified wild-type trastuzumab and trastuzumab HC-T335C-MMAF, trastuzumab HC-S337C-MMAF and trastuzumab HC-K360C-MMAF ADCs.
  • FIG. 15 Cell proliferation assays for trastuzumab LC-S159C-MMAF with A. HCC1954, B. MDA-MB231 clone 16 and C. MDA-MB231 clone 40 cells.
  • FIG. 16 IC 50 of trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16 cell proliferation assay.
  • FIG. 17 Cell proliferation assays for Antibody 14090 HC-S375C-MMAF ADC with A. CMK11-5 and B. Jurkat cells.
  • FIG. 18 Pharmacokinetics study of trastuzumab LC-Cys-MMAF ADCs displaying no significant drug lost.
  • FIG. 19 Pharmacokinetics study of trastuzumab HC-Cys-MMAF ADCs displaying no significant drug lost.
  • FIG. 20 Pharmacokinetics study of trastuzumab Cys-MMAF ADCs displaying significant drug lost.
  • FIG. 21 Pharmacokinetics study of two trastuzumab Cys-MMAF ADCs displaying fast clearance in vivo.
  • FIG. 22 In vivo efficacy studies of trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16 xenograft mouse model.
  • FIG. 23 Retention times of trastuzumab Pcl MMAF DAR 2 ADCs as measured by Hydrophobic Interaction Chromotography. ABA-MMAF is attached at a Pcl residue substituted for the indicated HC or LC residue. A) HC conjugated ADCs. B) LC conjugated ADCs. The retention time of unconjugated wild-type antibody is indicated (WT).
  • FIG. 24 Location of selected payload sites in the structure of a human IgG1 with a kappa light chain. Selected residues are shown in black on only one of the two heavy chains and for one of the two kappa light chains (1HZH.pdb). Three rotations of the structure are shown using PyMOL, an open-source molecular modeling package (The PyMOL Molecular Graphics System, Version 1.5.0. Schrödinger, LLC).
  • FIG. 25 Pharmacokinetics study of trastuzumab and antibody 14090 Cys-MMAF ADCs with DAR 4, 6 and 8 prepared with antibodies with 2, 3 or 4 Cys mutations.
  • DAR 4 trastuzumab ADCs HC-E258C-LC-S159C-MMAF (A), HC-S375C-LC-S159C-MMAF (B), HC-E258C-LC-E165C-MMAF (C), HC-S375C-LC-E165C-MMAF (D), HC-E152C-LC-R142C-MMAF (E), HC-P171C-LC-R142C-MMAF, and HC-E152C-LC-S159C-MMAF (G); DAR 4 antibody 14090 ADCs: HC-S375C-LC-A143C-MMAF (H), HC-K360C-LC-V159C-MMAF (I), and HC-S375C-LC-V159C-MMAF (J);
  • Antibody 14090 is mouse cross-reactive and therefore is cleared more rapidly that then the trastuzumab ADCs which do not bind to any mouse antigens.
  • the present invention provides methods of site-specific labeling of antibodies or antibody fragments by replacing one or more amino acids of a parental antibody or antibody fragment at specific positions with cysteine amino acids (“Cys”), such that the engineered antibodies or antibody fragments are capable of conjugation to various agents (e.g., cytotoxic agents).
  • Cys cysteine amino acids
  • the present invention also provides immunoconjugates that are produced by using the methods described herein.
  • cysteine When a cysteine is engineered into a parental antibody or antibody fragment, the modified antibody or antibody fragment is first recovered from the expression medium with cysteine or glutathione (GSH) attached at the engineered cysteine site(s) via a disulfide linkage (Chen et al., (2009) mAbs 16, 353-571). The attached cysteine or GSH is then removed in a reduction step, which also reduces all native inter-chain disulfide bonds of the parental antibody or antibody fragment. In a second step these disulfide bonds are re-oxidized before conjugation occurs.
  • GSH cysteine or glutathione
  • the present invention provides unique sets of sites on the antibody heavy chain constant region and antibody light chain constant region, respectively, where Cys substitution as described herein produces modified antibodies or antibody fragments that perform well in the re-oxidation process, and also produce stable and well behaved immunoconjugates.
  • the site-specific antibody labeling according to the present invention can be achieved with a variety of chemically accessible labeling reagents, such as anti-cancer agents, fluorophores, peptides, sugars, detergents, polyethylene glycols, immune potentiators, radio-imaging probes, prodrugs, and other molecules.
  • chemically accessible labeling reagents such as anti-cancer agents, fluorophores, peptides, sugars, detergents, polyethylene glycols, immune potentiators, radio-imaging probes, prodrugs, and other molecules.
  • the present invention provides methods of preparation of homogeneous immunoconjugates with a defined drug-to-antibody ratio for use in cancer therapy and other indications as well as imaging reagents.
  • the present invention also provides immunoconjugates prepared thereby, as well as pharmaceutical compositions comprising these immunoconjugates.
  • the methods of the instant invention can be used in combination with other conjugation methods known in the art.
  • the immunoconjugate comprises a group of the formula
  • the cysteine substitution site may be a position that corresponds to one of the sites identified by a position number, even though the position of the site in the sequence has been changed by a modification or truncation of the full-length antibody.
  • Corresponding sites can be readily identified by alignment of an antibody or fragment with a full-length antibody.
  • the antibodies (e.g., a parent antibody, optionally containing one or more non-canonical amino acids) of the present invention are numbered according to the EU numbering system as set forth in Edelman et al., (1969) Proc. Natl. Acad. USA 63:78-85, except that the lambda light chain is numbered according to the Kabat numbering system as set forth in Kabat et al., (1991) Fifth Edition. NIH Publication No. 91-3242.
  • Human IgG1 constant region is used as a representative throughout the application. However, the invention is not limited to human IgG1; corresponding amino acid positions can be readily deduced by sequence alignment. For example, FIG.
  • IgG1, IgG2, IgG3 and IgG4 heavy chain constant regions show sequence alignment of human IgG1, IgG2, IgG3 and IgG4 heavy chain constant regions, so that an identified Cys engineering site in the IgG1 constant region can be readily identified for IgG2, IgG3, and IgG4 as shown in FIG. 4 .
  • IgG1, IgG2, IgG3 and IgG4 are the same.
  • Table 1 lists the amino acid positions in the constant region of the heavy chain of an antibody that can be replaced by a cysteine.
  • Table 2 lists the amino acid positions in the constant region of the kappa light chain of an antibody that can be replaced by a cysteine.
  • Table 3 lists the amino acid positions in the constant region of the lambda light chain of an antibody that can be replaced by a cysteine.
  • findings of the invention are not limited to any specific antibodies or antibody fragments.
  • the present invention provides immunoconjugates comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises a substitution of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids on its heavy chain constant region chosen from positions identified in Table 1.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 334, 360, 375, and 392 of the heavy chain.
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of two amino acids with cysteine on its constant region chosen from positions 121 and 124, 121 and 152, 121 and 171, 121 and 174, 121 and 258, 121 and 292, 121 and 333, 121 and 334, 121 and 360, 121 and 375, 121 and 392, 124 and 152, 124 and 171, 124 and 174, 124 and 258, 124 and 292, 124 and 333, 124 and 334, 124 and 360, 124 and 375, 124 and 392, 152 and 171, 152 and 174, 152 and 258, 152 and 292, 152 and 333, 152 and 334, 152 and 360, 152 and 375, 152 and 392, 171 and 174, 171 and 258, 171 and 292, 171 and 333, 171 and 360, 171 and 375, 174 and 392,
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of three amino acids with cysteine on its constant region chosen from positions 121, 124 and 152; 121, 124 and 171; 121, 124 and 174; 121, 124 and 258; 121, 124 and 292; 121, 124 and 333; 121, 124 and 334; 121, 124 and 360; 121, 124 and 375; 121, 124 and 392; 121, 152 and 171; 121, 152 and 174; 121, 152 and 258; 121, 152 and 292; 121, 152 and 333; 121, 152 and 334; 121, 152 and 360; 121, 152 and 375; 121, 152 and 392; 121, 171 and 174; 121, 171 and 258; 121, 171 and 292; 121, 171 and 2
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of four amino acids with cysteine on its constant region chosen from positions 152, 333, 375 and 392; or 152, 334, 375 and 392 of the heavy chain.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 2, 3, 9, 11, 12, 13, 14, 16, 21, 25, 26, 28, 30, 31, 32, 33, 34, 36, 38, 39, 40, 43, 44, 45, 46, 47, 51, 53, 54, 56, 57, or 60.
  • the present invention provides an immunoconjugate comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 6, 7, 8, 15, 19, 20, 22, 23, 24, 27, 36, 37, 41, 49, 52, 55, 58, or 59.
  • the present invention provides immunoconjugates comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises a substitution of one or more amino acids (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) on its light chain constant region chosen from positions identified in Table 2.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 107, 108, 142, 145, 159, 161, and 165 of the light chain, wherein said light chain is human kappa light chain.
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of two amino acids with cysteine on its constant region chosen from positions 107 and 108; 107 and 142; 107 and 145; 107 and 159; 107 and 161; 107 and 165; 108 and 142; 108 and 145; 108 and 159; 108 and 161; 108 and 165; 142 and 145; 142 and 159; 142 and 161; 142 and 165; 145 and 159; 145 and 161; 145 and 165; 159 and 161; 159 and 165; 161 and 165 of the light chain, wherein said light chain is human kappa light chain.
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of three amino acids with cysteine on its constant region chosen from positions 107, 108 and 142; 107, 108 and 145; 107, 108 and 159; 107, 108 and 161; 107, 108 and 165; 107, 142 and 145; 107, 142 and 159; 107, 142 and 161; 107, 142 and 165; 107, 145 and 159; 107, 145 and 161; 107, 145 and 165; 107, 159 and 161; 107, 159 and 165; 107, 161 and 165; 108, 142 and 145; 108, 142 and 159; 108, 142 and 161; 108, 142 and 165; 108, 145 and 159; 108, 142 and 161; 108, 142 and 165; 108, 145
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 63, 65, 68, 70, 72, 73, 74, 78, 79, 80, 81, 82, 83, 86, 87, or 88.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 64, 66, 67, 84, 85, or 89 63, 64, 65, 66, 67, 68, 70, 72, 73, 74, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, or 89.
  • the present invention provides immunoconjugates comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises a substitution of one or more amino acids on its light chain constant region chosen from positions identified in Table 3.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 143, 147, 159, 163, and 168 of the light chain, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of two amino acids with cysteine on its constant region chosen from positions 143 and 147; 143 and 159; 143 and 163; 143 and 168; 147 and 159; 147 and 163; 147 and 168; 159 and 163; 159 and 168; or 163 and 168 of the light chain, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
  • an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of three amino acids with cysteine on its constant region chosen from positions 143, 147 and 159; 143, 147 and 163; 143, 147 and 168; 143, 159 and 163; 143, 159 and 168; 143, 163 and 168; 147, 159 and 163; 147, 159 and 168; 147, 163 and 168; or 159, 163 and 168 of the light chain, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 92, 94, 96, 97 or 98.
  • the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 93 or 95.
  • the immunoconjugate can have an DAR of about 2 or about 4.
  • the present invention provides immunoconjugates comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment comprises a Cys substitution of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids on its heavy chain constant region chosen from positions identified in Table 1, and a Cys substitution of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids on its light chain constant region chosen from positions identified in Table 2 or Table 3.
  • the present invention provides immunoconjugates comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment comprises a Cys substitution of one or more amino acids in its heavy chain constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 334, 360, 375 and 392; and a Cys substitution of one or more amino acids in its light chain constant region chosen from positions 107, 108, 142, 145, 159, 161, and 165, wherein said light chain is human kappa light chain.
  • a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain,
  • a modified antibody or antibody fragment according to the present invention comprises a Cys substitution on position 375 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain.
  • a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 334 and on position 375 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain.
  • a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 334 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain.
  • an immunoconjugates of those combinations can have a DAR of about 4 or about 6.
  • a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 334, on position 375 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain.
  • a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 333, on position 375 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain.
  • those combinations can have a DAR of about 4, 6, or 8.
  • the present invention provides immunoconjugates comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment comprises a Cys substitution of one or more amino acids in its heavy chain constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 334 360, 375 and 392; and a Cys substitution of one or more amino acids in its light chain constant region chosen from positions 143, 147, 159, 163, and 168, wherein said light chain is human lambda light chain.
  • a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position
  • the amino acid substitution described herein is cysteine comprising a thiol group.
  • the thiol group is utilized for chemical conjugation, and is attached to a linker unit (LU) and/or drug moiety.
  • the immunoconjugates of the invention comprise a drug moiety selected from the group consisting of a V-ATPase inhibitor, a HSP90 inhibitor, an IAP inhibitor, an mTor inhibitor, a microtubule stabilizer, a microtubule destabilizers, an auristatin, a dolastatin, a maytansinoid, a MetAP (methionine aminopeptidase), an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor, proteasome inhibitors, an inhibitors of phosphoryl transfer reactions in mitochondria, a protein synthesis inhibitor, a kinase inhibitor, a CDK2 inhibitor, a CDK9 inhibitor, an kinesin inhibitor, an HDAC inhibitor, a DNA damaging agent, a DNA alkylating agent, a DNA intercalator, a DNA minor groove binder and a DHFR inhibitor.
  • a drug moiety selected from the group consisting of a V-ATPase inhibitor, a HSP90 inhibitor, an
  • the immunoconjugates of the invention comprise a drug moiety that is an anti-cancer agent.
  • the modified antibody or antibody fragments of the present invention can be any formats known in the art, such as a monoclonal, chimeric, humanized, fully human, bispecific, or multispecific antibody or antibody fragment thereof.
  • the modified antibody heavy chain and/or light chain may contain 1, 2, 3, 4, 5, 6, 7, 8, or more cysteine substitutions in its constant regions.
  • the modified antibodies or antibody fragments contain 2, 4, 6, 8, or more cysteine substitutions in its constant regions.
  • the modified antibody, antibody fragment or immunoconjugate thereof comprises 2 or 4 Cys substitutions.
  • the parental antibody (antibody without cysteine substitution) is an IgG, IgM, IgE, or IgA antibody. In a specific embodiment, the parental antibody is an IgG1 antibody. In another specific embodiment, the parental antibody is an IgG2, IgG3, or IgG4 antibody.
  • the present invention also provides modified antibodies or antibody fragments thereof comprising a substitution of one or more amino acids on its heavy chain constant region chosen from positions identified in Table 1.
  • the present invention provides modified antibodies or antibody fragments thereof comprising a substitution of one or more amino acids on its light chain constant region chosen from positions identified in Table 2 or Table 3.
  • the modified antibodies or antibody fragments provided herein are labeled using the methods of the invention in combination with other conjugation methods known in the art including, but not limited to, chemoselective conjugation through lysine, histidine, tyrosine, formyl-glycine, pyrrolysine, pyrroline-carboxy-lysine, unnatural amino acids, and protein tags for enzyme-mediated conjugation (e.g., S6 tags).
  • conjugation methods including, but not limited to, chemoselective conjugation through lysine, histidine, tyrosine, formyl-glycine, pyrrolysine, pyrroline-carboxy-lysine, unnatural amino acids, and protein tags for enzyme-mediated conjugation (e.g., S6 tags).
  • the conjugated antibody or antibody fragment thereof provided herein is produced by post-translational modification of at least one cysteine residue that was incorporated into the antibody or antibody fragment thereof as described above by site-specific labeling methods.
  • the conjugated antibody or antibody fragment can be prepared by methods known in the art for conjugation of a payload of interest to cysteine residues that occur naturally in proteins, and by methods described for conjugation to proteins engineered to contain an additional cysteine residue substituted for another amino acid of a natural protein sequence.
  • modified antibodies or antibody fragment thereof provided herein are conjugated using known methods wherein the incorporated cysteine (cys) is conjugated to a maleimide derivative as Scheme Ia below.
  • Modified antibodies of the invention that undergo this type of conjugation contain a thiol-maleimide linkage.
  • LU is a Linker Unit (LU)
  • X is a payload or drug moiety.
  • the Cys incorporated into the modified antibodies or antibody fragment is conjugated by reaction with an alpha-halo carbonyl compound such as a chloro-, bromo-, or iodo-acetamide as shown in Scheme Ib below. It is understood that other leaving groups besides halogen, such as tosylate, triflate and other alkyl or aryl sulfonates, can be used as the leaving group Y.
  • Scheme Ib depicts reaction of a Cys thiol with an alpha-halo acetamide
  • the method includes any alkylation of a sulfur of an incorporated Cys with a group of the formula Y—CHR—C( ⁇ O)—, where R is H or C 1-4 alkyl, Y is a leaving group (typically Cl, Br, or I, and optionally an alkylsulfonate or arylsulfonate); it is not limited to amides.
  • the Cys incorporated into the modified antibodies or antibody fragment can be conjugated by reaction with an external thiol under conditions that induce formation of a disulfide bond between the external thiol and the sulfur atom of the incorporated cysteine residue as shown in Scheme Ic below.
  • R can be H; however, compounds where one or both R groups represent an alkyl group, e.g., Methyl, have been found to increase the stability of the disulfide.
  • the modified antibodies of the invention typically contain 1-12, frequently 2-8, and preferably 2, 4 or 6-LU-X (Linker Unit-Payload) moieties.
  • an antibody light or heavy chain is modified to incorporate two new Cys residues at two of the specific sites identified herein for Cys substitutions (or alternatively one Cys is incorporated in the light chain and one in the heavy chain), so the tetrameric antibody ultimately contains four conjugation sites.
  • the antibody can be modified by replacement of 3 or 4 of its native amino acids with Cys at the specific sites identified herein, in light chain or heavy chain or a combination thereof, resulting in 6 or 8 conjugation sites in the tetrameric antibody.
  • X in these conjugates represents a payload, which can be any chemical moiety that is useful to attach to an antibody.
  • X is a drug moiety selected from a cytotoxin, an anti-cancer agent, an anti-inflammatory agent, an antifungal agent, an antibacterial agent, an anti-parasitic agent, an anti-viral agent, an immune potentiator, and an anesthetic agent or any other therapeutic, or biologically active moiety or drug moiety.
  • X is a label such as a biophysical probe, a fluorophore, an affinity probe, a spectroscopic probe, a radioactive probe, a spin label, or a quantum dot.
  • X is a chemical moiety that modifies the antibody's physicochemical properties such as a lipid molecule, a polyethylene glycol, a polymer, a polysaccharide, a liposome, or a chelator.
  • X is a functional or detectable biomolecule such as a nucleic acid, a ribonucleic acid, a protein, a peptide (e.g., an enzyme or receptor), a sugar or polysaccharide, an antibody, or an antibody fragment.
  • X is an anchoring moiety such as a nanoparticle, a PLGA particle, or a surface, or any binding moiety for specifically binding the conjugate to another moiety, such as a histidine tag, poly-G, biotin, avidin, streptavidin, and the like.
  • X is a reactive functional group that can be used to attach the antibody conjugate to another chemical moiety, such as a drug moiety, a label, another antibody, another chemical moiety, or a surface.
  • the Linker Unit can be any suitable chemical moiety that covalently attaches the thiol-reactive group (e.g., maleimide, alpha-halo carbonyl, vinyl carbonyl (e.g., acrylate or acrylamide), vinyl sulfone, vinylpyridine, or thiol) to a payload.
  • thiol-reactive group e.g., maleimide, alpha-halo carbonyl, vinyl carbonyl (e.g., acrylate or acrylamide), vinyl sulfone, vinylpyridine, or thiol
  • LU can be comprised of one, two, three, four, five, six, or more than six linkers referred to herein as L 1 , L 2 , L 3 , L 4 , L 5 and L 6 .
  • the LU comprises a linker selected from a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or any combination thereof, and the LU optionally contains a self-immolative spacer.
  • LU is a group of the formula -L 1 -L 2 -L 3 -L 4 - or -L 1 -L-L 3 -L 4 -L 5 -L 6 -.
  • Linking groups L 1 , L 2 , L 3 , L 4 , L 5 and L 6 for use in LU include alkylene groups —(CH 2 ) n — (where n is 1-20, typically 1-10 or 1-6), ethylene glycol units (—CH 2 CH 2 O—) n (where n is 1-20, typically 1-10 or 1-6), amides —C( ⁇ O)—NH— or —NH—C( ⁇ O)—, esters —C( ⁇ O)—O— or —O—C( ⁇ O)—, rings having two available points of attachment such as divalent phenyl, C 3-8 cycloalkyl or C 4-8 heterocyclyl groups, amino acids —NH—CHR*—C ⁇ O— or —C( ⁇ O)
  • L 1 , L 2 , L 3 , L 4 , L 5 and L 6 can be selected from:
  • At least one of L 1 , L 2 , L 3 , L 4 , L 5 and L 6 is a stable, or non-cleavable, linker.
  • at least one of L 1 , L 2 , L 3 , L 4 , L 5 and L 6 is a cleavable linker, which may be chemically cleavable (hydrazones, disulfides) or enzymatically cleavable.
  • the enzymatically cleavable linker is one readily cleaved by a peptidase: The Val-Cit linker (valine-citrulline), a dipeptide of two known amino acids, is one such linker.
  • the enzymatically cleavable linker is one that is triggered by activity of a glucuronidase:
  • linker which also comprises a self-immolative spacer that falls apart spontaneously under physiological conditions once glucuronidase cleaves the glycosidic linkage.
  • the immunoconjugate of the invention comprises a modified cysteine residue of the formula IIA or IIB:
  • L 2 is a bond.
  • L 2 is NH or O.
  • L 3 is selected from (CH 2 ) 1-10 and (CH 2 CH 2 O) 1-6 .
  • L 4 , L 5 and L 6 are additional optional linkers selected from those described herein.
  • L 6 can be a carbonyl (C ⁇ O) or a linker that comprises a self-immolative spacer.
  • the Linker Unit is -L 1 -L 2 -L 3 -L 4 -, wherein:
  • the Linker Unit is -L 1 -L 2 -L 3 -L 4 -, wherein
  • At least one of L 1 , L 2 , L 3 , L 4 , L 5 and L 6 is a cleavable linker, and LU is considered cleavable.
  • at least one of L 1 , L 2 , L 3 , L 4 , L 5 and L 6 is a non-cleavable linker.
  • each linker of LU is non-cleavable, and LU is considered non-cleavable.
  • L 1 , L 2 , L 3 and L 4 are linkers selected from -A 1 -, -A 1 X 2 — and —X 2 —;
  • R 9 is independently selected from H and C 1-6 haloalkyl
  • the other linkers of LU are independently selected from a bond, -A 1 -, -A 1 X 2 —, —X 2 —, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker and a linker that comprises a self-immolative spacer.
  • the Linker Unit is -L 1 -L 2 -L 3 -L 4 -, wherein
  • L 1 is C( ⁇ O)—CH 2 CH 2 —NH—C( ⁇ O)—CH 2 CH 2 —S—, so LU is —C( ⁇ O)—CH 2 CH 2 —NH—C( ⁇ O)—CH 2 CH 2 —S-L 2 -L 3 -L 4 -.
  • the Linker Unit is -L 1 -L 2 -L 3 -L 4 -, wherein
  • the Linker Unit is -L 1 -L 2 -L 3 -L 4 -, wherein
  • R 9 is independently selected from H and C 1-6 haloalkyl; each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
  • L 1 is —(CH 2 ) 1-10 —C( ⁇ O)—, e.g., —(CH 2 ) 5 —C( ⁇ O)—; and L 2 , L 3 and L 4 each represent a bond.
  • LU comprises a val-cit linker of this formula, wherein X represents a payload, typically a drug moiety such as one having anticancer activity:
  • L 3 is preferably —(CH 2 ) 2-6 —C( ⁇ O)—.
  • the X group is a maytansinoid such as DM1 or DM4, or a dolastatin analog or derivative such as dolastatin 10 or 15 and auristatins MMAF or MMAE, or a calicheamicin such as N-acetyl- ⁇ -calicheamicin, or a label or dye such as rhodamine or tetramethylrhodamine.
  • a maytansinoid such as DM1 or DM4
  • a dolastatin analog or derivative such as dolastatin 10 or 15 and auristatins MMAF or MMAE
  • a calicheamicin such as N-acetyl- ⁇ -calicheamicin
  • a label or dye such as rhodamine or tetramethylrhodamine.
  • a “linker” is any chemical moiety that is capable of connecting an antibody or a fragment thereof to an X group (payload) to form an immunoconjugate.
  • Linkers can be susceptible to cleavage, such as, acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the compound or the antibody remains active.
  • linkers can be substantially resistant to cleavage.
  • a linker may or may not include a self-immolative spacer.
  • Non-limiting examples of the non-enzymatically cleavable linkers as used herein to conjugate an X 1 group to the modified antibodies or antibody fragment thereof provided herein include, acid-labile linkers, linkers containing a disulfide moiety, linkers containing a triazole moiety, linkers containing a hydrazone moiety, linkers containing a thioether moiety, linkers containing a diazo moiety, linkers containing an oxime moiety, linkers containing an amide moiety and linkers containing an acetamide moiety.
  • Non-limiting examples of the enzymatically cleavable linkers as used herein to conjugate an X group to the modified antibodies or antibody fragment thereof provided herein include, but are not limited to, linkers that are cleaved by a protease, linkers that are cleaved by an amidase, and linkers that are cleaved by -glucuronidase or another glycosidase.
  • such enzyme cleavable linkers are linkers which are cleaved by cathepsin, including cathepsin Z, cathepsin B, cathepsin H and cathepsin C.
  • the enzymatically cleavable linker is a dipeptide cleaved by cathepsin, including dipeptides cleaved by cathepsin Z, cathepsin B, cathepsin H or cathepsin C.
  • the enzymatically cleavable linker is a cathepsin B-cleavable peptide linker.
  • the enzymatically cleavable linker is a cathepsin B-cleavable dipeptide linker. In certain embodiments the enzymatically cleavable dipeptide linker is valine-citrulline or phenylalanine-lysine.
  • Other non-limiting examples of the enzymatically cleavable linkers as used herein conjugate an X group to the modified antibodies or antibody fragment thereof provided herein include, but are not limited to, linkers which are cleaved
  • “Self-immolative spacers” are bifunctional chemical moieties covalently linked at one terminus to a first chemical moiety and at the other terminus to a second chemical moiety, thereby forming a stable tripartate molecule.
  • a linker can comprise a self-immolative spacer bonded to a third chemical moiety that is cleavable from the spacer either chemically or enzymatically. Upon cleavage of a bond between the self-immolative spacer and the first chemical moiety or the third chemical moiety, self-immolative spacers undergo rapid and spontaneous intramolecular reactions and thereby separate from the second chemical moiety.
  • the first or third moiety is an enzyme cleavable group, and this cleavage results from an enzymatic reaction, while in other embodiments the first or third moiety is an acid labile group and this cleavage occurs due to a change in pH.
  • the second moiety is the “Payload” group as defined herein.
  • cleavage of the first or third moiety from the self-immolative spacer results from cleavage by a proteolytic enzyme, while in other embodiments it results from cleaved by a hydrolase. In certain embodiments, cleavage of the first or third moiety from the self-immolative spacer results from cleavage by a cathepsin enzyme or a glucuronidase.
  • the enzyme cleavable linker is a peptide linker and the self-immolative spacer is covalently linked at one of its ends to the peptide linker and covalently linked at its other end to a drug moiety.
  • This tripartite molecule is stable and pharmacologically inactive in the absence of an enzyme, but which is enzymatically cleavable by enzyme at a bond covalently linking the spacer moiety and the peptide moiety.
  • the peptide moiety is cleaved from the tripartate molecule which initiates the self-immolating character of the spacer moiety, resulting in spontaneous cleavage of the bond covalently linking the spacer moiety to the drug moiety, to thereby effect release of the drug in pharmacologically active form.
  • a linker comprises a self-immolative spacer that connects to the peptide, either directly or indirectly at one end, and to a payload at the other end; and the spacer is attached to a third moiety that can be cleaved from the spacer enzymatically, such as by a glucuronidase. Upon cleavage of the third moiety, the spacer degrades or rearranges in a way that causes the payload to be released.
  • linker with this type of self-immolative spacer is this glucuronidase-cleavable linker, where hydrolysis of the acetal catalyzed by glucuronidase releases a phenolic compound that spontaneously decomposes under physiological conditions:
  • Non-limiting examples of the self-immolative spacer optionally used in the conjugation of an X 1 group to the modified antibodies or antibody fragment thereof provided herein include, but are not limited to, moieties which include a benzyl carbonyl moiety, a benzyl ether moiety, a 4-aminobutyrate moiety, a hemithioaminal moiety or a N-acylhemithioaminal moiety.
  • self-immolative spacers include, but are not limited to, p-aminobenzyloxycarbonyl groups, aromatic compounds that are electronically similar to the p-aminobenzyloxycarbonyl group, such as 2-aminoimidazol-5-methanol derivatives and ortho or para-aminobenzylacetals.
  • self-immolative spacers used herein which undergo cyclization upon amide bond hydrolysis include substituted and unsubstituted 4-aminobutyric acid amides and 2-aminophenylpropionic acid amides.
  • the self-immolative spacer is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe-immolative spacer
  • n 1 or 2.
  • the self-immolative spacer is
  • n 1 or 2.
  • the self-immolative spacer is
  • n 1 or 2.
  • the self-immolative spacer is
  • n 1 or 2.
  • the self-immolative spacer is
  • n 1 or 2.
  • Schemes (2a-2c) illustrate the post-translational modification of the modified antibodies or antibody fragment thereof provided herein wherein the Linker Unit (LU) is -L 1 -L 2 -L 3 -L 4 -, and L1 in each case is the group that reacts with the new Cys.
  • the Linker Unit LU
  • L1 in each case is the group that reacts with the new Cys.
  • the starting material is the replacement Cys residue in an antibody or antibody fragment modified as described herein, where the dashed bonds indicate connection to adjoining residues of the antibody or antibody fragment; each R is H or C 1-4 alkyl, typically H or methyl; L 2 , L 3 and L 4 are components of the linking unit LU, such as those described above; X is the payload; and the group connecting L 2 to the sulfur of the substitute Cys of the invention is L 1 .
  • X is a reactive functional group that can be used to connect the conjugated antibody to another chemical moiety, by interacting with a suitable complementary functional group.
  • Table 4 depicts some examples of reactive functional groups that X can represent, along with a complementary functional group that can be used to connect a conjugate comprising X to another compound.
  • Methods for using X to connect to the corresponding complementary functional group are well known in the art. Connections using azide are typically done using ‘Click’ or copper-free click chemistry; reactions involving hydrazines, alkoxyamines or acyl hydrazines typically proceed through the formation of a Schiff base with one of the carbonyl functional groups.
  • Payload X a is a reactive functional group
  • X b on Formula II-a is the corresponding complementary functional group
  • Formula II-a itself represents a molecule to be connected to the conjugated antibody.
  • the third column in Table 5 depicts a product from reaction of X a with X b .
  • the modified antibody or antibody fragment thereof provided herein is conjugated with an “X group-to-antibody” (payload to antibody) ratio between about 1 and 16, such as 1-12, or 1, 2, 3, 4, 5, 6, 7, or 8, wherein the modified antibody or antibody fragment thereof contains 1, 2, 3, 4, 5, 6, 7, or 8 cysteine residues incorporated at the specific sites disclosed herein.
  • an “X group-to-antibody” ratio of 4 can be achieved by incorporating two Cys residues into the heavy chain of an antibody, which will contain 4 conjugation sites, two from each heavy chain Immunoconjugates of such antibodies will contain up to 4 payload groups, which may be alike or different and are preferably all alike.
  • an “X group-to-antibody” ratio of 4 can be achieved by incorporating one Cys residue into the heavy chain and a second Cys residue into the light chain of an antibody resulting in 4 conjugation sites, two in the two heavy chains and two in the two light chains.
  • a ratio 6, 8 or higher can be achieved by combinations of 3, 4 or more cysteine substitutions of the invention in heavy and light chain of the antibody. Substituting multiple cysteine groups into an antibody can lead to inappropriate disulfide formation and other problems.
  • the methods of the invention can alternatively be combined with methods that do not rely upon reactions at cysteine sulfur, such as acylations at lysine, or conjugation via S6 tags or Pcl methodology.
  • the payload to antibody ratio has an exact value for a specific conjugate molecule, it is understood that the value will often be an average value when used to describe a sample containing many molecules, due to some degree of inhomogeneity, typically in the conjugation step.
  • the average loading for a sample of an immunoconjugate is referred to herein as the drug to antibody ratio, or DAR.
  • the DAR is between about 1 and about 16, and typically is about 1, 2, 3, 4, 5, 6, 7, or 8.
  • at least 50% of a sample by weight is compound having the average ratio plus or minus 2, and preferably at least 50% of the sample is a conjugate that contains the average ratio plus or minus 1.
  • Preferred embodiments include immunoconjugates wherein the DAR is about 2 or about 8, e.g., about 2, about 4, about 6 or about 8.
  • a DAR of ‘about n’ means the measured value for DAR is within 10% of n (in Formula (I)).
  • the present invention provides site-specific labeled immunoconjugates.
  • the immunoconjugates of the invention may comprise modified antibodies or antibody fragments thereof that further comprise modifications to framework residues within V H and/or V L , e.g. to improve the properties of the antibody.
  • framework modifications are made to decrease the immunogenicity of the antibody.
  • one approach is to “back-mutate” one or more framework residues to the corresponding germline sequence.
  • an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
  • somatic mutations can be “back-mutated” to the germline sequence by, for example, site-directed mutagenesis.
  • Such “back-mutated” antibodies are also intended to be encompassed by the invention.
  • Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T-cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
  • antibodies of the invention may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • modifications within the Fc region typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • an antibody of the invention may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody.
  • the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased.
  • This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al.
  • the number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
  • SpA Staphylococcyl protein A
  • the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector functions of the antibody.
  • one or more amino acids can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody.
  • the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in, e.g., U.S. Pat. Nos. 5,624,821 and 5,648,260, both by Winter et al.
  • one or more amino acids selected from amino acid residues can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
  • CDC complement dependent cytotoxicity
  • one or more amino acid residues are altered to thereby alter the ability of the antibody to fix complement. This approach is described in, e.g., the PCT Publication WO 94/29351 by Bodmer et al.
  • one or more amino acids of an antibody or antibody fragment thereof of the present invention are replaced by one or more allotypic amino acid residues, such as those shown in FIG. 4 for the IgG1 subclass and the kappa isotype.
  • Allotypic amino acid residues also include, but are not limited to, the constant region of the heavy chain of the IgG1, IgG2, and IgG3 subclasses as well as the constant region of the light chain of the kappa isotype as described by Jefferis et al., MAbs. 1:332-338 (2009).
  • the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fc ⁇ receptor by modifying one or more amino acids.
  • ADCC antibody dependent cellular cytotoxicity
  • This approach is described in, e.g., the PCT Publication WO 00/42072 by Presta.
  • the binding sites on human IgG1 for Fc ⁇ R1, Fc ⁇ RII, Fc ⁇ RIII and FcRn have been mapped and variants with improved binding have been described (see Shields et al., J. Biol. Chem. 276:6591-6604, 2001).
  • the glycosylation of an antibody is modified.
  • an aglycosylated antibody can be made (i.e., the antibody lacks glycosylation).
  • Glycosylation can be altered to, for example, increase the affinity of the antibody for “antigen.”
  • Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
  • one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
  • Such aglycosylation may increase the affinity of the antibody for antigen.
  • Such an approach is described in, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861 by Co et al.
  • an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures.
  • altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies.
  • carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation.
  • glycoprotein-modifying glycosyl transferases e.g., beta(1,4)-N acetylglucosaminyltransferase III (GnTIII)
  • GnTIII glycoprotein-modifying glycosyl transferases
  • the antibody is modified to increase its biological half-life.
  • Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, or T256F, as described in U.S. Pat. No. 6,277,375 to Ward.
  • the antibody can be altered within the CH1 or C L region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al.
  • the present invention provides site-specific labeling methods, modified antibodies and antibody fragments thereof, and immunoconjugates prepared accordingly.
  • a modified antibody or antibody fragments thereof can be conjugated to a label, such as a drug moiety, e.g., an anti-cancer agent, an autoimmune treatment agent, an anti-inflammatory agent, an antifungal agent, an antibacterial agent, an anti-parasitic agent, an anti-viral agent, or an anesthetic agent, or an imaging reagent, such as a chelator for PET imaging, or a fluorescent label, or a MRI contrast reagent.
  • An antibody or antibody fragments can also be conjugated using several identical or different labeling moieties combining the methods of the invention with other conjugation methods.
  • the immunoconjugates of the present invention comprise a drug moiety selected from a V-ATPase inhibitor, a HSP90 inhibitor, an IAP inhibitor, an mTor inhibitor, a microtubule stabilizer, a microtubule destabilizer, an auristatin, a dolastatin, a maytansinoid, a MetAP (methionine aminopeptidase), an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor, proteasome inhibitors, an inhibitor of phosphoryl transfer reactions in mitochondria, a protein synthesis inhibitor, a kinase inhibitor, a CDK2 inhibitor, a CDK9 inhibitor, an HDAC inhibitor, a DNA damaging agent, a DNA alkylating agent, a DNA intercalator, a DNA minor groove binder, topoisomerase inhibitors, RNA synthesis inhibitors, kinesin inhibitors, inhibitors of protein-protein interactions, and a DHFR inhibitor.
  • a drug moiety selected from a V-ATP
  • the modified antibodies or antibody fragments of the present invention may be conjugated to a drug moiety that modifies a given biological response.
  • Drug moieties are not to be construed as limited to classical chemical therapeutic agents.
  • the drug moiety may be an immune modulator, such as an immune potentiator, a small molecule immune potentiator, a TLR agonist, a CpG oligomer, a TLR2 agonist, a TLR4 agonist, a TLR7 agonist, a TLR9 agonist, a TLR8 agonist, a T-cell epitope peptide or a like.
  • the drug moiety may also be an oligonucleotide, a siRNA, a shRNA, a cDNA or a like.
  • the drug moiety may be a protein, peptide, or polypeptide possessing a desired biological activity.
  • Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, cholera toxin, or diphtheria toxin, a protein such as tumor necrosis factor, ⁇ -interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, a cytokine, an apoptotic agent, an anti-angiogenic agent, or, a biological response modifier such as, for example, a lymphokine.
  • a toxin such as abrin, ricin A, pseudomonas exotoxin, cholera toxin, or diphtheria toxin
  • a protein such as tumor necrosis factor, ⁇ -interferon, ⁇ -interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, a cytokine, an apoptotic agent, an anti-angiogenic agent, or, a biological response
  • the modified antibodies or antibody fragments of the present invention are conjugated to a drug moiety, such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin.
  • a drug moiety such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin.
  • cytotoxin include but not limited to, taxanes (see, e.g., International (PCT) Patent Application Nos.
  • DNA-alkylating agents e.g., CC-1065 analogs
  • anthracyclines e.g., tubulysin analogs
  • duocarmycin analogs e.g., auristatin E
  • auristatin F e.g., maytansinoids
  • cytotoxic agents comprising a reactive polyethylene glycol moiety (see, e.g., Sasse et al., J. Antibiot. (Tokyo), 53, 879-85 (2000), Suzawa et al., Bioorg. Med. Chem., 8, 2175-84 (2000), Ichimura et al., J. Antibiot.
  • WO 01/49698 taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, and puromycin and analogs or homologs thereof.
  • Therapeutic agents also include, for example, anti-metabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), ablating agents (e.g., mechlorethamine, thiotepa chlorambucil, meiphalan, carmustine (BSNU) and lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin, anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g.,
  • An example of a calicheamicin antibody conjugate is commercially available (MylotargTM; Wyeth-Ayerst).
  • modified antibodies or antibody fragments thereof can also be conjugated to a radioactive isotope to generate cytotoxic radiopharmaceuticals, referred to as radioimmunoconjugates.
  • radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include, but are not limited to, iodine 131 , indium 111 , yttrium 90 , and lutetium 177 . Methods for preparing radioimmunoconjugates are established in the art.
  • radioimmunoconjugates are commercially available, including ZevalinTM (DEC Pharmaceuticals) and BexxarTM (Corixa Pharmaceuticals), and similar methods can be used to prepare radioimmunoconjugates using the antibodies of the invention.
  • the macrocyclic chelator is 1,4,7,10-tetraazacyclododecane-N,N′,N′′,N′′′-tetraacetic acid (DOTA) which can be attached to the antibody via a linker molecule.
  • linker molecules are commonly known in the art and described in Denardo et al., (1998) Clin. Cancer Res. 4(10):2483-90; Peterson et al., (1999) Bioconjug. Chem. 10(4):553-7; and Zimmerman et al., (1999) Nucl. Med. Biol. 26(8):943-50, each incorporated by reference in their entireties.
  • the present invention further provides modified antibodies or fragments thereof that specifically bind to an antigen.
  • the modified antibodies or fragments may be conjugated or fused to a heterologous protein or polypeptide (or fragment thereof, preferably to a polypeptide of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids) to generate fusion proteins.
  • the invention provides fusion proteins comprising an antibody fragment described herein (e.g., a Fab fragment, Fd fragment, Fv fragment, F(ab)2 fragment, a V H domain, a V H CDR, a V L domain or a V L CDR) and a heterologous protein, polypeptide, or peptide.
  • modified antibody fragments without antigen binding specificity such as but not limited to, modified Fc domains with engineered cysteine residue(s) according to the present invention, are used to generate fusion proteins comprising such an antibody fragment (e.g., engineered Fc) and a heterologous protein, polypeptide, or peptide.
  • DNA shuffling may be employed to alter the activities of antibodies of the invention or fragments thereof (e.g., antibodies or fragments thereof with higher affinities and lower dissociation rates). See, generally, U.S. Pat. Nos. 5,605,793, 5,811,238, 5,830,721, 5,834,252, and 5,837,458; Patten et al., (1997) Curr. Opinion Biotechnol. 8:724-33; Harayama, (1998) Trends Biotechnol.
  • Antibodies or fragments thereof, or the encoded antibodies or fragments thereof may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination.
  • a polynucleotide encoding an antibody or fragment thereof that specifically binds to an antigen may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
  • the modified antibodies or antibody fragments thereof of the present invention can be conjugated to marker sequences, such as a peptide to facilitate purification.
  • the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), among others, many of which are commercially available.
  • hexa-histidine provides for convenient purification of the fusion protein.
  • peptide tags useful for purification include, but are not limited to, the hemagglutinin (“HA”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., (1984) Cell 37:767), and the “FLAG” tag (A. Einhauer et al., J. Biochem. Biophys. Methods 49: 455-465, 2001).
  • HA hemagglutinin
  • FLAG A. Einhauer et al., J. Biochem. Biophys. Methods 49: 455-465, 2001.
  • antibodies or antibody fragments can also be conjugated to tumor-penetrating peptides in order to enhance their efficacy.
  • modified antibodies or antibody fragments of the present invention are conjugated to a diagnostic or detectable agent.
  • immunoconjugates can be useful for monitoring or prognosing the onset, development, progression and/or severity of a disease or disorder as part of a clinical testing procedure, such as determining the efficacy of a particular therapy.
  • Such diagnosis and detection can accomplished by coupling the antibody to detectable substances including, but not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidin/biotin and avidin/biotin; fluorescent materials, such as, but not limited to, Alexa Fluor 350, Alexa Fluor 405, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 500, Alexa Fluor 514, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 555, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 610, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680, Alexa Fluor 700, Alexa Fluor 750, umbelliferone, fluorescein, fluorescein isothiocyan
  • Modified antibodies or antibody fragments of the invention may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen.
  • solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
  • compositions including immunoconjugates are mixed with a pharmaceutically acceptable carrier or excipient.
  • the compositions can additionally contain one or more other therapeutic agents that are suitable for treating or preventing cancer (breast cancer, colorectal cancer, lung cancer, multiple myeloma, ovarian cancer, liver cancer, gastric cancer, pancreatic cancer, acute myeloid leukemia, chronic myeloid leukemia, osteosarcoma, squamous cell carcinoma, peripheral nerve sheath tumors (e.g., schwannoma), head and neck cancer, bladder cancer, esophageal cancer, Barretts esophageal cancer, glioblastoma, clear cell sarcoma of soft tissue, malignant mesothelioma, neurofibromatosis, renal cancer, melanoma, prostate cancer, benign prostatic hyperplasia (BPH), gynacomastica, and endometriosis).
  • cancer breast cancer, colorectal cancer, lung cancer, multiple
  • Formulations of therapeutic and diagnostic agents can be prepared by mixing with physiologically acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions, lotions, or suspensions (see, e.g., Hardman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y., 2001; Gennaro, Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y., 2000; Avis, et al.
  • an administration regimen for a therapeutic depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the immunogenicity of the entity, and the accessibility of the target cells in the biological matrix.
  • an administration regimen maximizes the amount of therapeutic delivered to the patient consistent with an acceptable level of side effects.
  • the amount of biologic delivered depends in part on the particular entity and the severity of the condition being treated. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules is available (see, e.g., Wawrzynczak, Antibody Therapy, Bios Scientific Pub.
  • Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects.
  • Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
  • the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors known in the medical arts.
  • compositions comprising antibodies or fragments thereof of the invention can be provided by continuous infusion, or by doses at intervals of, e.g., one day, one week, or 1-7 times per week.
  • Doses may be provided intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, or by inhalation.
  • a specific dose protocol is one involving the maximal dose or dose frequency that avoids significant undesirable side effects.
  • the dosage administered to a patient may be 0.0001 mg/kg to 100 mg/kg of the patient's body weight.
  • the dosage may be between 0.0001 mg/kg and 20 mg/kg, 0.0001 mg/kg and 10 mg/kg, 0.0001 mg/kg and 5 mg/kg, 0.0001 and 2 mg/kg, 0.0001 and 1 mg/kg, 0.0001 mg/kg and 0.75 mg/kg, 0.0001 mg/kg and 0.5 mg/kg, 0.0001 mg/kg to 0.25 mg/kg, 0.0001 to 0.15 mg/kg, 0.0001 to 0.10 mg/kg, 0.001 to 0.5 mg/kg, 0.01 to 0.25 mg/kg or 0.01 to 0.10 mg/kg of the patient's body weight.
  • the dosage of the antibodies or fragments thereof of the invention may be calculated using the patient's weight in kilograms (kg) multiplied by the dose to be administered in mg/kg.
  • Doses of the immunoconjugates the invention may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or at least 6 months. In a specific embodiment, does of the immunoconjugates of the invention are repeated every 3 weeks.
  • An effective amount for a particular patient may vary depending on factors such as the condition being treated, the overall health of the patient, the method route and dose of administration and the severity of side effects (see, e.g., Maynard et al., A Handbook of SOPs for Good Clinical Practice, Interpharm Press, Boca Raton, Fla., 1996; Dent, Good Laboratory and Good Clinical Practice, Urch Publ., London, UK, 2001).
  • the route of administration may be by, e.g., topical or cutaneous application, injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular, intraocular, intraarterial, intracerebrospinal, intralesional, or by sustained release systems or an implant (see, e.g., Sidman et al., Biopolymers 22:547-556, 1983; Langer et al., J. Biomed. Mater. Res. 15:167-277, 1981; Langer, Chem. Tech. 12:98-105, 1982; Epstein et al., Proc. Natl. Acad. Sci. USA 82:3688-3692, 1985; Hwang et al., Proc.
  • composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection.
  • pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. See, e.g., U.S. Pat. Nos. 6,019,968, 5,985,320, 5,985,309, 5,934,272, 5,874,064, 5,855,913, 5,290,540, and 4,880,078; and PCT Publication Nos. WO 92/19244, WO 97/32572, WO 97/44013, WO 98/31346, and WO 99/66903, each of which is incorporated herein by reference their entirety.
  • a composition of the present invention may also be administered via one or more routes of administration using one or more of a variety of methods known in the art.
  • routes of administration include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
  • Parenteral administration may represent modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
  • a composition of the invention can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
  • the immunoconjugates of the invention is administered by infusion.
  • the immunoconjugates of the invention is administered subcutaneously.
  • a pump may be used to achieve controlled or sustained release (see Langer, supra; Sefton, CRC Crit. Ref Biomed. Eng. 14:20, 1987; Buchwald et al., Surgery 88:507, 1980; Saudek et al., N. Engl. J. Med. 321:574, 1989).
  • Polymeric materials can be used to achieve controlled or sustained release of the therapies of the invention (see e.g., Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla., 1974; Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York, 1984; Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61, 1983; see also Levy et al., Science 228:190, 1985; During et al., Ann. Neurol. 25:351, 1989; Howard et al., J. Neurosurg. 7 1:105, 1989; U.S. Pat. No.
  • polymers used in sustained release formulations include, but are not limited to, poly(-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N-vinyl pyrrolidone), poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters.
  • the polymer used in a sustained release formulation is inert, free of leachable impurities, stable on storage, sterile, and biodegradable.
  • a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138, 1984).
  • the immunoconjugates of the invention are administered topically, they can be formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well-known to one of skill in the art. See, e.g., Remington's Pharmaceutical Sciences and Introduction to Pharmaceutical Dosage Forms, 19th ed., Mack Pub. Co., Easton, Pa. (1995).
  • viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity, in some instances, greater than water are typically employed.
  • Suitable formulations include, without limitation, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, and the like, which are, if desired, sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, such as, for example, osmotic pressure.
  • auxiliary agents e.g., preservatives, stabilizers, wetting agents, buffers, or salts
  • Other suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient, in some instances, in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as FreonTM) or in a squeeze bottle.
  • a pressurized volatile e.g., a gaseous propellant, such as FreonTM
  • compositions comprising the immunoconjugates are administered intranasally, it can be formulated in an aerosol form, spray, mist or in the form of drops.
  • prophylactic or therapeutic agents for use according to the present invention can be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas).
  • a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
  • a second therapeutic agent e.g., a cytokine, steroid, chemotherapeutic agent, antibiotic, or radiation
  • a second therapeutic agent e.g., a cytokine, steroid, chemotherapeutic agent, antibiotic, or radiation
  • An effective amount of therapeutic may decrease the symptoms by at least 10%; by at least 20%; at least about 30%; at least 40%, or at least 50%.
  • Additional therapies which can be administered in combination with the immunoconjugates of the invention may be administered less than 5 minutes apart, less than 30 minutes apart, 1 hour apart, at about 1 hour apart, at about 1 to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 10 hours to about 11 hours apart, at about 11 hours to about 12 hours apart, at about 12 hours to 18 hours apart, 18 hours to 24 hours apart, 24 hours to 36 hours apart, 36 hours to 48 hours apart, 48 hours to 52 hours apart, 52 hours to 60 hours apart, 60 hours to 72 hours apart, 72 hours to 84 hours apart, 84 hours to 96 hours apart, or 96 hours to 120 hours apart from the immunoconjugates of the invention.
  • the immunoconjugates of the invention can be formulated to ensure proper distribution in vivo.
  • the blood-brain barrier excludes many highly hydrophilic compounds.
  • the therapeutic compounds of the invention cross the BBB (if desired)
  • they can be formulated, for example, in liposomes.
  • liposomes For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331.
  • the liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., Ranade, (1989) J. Clin. Pharmacol. 29:685).
  • Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun 153:1038); antibodies (Bloeman et al., (1995) FEBS Lett. 357:140; Owais et al., (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al., (1995) Am. J. Physiol. 1233:134); p 120 (Schreier et al, (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4:273.
  • biotin
  • the invention provides protocols for the administration of pharmaceutical composition comprising immunoconjugates of the invention alone or in combination with other therapies to a subject in need thereof.
  • the therapies e.g., prophylactic or therapeutic agents
  • the therapy e.g., prophylactic or therapeutic agents
  • the combination therapies of the present invention can also be cyclically administered.
  • Cycling therapy involves the administration of a first therapy (e.g., a first prophylactic or therapeutic agent) for a period of time, followed by the administration of a second therapy (e.g., a second prophylactic or therapeutic agent) for a period of time and repeating this sequential administration, i.e., the cycle, in order to reduce the development of resistance to one of the therapies (e.g., agents) to avoid or reduce the side effects of one of the therapies (e.g., agents), and/or to improve, the efficacy of the therapies.
  • a first therapy e.g., a first prophylactic or therapeutic agent
  • a second therapy e.g., a second prophylactic or therapeutic agent
  • the therapies e.g., prophylactic or therapeutic agents
  • the combination therapies of the invention can be administered to a subject concurrently.
  • each therapy may be administered to a subject at the same time or sequentially in any order at different points in time; however, if not administered at the same time, they should be administered sufficiently close in time so as to provide the desired therapeutic or prophylactic effect.
  • Each therapy can be administered to a subject separately, in any appropriate form and by any suitable route.
  • the therapies are administered to a subject less than 15 minutes, less than 30 minutes, less than 1 hour apart, at about 1 hour apart, at about 1 hour to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 10 hours to about 11 hours apart, at about 11 hours to about 12 hours apart, 24 hours apart, 48 hours apart, 72 hours apart, or 1 week apart.
  • two or more therapies are administered to a within the same patient visit.
  • the prophylactic or therapeutic agents of the combination therapies can be administered to a subject in the same pharmaceutical composition.
  • the prophylactic or therapeutic agents of the combination therapies can be administered concurrently to a subject in separate pharmaceutical compositions.
  • the prophylactic or therapeutic agents may be administered to a subject by the same or different routes of administration.
  • 88 residues were selected for Cys substitution, 59 sites in hIgG heavy chain and 29 in human kappa light chain, based on the following criteria: 1) select residues in CH1, CH2 and CH3 domains of the constant regions of heavy chain and the constant regions of light chain; 2) select surface exposed residues but circumvent globally exposed residues and the C-terminal region to avoid inter-antibody dimer formation; 3) focus on polar or charged residues such as Ser, Thr, Lys, Arg, Glu, and Asp; and 4) exclude residues in FcRn binding domain, Protein A binding domain, and heavy chain hinge region.
  • Criterion 1) namely the selection of Cys substitution sites in the constant region of the antibody, assures transferability of the conjugation sites to many different antibodies.
  • Criterion 2) is based on observation of inter-antibody dimer formation for Cys substitutions of prominently exposed residues (residues excluded based on this criteria are listed in Table 6). Based on the IgG crystal structure, the putative orientation of the Cys side chain was taking into consideration: residues for which the Cys side chain may be partially shielded from interactions with another antibody but may still be reactive with a small molecular payload, were favored over residues with larger surface accessibility but with an orientation that may enable interactions with a large macromolecule such as dimer formation.
  • Criterion 3 was implemented to favor conservative mutations in order to minimize destabilizing effects of the mutations on the antibody.
  • criterion 4 was used to avoid functional changes to the antibody such as effects on FcRn and Protein A binding which may affect the antibody's pharmacokinetic properties or may result in the loss of a purification handle, respectively. Residues excluded based on criterion 4 are listed in Table 6. The location of the 88 selected mutation sites in the structure model of hIgG1/kappa indicates that the selected sites are surface accessible ( FIG. 2 ).
  • DNA encoding variable regions of heavy and light chains of trastuzumab were chemically synthesized and cloned into two mammalian expression vectors, pOG-HC and pOG-LC that contain constant regions of human IgG1 and human kappa light chain, resulting in two wild-type constructs, pOG-trastuzumab HC and pOG-trastuzumab LC, respectively.
  • pOG-HC and pOG-LC that contain constant regions of human IgG1 and human kappa light chain, resulting in two wild-type constructs, pOG-trastuzumab HC and pOG-trastuzumab LC, respectively.
  • the expression of antibody heavy and light chain constructs in mammalian cells is driven by a CMV promoter.
  • the vectors contain a synthetic 24 amino acid signal sequence: MKTFILLLWVLLLWVIFLLPGATA (SEQ ID NO: 99), in the N-terminal of heavy chain or light chain to guide their secretion from mammalian cells.
  • the signal sequence has been validated to be efficient in directing protein secretion in hundreds of mammalian proteins in 293 FreestyleTM cells.
  • Oligonucleotide directed mutagenesis was employed to prepare Cys mutant constructs in trastuzumab.
  • 88 pairs of mutation primers (Table 8) were chemically synthesized that correspond to the 88 Cys mutation sites selected in the constant regions of human IgG1 heavy chain and kappa light chain as described in Example 1.
  • PCR reactions were performed by using PfuUltra II Fusion HS DNA Polymerase (Stratagene) with pOG-trastuzumab HC and pOG-trastuzumab LC as the templates. After PCR reactions, the PCR products were confirmed on agarose gels, and treated with DPN I followed by transformation in DH5a cells (Klock et al., (2009) Methods Mol Biol. 498:91-103).
  • SEQ ID NO: 1 is the sequence for full-length trastuzumab (human IgG1).
  • SEQ ID NO: 2 to SEQ ID NO: 60 indicate the sequence ID numbers for 59 Cys mutant constructs in human IgG1 heavy chain, showing only the sequences of the constant region.
  • SEQ ID NO: 61 is the sequence of the constant region of wild-type human kappa light chain.
  • SEQ ID NO: 62 to SEQ ID NO: 90 indicate the sequence ID numbers for 29 Cys mutant constructs in the constant region of human kappa light chain.
  • the DNA encoding variable region of antibody 14090 was cloned into seven selected pOG trastuzumab HC Cys mutant plasmid constructs (SEQ ID NO listed in Table 11) to replace the variable regions of trastuzumab constructs in the plasmids as described in Example 2.
  • SEQ ID NO listed in Table 11 the amino acid sequences of the heavy chain constant regions in corresponding seven Cys constructs of antibody 14090 and trastuzumab are identical ( FIG. 3 ).
  • Subsequent examples show that these sites can be conjugated readily.
  • FIG. 3 due to a high degree of similarity in primary sequences and in tertiary structures for different human IgG isotypes.
  • Cys mutations on the kappa light chain of trastuzumab can readily be transferred to equivalent light chains on human antibodies containing different isotype heavy chains.
  • the sites identified in the constant region of IgG1 may be transferred to IgG2, IgG3 and IgG4.
  • FIG. 5A Human lambda and kappa light chains have little amino acid sequence similarity.
  • Mutations in the lambda light chain of antibody 14090 were selected based on the approximate similarity of the locations of the residues in a protein crystal structure model (Protein Databank structure entry 3G6D.pdb) of a Fab containing the human lambda light chain in reference to the desirable residues in the kappa light chain of trastuzumab ( FIGS. 5 A and B). Seven additional Cys mutant constructs were generated in antibody 14090-lambda light chain plasmid using oligonucleotide directed mutagenesis (Higuchi et al.
  • the mutation primers used to generate Cys point mutations in the lambda light chain are listed in Table 12.
  • the secretion of antibody 14090 is also directed by the synthetic 24 amino acid signal sequence: MKTFILLLWVLLLWVIFLLPGATA (SEQ ID NO: 99). Sequences of antibody 14090 Cys constructs were confirmed by DNA sequencing.
  • the sequence for the constant region of human wild-type lambda light chain is shown as SEQ ID NO:91.
  • the encoded protein sequences of seven Cys mutant constructs in the light chain (SEQ ID NO:92 to SEQ ID NO:98) are shown in Table 13. Subsequent examples will show that these Cys mutants are efficiently conjugated with an ADC payload. Because all of these mutants are in the constant region of the human lambda light chain, these conjugation sites can readily be transferred to other antibodies with lambda light chains.
  • SEQ ID NO: 91 is the sequence for the constant region of wild-type human lambda light chain.
  • SEQ ID NO: 91 to SEQ ID NO: 98 indicate the sequences of the 7 Cys mutants in the constant region of human lambda light chain of antibody 14090.
  • Cys mutants of the trastuzumab antibody were expressed in 293 FreestyleTM cells by co-transfecting heavy chain and light chain plasmids using transient transfection method as described previously (Meissner, et al., Biotechnol Bioeng. 75:197-203 (2001)).
  • the DNA plasmids used in co-transfection were prepared using Qiagen plasmid preparation kit according to manufacturer's protocol.
  • 293 FreestyleTM cells were cultured in suspension in FreestyleTM expression media (Invitrogen) at 37° C. under 5% CO 2 . On the day before transfection, cells were split to 0.7 ⁇ 10 6 cells/ml into fresh media. On the day of transfection, the cell density typically reached 1.5 ⁇ 10 6 cells/ml.
  • the cells were transfected with a mixture of heavy chain and light chain plasmids at the ratio of 1:1 using PEI method (Meissner et al., 2001). The transfected cells were further cultured for five days. The media from the culture was harvested by centrifugation of the culture at 2000 ⁇ g for 20 min and filtered through 0.2 micrometer filters. The expressed antibodies were purified from the filtered media using Protein A-SepharoseTM (GE Healthcare Life Sciences). Antibody IgGs were eluted from the Protein A-SepharoseTM column by the elution buffer (pH 3.0) and immediately neutralized with 1 M Tris-HCl (pH 8.0) followed by a buffer exchange to PBS.
  • the Cys mutants of antibody 14090 were also expressed in 293 FreestyleTM cells by co-transfecting HC and LC plasmids using PEI method as described (Meissner et al., 2001). The expression levels of the Cys mutants of antibody 14090 are similar to that of wild-type antibody 14090 (Table 16).
  • trastuzumab Cys mutant antibodies transiently expressed in 293 Freestyle TM cells. Yields were measured by UV absorbance at 280 nm after Protein A purification.
  • trastuzumab Purified trastuzumab Purified Cys mutant Ab (mg/L) Cys Mutant Ab (mg/L) HC-S117C 46.9 HC-R355C 30.1 HC-S119C 22.5 HC-K360C 32.0 HC-K121C 22.1 HC-Q362C 20.7 HC-S124C 17.8 HC-S375C 33.3 HC-S132C 30.9 HC-E382C 35.3 HC-S134C 18.6 HC-N389C 28.7 HC-S136C 21.2 HC-N390C 34.5 HC-T139C 25.9 HC-K392C 28.2 HC-E152C 13.0 HC-T393C 6.6 HC-P153C 10.8 HC-L3
  • engineered Cys in antibodies expressed in mammalian cells are modified by adducts (disulfides) such as glutathione (GSH) and/or Cysteine during their biosynthesis (Chen et al. 2009)
  • the modified Cys in the product as initially expressed is unreactive to thiol reactive reagents such as maleimido or bromo- or iodo-acetamide groups.
  • glutathione or cysteine adducts need to be removed by reducing these disulfides, which generally entails reducing all of the disulfides in the expressed protein.
  • DTT dithiothreitol
  • the antibodies are ready for conjugation.
  • Maleimide-MMAF (MC-MMAF, 10 equivalents relative to the antibody, FIG. 10 ) was added to re-oxidized antibodies in PBS buffer (pH7.2). The incubations were carried out from 1 hour to 24 hours.
  • the conjugation process was monitored by reverse-phase HPLC, which is able to separate conjugated antibodies from non-conjugated ones.
  • the conjugation reaction mixtures were analyzed on a PRLP-S 4000A column (50 mm ⁇ 2.1 mm, Agilent) heated to 80° C. and elution of the column was carried out by a linear gradient of 30-60% acetonitrile in water containing 0.1% TFA at a flow rate of 1.5 ml/min. The elution of proteins from the column was monitored at 280 nm, 254 nm and 215 nm.
  • the reverse-phase HPLC trace of a typical conjugation mixture is shown in FIG. 11 .
  • mismatched disulfide bonds may affect the retention of the antibody on the reverse-phase HPLC column.
  • the mismatch processes may also result in unpaired cysteine residues other than the desired engineered cysteine. Attachment of the maleimide-MMAF to different positions on the antibody affects the retention time differently (see discussion of homogenously conjugated ADCs below).
  • incomplete re-oxidation will leave the antibody with native cysteine residues that will react with maleimide-MMAF in addition to the desired conjugation with the engineered cysteine residue.
  • Cys-MMAF ADCs were analyzed in details in various assays: Differential scanning fluorimetry (DSF) was used to measure thermal stability. Analytical size exclusion chromatograph (AnSEC) was used to measure aggregation. In vitro antigen dependent cell killing potency was measured by cell viability assays and pharmacokinetics behavior was measured in mice. These assays and the respective results are described in more detail below.
  • the ADCs were analyzed in a size exclusion chromatography column (GE, Superdex200, 3.2/30) at a flow rate of 0.1 ml/min in PBS. All 65 Cys-MMAF ADCs were monomeric. The majority of the ADCs contain less than 10% oligomer ( FIG. 13 , Table 18), indicating that conjugation of MC-MMAF to trastuzumab Cys mutant constructs at the selected sites did not cause aggregation of the antibody.
  • trastuzumab Oligomer Conjugation Oligomer Cys-MMAF ADC site (%) HC-S117C b.d. HC-R344C 9.5 HC-S119C 3.2 HC-R355C b.d. HC-K121C b.d. HC-K360C b.d. HC-S124C b.d. HC-S375C b.d. HC-T139C 4.8 HC-E382C b.d. HC-E152C b.d.
  • Conjugation of MMAF payload to trastuzumab may stabilize or destabilize the antibody, leading to changes in melting temperature of the antibody, which can be determined by differential scanning fluorimetry (DSF) that is based on temperature induced denaturation monitored by an environmentally sensitive dye, such as sypro orange.
  • DSF differential scanning fluorimetry
  • ADC samples were aliquoted in triplicate to 384-well plates into PBS (6.7 mM sodium phosphate pH7.2; 150 mM NaCl). In each well, 8 ⁇ l of 0.25 mg/ml antibody was mixed with 2 ⁇ l 25 ⁇ sypro orange dye (Invitrogen). Plates were sealed and analyzed in a Roche LightCycler 480 system with a temperature ramp from 30 to 85° C. with 20 fluorescence scans recorded per degree C. Melting temperatures were determined from the first derivative of the fluorescence intensity vs. time curves.
  • a typical thermal shift assay for wild-type trastuzumab revealed two melting transitions (Tm), Tm1 at 69.7° C. and Tm2 at 81.2° C., respectively (Table 19).
  • trastuzumab Cys-MMAF ADCs Melting temperatures Tm1 and Tm2 of trastuzumab Cys-MMAF ADCs observed by differential scanning fluorimetry (DSF). trastuzumab Cys-MMAF ADC HC domain Tm1 [° C.] Tm2 [° C.] wild type antibody n.a.
  • MDA-MB231 clone 16 cells stably express high copy numbers ( ⁇ 5 ⁇ 10 5 copies/cell) of recombinant human Her2 while clone 40 expresses low copy numbers ( ⁇ 5 ⁇ 10 3 copies/cell) of human Her2.
  • HCC1954 cells endogenously express high level ( ⁇ 5 ⁇ 10 5 copies/cell) of human Her2 in the surface.
  • CMK11-5 and Jurkat cells were used for determination of the cell killing potency of antibody 14090 ADCs. While CMK11-5 cells express a high level of the antigen for antibody 14090 in the cell surface there is no detectable antigen expression in Jurkat cells. An antigen dependent cytotoxic effect should only kill cells that express sufficient antigen in the cell surface and not cells lacking the antigen.
  • the cell proliferation assays were conducted with Cell-Titer-GloTM (Promega) five days after cells were incubated with various concentrations of ADCs (Riss et al., (2004) Assay Drug Dev Technol. 2:51-62). In some studies, the cell based assays are high throughput and conducted in an automated system (Melnick et al., (2006) Proc Natl Acad Sci USA. 103:3153-3158).
  • Trastuzumab Cys-MMAF ADCs specifically killed MDA-MB231 clone 16 and HCC1954 but not MDA-MB231 clone 40 cells ( FIG. 15 ).
  • IC 50 of the trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16 cell assays ranges from 30 pM to 200 pM (Table 20, FIG. 16 ).
  • antibody 14090 Cys-MMAF ADC displayed antigen dependent cell killing in cell proliferation assays.
  • the antibody 14090 Cys-MMAF ADCs killed antigen expressing CMK11-5 cells but not antigen negative Jurkat cells ( FIG. 17 ).
  • the IC 50 of the antibody 14090-MMAF ADC in CMK11-5 proliferation assay is in the range of 400 pM to 1 nM (Table 21).
  • MMAF ADCs To evaluate the effects of different conjugation site on clearance of MMAF ADCs in vivo, pharmacokinetic studies in non-tumor bearing mice were carried out with 65 trastuzumab Cys-MMAF ADCs. To detect MMAF containing ADCs in murine plasma, an anti-MMAF antibody was generated. ELISA assays for the detection of ADCs were developed using the extracellular domain of human HER2 to capture trastuzumab IgG molecules from the plasma and an anti-human IgG (anti-hIgG) antibody and the anti-MMAF antibody for signal generation in two separate assays. The two ELISA assays measure the serum concentration of the trastuzumab antibody and the “intact” ADC respectively as discussed in more detail below.
  • mice per group were administered with a single dose of a trastuzumab Cys-MMAF ADC at 1 mg/kg.
  • Ten plasma samples were collected over the course of two weeks and assayed by ELISA using the extracellular domain of human HER2 to capture all trastuzumab IgG molecules including trastuzumab Cys-MMAF ADCs and trastuzumab lacking MMAF.
  • An anti-MMAF and an anti-hIgG antibody were then used for detection in two separate assays.
  • the anti-MMAF antibody ELISA measures the concentration of trastuzumab MMAF conjugates only and the anti-hIgG ELISA quantitates both trastuzumab Cys-MMAF conjugates and trastuzumab antibodies that lack MMAF. Standard curves were generated for each ADC separately using the same material as injected into the mice. The assays with anti-MMAF and anti-hIgG should therefore yield identical concentration readouts if no changes to the drug loading of the trastuzumab Cys-MMAF ADC occur after injection into mice.
  • the ELISA assay with the anti-MMAF antibody will measure a lower concentration than the anti-hIgG ELISA. A comparison of the two concentration readouts therefore allows to measure drug-release from trastuzumab Cys-MMAF ADCs during in vivo incubation in the mouse.
  • 63 out of 65 ADCs displayed a pharmacokinetic profile similar to unconjugated wild-type trastuzumab antibody ( FIGS. 18 , 19 , 20 ), indicating that MC-MMAF payload conjugation to these sites did not significantly affect the antibody's clearance.
  • the two exceptions are HC-T335C and HC-S337C. Conjugation of MC-MMAF to these two sites results in rapid clearance of the ADCs as measured by the anti-MMAF and the anti-hIgG ELISA ( FIG. 21 ).
  • the protein thermal shift assay revealed that the Tm1 for trastuzumab HC-T335C-MMAF and trastuzumab HC-S337C-MMAF decreased from 69° C. in wild-type trastuzumab antibody to 42° C. and 45° C., respectively ( FIG. 14 ).
  • Conjugation of MC-MMAF to the two sites dramatically reduces the thermal stability of the ADC (by 27° C. and 24° C., respectively).
  • Tm1 changes were smaller than 8° C. suggesting that fast clearance may possibly correlate with low thermal stability of the ADC.
  • trastuzumab Cys-MMAF ADCs displayed a significant drug loss as indicated by the higher anti-hIgG readout than the anti-MMAF readout ( FIG. 20 ).
  • concentration of ADC was about 50% of that of hIgG.
  • AUC area-under-the-plasma-concentration-versus-time-curve
  • Sites in Table 22 having an AUC(MMAF)/AUC(hIgG) ratio greater than 0.7 are therefore particularly suitable sites for cysteine substitution based on this criterion, and sites having a ratio of about 0.9 or above are especially preferred cysteine substitution sites for purposes of the invention when applying.
  • These include heavy chain sites 322, 334, 121, 288, 171, 139, 360, 117, 392, 375, 292, 333, 174, 258, 337, 422, 320, 390, and 335; and light chain sites 107, 203, 108 and 114.
  • Antibody conjugates produced through conjugation to lysine residues or partially reduced native disulfide bonds often feature drug-to-antibody-ratios (DAR) of between 3 and 4. Cys engineered antibodies more typically feature a DAR of 2. For certain indications, it may be desirable to produce ADCs with higher DAR which can in principle be achieved by introducing multiple Cys mutations in the antibody. As the number of Cys mutation increases, the likelihood that such mutations interfere with the required re-oxidation process during ADC preparation and hence result in heterogeneous products also increases. In this study, a large number of single site heavy and light chain Cys mutants with good re-oxidation behavior were identified.
  • DAR drug-to-antibody-ratios
  • the DAR of all ADCs in Table 23 was confirmed to be 4 by mass spectrometry. Production yields varied from 16 to 24 mg/L transient cell culture.
  • the ADCs were predominantly monomeric as determined by analytical size exclusion chromatography; only for 2 of the 8 antibodies could small amounts of aggregates be detected (Table 23).
  • Trastuzumab and 14090 ADCs exhibited antigen-dependent cell killing in MDA-MB231 clone 16 and CMK1105 cell proliferation assays, respectively (Table 23).
  • the surprisingly large differences in retention times can be rationalized from the inspection of location of the attachment sites on the structure of an antibody ( FIG. 24 ):
  • the retention times are higher if the drug payload is attached at an exposed site on the outside of an antibody, for example at HC-K288Pcl, HC-N286Pcl, HC-V422Pcl, HC-L398Pcl and HC-S415Pcl where retention time between 87 and 94 mM were measured for the respective ADCs ( FIG. 23 ).
  • the payload is attached at an interior site such as the cavity formed between variable and CH1 domains (for examples, HC-P153Pcl, HC-E152Pcl, HC-L174Pcl, HC-P171Pcl, LC-R142Pcl, LC-E161Pcl, LC-E165Pcl, LC-S159Pcl) or the large opening between CH2 and CH3 domains of the antibody (for examples, HC-K246C, HC-S375Pcl, HC-T393Pcl, HC-K334Pcl), the HIC retention time increased to only 47 to 57 mins because the payload is partially sequestered from interacting with solvent and the HIC column. For other sites, for example, the relatively exposed sites, LC-K107Pcl and HC-K360Pcl, intermediate retention time of 70 and 83 min were measured.
  • variable and CH1 domains for examples, HC-P153Pcl, HC-
  • Reducing hydrophobicity of a protein drug is generally considered beneficial because it may reduce aggregation and clearance from circulation.
  • HIC data presented in FIG. 23 enables selection of preferred payload attachment sites. Conjugating drug payloads at sites where they are sequestered from solvent interactions and attachment minimally increases the hydrophobicity of the antibody upon drug attachment should be beneficial independent of the conjugation chemistry and payload class. Carefully selecting attachment sites that result in minimal changes in hydrophobicity may be particularly beneficial when 4, 6 or 8 drugs are attached per antibody, or when particularly hydrophobic payloads are used.
  • HC-E333C, HC-K392C, and HC-K326C results in MMAF ADCs that have HIC retention times that are similar to the exposed site ADCs LC-K107C-MMAF, HC-E258C-MMAF, HC-R292C-MMAF and HC-K360C-MMAF (Table 28).
  • Attachment to the HC-E152C, LC-E165C, HC-P171C, LC-R142C, LC-E161C, HC-L174C and HC-S124C sites increases the retention time of the resulting ADC by less than 15% compared to the unconjugated, wild-type antibody.
  • CH3 domain sites HC-K334C and HC-S375C exhibit to lowest increase in hydrophobicity upon conjugation making them preferred attachment sites.
  • Cys mutant sites Cys mutant site Site (EU No.) LC-R142C 142 LC-S159C 159 LC-E161C 161 LC-E165C 165 HC-S124C 124 HC-E152C 152 HC-P171C 171 HC-L174C 174 HC-K326C 326 HC-E333C 333 HC-K334C 334 HC-S375C 375 HC-K392C 392
  • Cys mutations can be combined for the preparation of DAR 4, 6 and 8 ADCs.
  • the preferred combination is a combination of two Cys mutations resulting in ADCs with DAR 4.
  • HC heavy chain
  • LC light chain
  • Example 10 for trastuzumab and for antibody 14090. Additional data is provided in Table 26. Based on the HIC data and the inspection of attachment sites in the IgG crystal structures, additional Cys combinations were prepared using the protocols described in Examples 2, 5 and 6. Data for selected examples of MMAF ADCs are shown in Table 26.
  • selected heavy chain sites were combined and double Cys mutations of the heavy chain were cloned following protocols listed in Example 2.
  • Antibodies featuring two HC Cys mutations were prepared and conjugated following protocols described in Example 5 and 6.
  • combinations include single site mutations listed in Table 24. Combinations of single sites resulted in ADCs with low hydrophobicity (Table 25). In the some combination, one Cys mutation is located in the CH1 domain or on the light chain and the second site is located in the CH3 domain. Examples of such combinations are antibodies featuring Cys mutant combinations of HC-E152C and HC-S375C, and LC-E165C and HC-S375C, and HC-E152C and HC-K334C, and LC-E165C and HC-K334C.
  • ADCs with DAR 6 and 8 can also be prepared when three or four Cys mutations are combined in one antibody. Selected heavy chain combinations were combined for the preparations of DAR 4, 6 and 8 ADCs. Double and triple Cys mutations of the heavy chain were cloned following protocols listed in Example 2. Antibodies featuring two, three and four Cys mutations were prepared and conjugated following protocols described in Example 5 and 6. The characteristics of some DAR 4, DAR 6 and DAR 8 ADC examples are summarized in Table 26. Some of these ADCs have surprisingly good PK properties as shown in FIG. 25 . Antibody 14090 is mouse cross-reactive and therefore, antibody 14090 ADCs, as expected, are cleared more rapidly than trastuzumab ADCs which do not bind to any mouse antigens.
  • Combinations include those with three and four of the single site mutations listed in Table 24. Combinations include those sites that resulted in ADCs with low hydrophobicity (Table 25). Combinations include one Cys mutation is located in the CH1 domain or on the light chain (LC), and optionally an additional one to three sites are in the CH3 domain. Examples of such combinations include antibodies featuring Cys mutant combinations of HC-E152C or LC-E165C, with HC-S375C, with HC-K334C, and/or HC-K392C. Preferred combinations for the preparation of DAR 6 and DAR 8 ADCs are shown in Table 27 and Table 28 respectively.
  • ADC combination Site 1 Site 2 Site 3 1 HC-E152C HC-S375C HC-K392C 2 HC-E152C HC-S375C HC-K334C 3 HC-E152C HC-K334C HC-K392C 4 LC-E165C HC-S375C HC-K392C 5 LC-E165C HC-S375C HC-K334C 6 LC-E165C HC-K334C HC-K392C
  • ADC combination Site 1 Site 2 Site 3 Site 4 1 HC-E152C HC-S375C HC-K334C HC-K392C 2 HC-E152C HC-S375C HC-E333C HC-K392C 3 LC-E165C HC-S375C HC-K334C HC-K392C 4 LC-E165C HC-S375C HC-E333C HC-K392C
  • In vivo xenograft tumor models simulate biological activity observed iby grafting relevant and well characterized human primary tumors or tumor cell lines into immune-deficient nude mice.
  • Studies on treatment of tumor xenograft mice with anti-cancer reagents have provided valuable information regarding in vivo efficacy of the tested reagents (Sausville and Burger, 2006).
  • MDA-MB231 clone 16 cells were sensitive to trastuzumab Cys-MMAF ADCs in antigen dependent manner ( FIG. 15 ), the cell line was chosen as the in vivo model to evaluate the trastuzumab Cys-MMAF ADCs.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The present invention provides specific sites for modifying antibodies or antibody fragments by replacing at least one native amino acid in the constant region of a parental antibody or antibody fragment with cysteine, which can be used as a site of attachment for a payload or linker-payload combination.

Description

    FIELD OF THE INVENTION
  • Due to the importance of antibodies for various therapeutic applications, there is a need for robust methods to selectively modify antibodies to introduce improved properties or additional functions. The invention provides specific sites for attaching moieties to antibodies for making modified antibodies, such as for use in preparation of antibody-drug conjugates (ADCs). The selective conjugation sites are located on constant regions of the antibody and thus are useful with various antibodies.
  • BACKGROUND
  • The value of methods for modifying antibodies is well known, and many methods for conjugation of antibodies to attach various “payload” moieties have been developed. Many of these methods rely upon the natural occurrence of specific reactive amino acid residues on the antibody, such as lysine and cysteine, which can be used to attach a payload. However, relying on the native amino acids is not always desirable, because the location and amount of payload attached depend on the number and position of those reactive amino acids: too many or too few such residues make it difficult to efficiently control loading of the payload onto the antibody. In addition, placement of the reactive amino acids may make it difficult to get complete conjugation, resulting in heterogeneous products during conjugation. Heterogeneity of a pharmaceutical active ingredient, for example, is typically undesirable because it compounds the unpredictability of administering a drug to a heterogeneous population of subjects: it is far preferable to administer a homogeneous product, and far more difficult to fully characterize and predict behavior of a heterogeneous one. Site-specific conjugation of a cytotoxic drug to an antibody through, for example, engineered cysteine residues results in homogenous immunoconjugates that exhibit improved therapeutic index (Junutula et al., (2008) Nat Biotechnol. 26(8):925-932)).
  • Antibodies have been engineered to add certain residues like cysteine in specific positions where these residues can be used for conjugation (Lyons et al., (1990) Protein Eng., 3:703-708), but the value of specific substitutions can vary with certain antibodies, as engineered cysteine might interfere with folding of the antibody and oxidation of the proper intra-molecular disulfide bonds (Voynov et al., (2010) Bioconjug. Chem. 21(2):385-392).
  • Because engineered cysteines in antibodies expressed in mammalian cells are modified through disulfide bonds with glutathione (GSH) and/or cysteine during their biosynthesis (Chen et al. (2009) mAbs 1:6, 563-571), the modified cysteine(s) in the antibody drug conjugate product as initially expressed is unreactive to thiol reactive reagents. Activation of the engineered cysteine(s) requires reduction of the GSH and/or cysteine adduct (which typically results in reduction of all inter-chain disulfide bonds of the antibody), followed by reoxidation and reformation of the native, inter-chain disulfide bonds prior to conjugation (Junutula et al., (2008) Nat. Biotechnol. 26(8):925-32). Some of the sites where cysteine has been inserted interfere with the process of reoxidation and subsequently result in undesirable, non-homogeneous conjugation products. It is therefore important to identify sites on the antibody where the introduced cysteine does not interfere with the reoxidation process prior to the conjugation with a thiol reactive reagent such as maleimide or bromo-, chloro- or iodo-acetamide groups.
  • Conjugation of cysteine residues with bromo-acetamide, iodo-acetamide or chloro-acetamide results in the formation of a stable thioether linkage. (Alley et al., (2008) Bioconjug Chem. 19(3):759-65). However, the chemistry is less efficient than maleimide conjugation chemistry. Since forming such thiol-maleimide linkages is a popular and highly efficient method to use when attaching a payload or linker to cysteine, there is a need to identify cysteine substitution sites on an antibody where maleimide linkages can be used. More importantly, site-specifically conjugated immunoconjugates can exhibit improved therapeutic index, thus there remains a need to identify specific privileged sites for cysteine substitution in antibodies that enables conjugation of payloads onto antibodies to form efficiently, and that provide conjugates having high stability. The instant invention provides such privileged cysteine substitution sites that give improved antibodies for conjugation purposes and immunoconjugates comprising such improved antibodies.
  • SUMMARY OF THE INVENTION
  • The invention provides specific sites in the constant region of an antibody or antibody fragment at which cysteine (“Cys”) replacement of the native amino acid on a parental antibody or antibody fragment can be performed in order to provide a Cys residue for attachment of a chemical moiety (e.g., payload/drug moiety) to form an immunoconjugate with good efficiency and stability. The invention further provides engineered antibodies or antibody fragments having one or more Cys residues in one or more of these specific sites, as well as immunoconjugates made from such engineered antibodies or antibody fragments.
  • Methods for inserting Cys at specific locations of an antibody are known in the art, see, e.g., WO 2011/005481. However, the current invention discloses specific sites in the constant region of antibodies or antibody fragments where replacing one or more native amino acids of a parental antibody or antibody fragment with Cys provides one or more of the following advantages: Good reactivity to promote efficient immunoconjugation; reduced propensity for loss of payload when a Cys-maleimide conjugation linker is used; a reduced tendency to form undesired disulfide linkages, such as cross-linking between antibodies or the formation of non-native intramolecular disulfide bonds; and low hydrophobicity of the resulting ADC.
  • The specific privileged sites for Cys replacement of native amino acids in the constant region of a parental antibody or antibody fragment are selected to provide efficient conjugation while minimizing undesired effects. First, the specific sites for modification are selected so that replacing the native amino acid of a parental antibody or antibody fragment with Cys in one or more of the selected locations provides antibodies or antibody fragments that are readily conjugated on the new cysteine. The specific locations are selected to be sufficiently surface-accessible to allow the sulfhydryl of the cysteine residue to be reactive towards electrophiles in aqueous solutions. The identification of suitable sites for Cys replacement of native amino acids of a parental antibody or antibody fragment involved analyzing surface exposure of the native amino acids based on crystal structure data. Because the sites described herein are sufficiently accessible and reactive, they can be used to form immunoconjugates via chemistry that is well known in the art for modifying naturally-occurring cysteine residues. Conjugation of the replacement Cys residues thus uses conventional methods.
  • Selected modification sites can show a low propensity for reversal of conjugation when thiol-maleimide moieties are used in the conjugation. The thiol-maleimide conjugation reaction is often highly selective and extremely efficient, and may be used either to attach a payload to the thiol of a cysteine residue of a protein or as a linker elsewhere in the linkage between protein and payload. For example, a maleimide can be attached to a protein (e.g., an antibody or antibody fragment), and a payload having an attached thiol can be added to the maleimide to form a conjugate:
  • Figure US20160067351A1-20160310-C00001
  • Accordingly, in this conjugation step, the protein (e.g., an antibody or antibody fragment) could be either the single circle or the double circle; the other would represent the payload. The immunoconjugate stability information here specifically relates to conjugation of the substituted cysteine by reaction with a maleimide group. In some embodiments, the thiol is from a cysteine on the protein (e.g., an antibody or antibody fragment), so the double circle represents the protein and the single circle represents a payload.
  • While the thiol-maleimide reaction is often used for making conjugates, reversal of the conjugation step as depicted below can result in loss of payload or scrambling of payload with other thiol-containing species:
  • Figure US20160067351A1-20160310-C00002
  • It has been reported that some sites for cysteine substitution provide more stable maleimide conjugates than others, presumably because the local chemical environment at certain points on the antibody surface around a new cysteine can promote the hydrolysis of the succinimide ring and hence prevent reversal of the thiol-maleimide linkage in the immunoconjugate (Shen et al. (2012), Nat. Biotechnol. 30(2):184-9). The identification of the advantageous sites for meeting this criterion involved inserting Cys in place of many of the native amino acids having suitable surface exposure, making immunoconjugates containing a thiol-maleimide linkage, and assessing stability of the immunoconjugate in order to eliminate sites where the stability of the conjugate was reduced by the local microenvironment around destabilizing sites. Because of this, the chemistry that can be used to attach linkers and payloads to the replacement Cys residues is not limited by the stability problems associated with the reversibility of thiol-maleimide conjugates that is discussed above. A number of methods can be used to form conjugates at cysteine, including maleimide conjugation. The sites for cysteine substitution described herein promote stability of the antibody conjugate product when using one of the most common conjugation methods, making these sites advantageous for antibody engineering, because the modified antibody can be used with the well-known and highly efficient maleimide conjugation methodology. Selection of sites based on this criterion is illustrated by data presented in Table 22 and Example 9.
  • Selected sites can be positioned so as to minimize undesired disulfide formation that may interfere with formation of a homogeneous conjugate. When antibodies or antibody fragments containing engineered cysteines are produced in mammalian cells, the Cys residues are typically present as disulfides to a free Cys amino acid or to glutathione (Chen et al., (2009) mAbs 16, 353-571). To free the Cys residues for conjugation with thiol reactive groups, the antibody or antibody fragment needs to be reduced, breaking all of the disulfide bonds. The antibody or antibody fragment is then reoxidized under conditions that facilitate formation of the native disulfides that stabilize the antibody or antibody fragment. Upon reoxidation, cysteine residues that are too prominently exposed on the surface of the antibody or antibody fragment can form disulfides by reaction with Cys on another antibody or antibody fragment (“inter-antibody disulfides”), or by forming undesired intra-antibody disulfides. It has been found that cysteine residues placed in the specific sites described herein are suitably accessible to be available for efficient conjugation, but are sufficiently shielded or suitably positioned to reduce or eliminate formation of inter-antibody and intra-antibody disulfide bonds that would otherwise occur during the reduction/reoxidation procedures typically needed when expressing cys-modified antibodies. Similarly, after re-oxidation some sites were found to produce non-homogenous conjugation products that appear to be due to the location of the new Cys residue engineered into the protein, and the specific sites identified herein are ones where such heterogeneity is minimized.
  • Conjugating drug payloads at sites where they are sequestered from solvent interactions and attachment can increase the hydrophobicity of the antibody upon drug attachment is preferred as reducing hydrophobicity of a protein drug is generally considered beneficial because it might reduce aggregation and clearance from circulation. Selecting attachment sites that result in minimal changes in hydrophobicity might be particularly beneficial when 4, 6 or 8 drugs are attached per antibody, or when particularly hydrophobic payloads are used.
  • Sites for Cys incorporation were evaluated using these and additional methods described in the Examples herein, leading to the selection of preferred sites for Cys incorporation for engineering antibodies or antibody fragments to introduce Cys as a site for conjugation, especially for making ADCs. Additional details regarding the selection of the specific sites for replacing a natural amino acid of an antibody with Cys are provided herein.
  • Cysteine substitution sites are located in the constant region of an antibody or antibody fragment, and are identified herein using standard numbering conventions. It is well known, however, that portions or fragments of antibodies can be used for many purposes instead of intact full-length antibodies, and also that antibodies can be modified in various ways that affect numbering of sites in the constant region even though they do not substantially affect the functioning of the constant region. For example, insertion of an S6 tag (a short peptide) into a loop region of an antibody has been shown to allow activity of the antibody to be retained, even though it would change the numbering of many sites in the antibody. Accordingly, while the preferred cysteine substitution sites described herein are identified by a standard numbering system based on intact antibody numbering, the invention includes the corresponding sites in antibody fragments or in antibodies containing other modifications, such as peptide tag insertion. The corresponding sites in those fragments or modified antibodies are thus preferred sites for cysteine substitution in fragments or modified antibodies, and references to the cysteine substitution sites by number include corresponding sites in modified antibodies or antibody fragments that retain the function of the relevant portion of the full-length antibody.
  • A corresponding site in an antibody fragment or modified antibody can readily be identified by aligning a segment of the antibody fragment or modified antibody with the full-length antibody to identify the site in the antibody fragment or modified antibody that matches one of the preferred cysteine substitution sites of the invention. Alignment may be based on a segment long enough to ensure that the segment matches the correct portion of the full-length antibody, such as a segment of at least 20 amino acid residues, or at least 50 residues, or at least 100 residues, or at least 150 residues. Alignment may also take into account other modifications that may have been engineered into the antibody fragment or modified antibody, thus differences in sequence due to engineered point mutations in the segment used for alignment, particularly for conservative substitutions, would be allowed. Thus, for example, an Fc domain can be excised from an antibody, and would contain amino acid residues that correspond to the cysteine substitution sites described herein, despite numbering differences: sites in the Fc domain corresponding to the cysteine substitution sites of the invention would also be expected to be advantageous sites for cysteine substation in the Fc domain, and are included in the scope of the invention.
  • In one embodiment, the invention provides an immunoconjugate of Formula (I):
  • Figure US20160067351A1-20160310-C00003
  • wherein Ab represents an antibody or antibody fragment comprising at least one cysteine residue at one of the preferred cysteine substitution sites described herein;
  • LU is a linker unit as described herein;
  • X is a payload or drug moiety;
  • and n is an integer from 1 to 16.
  • Typically in compounds of Formula (I), LU is attached to a cysteine at one of the cysteine substitution sites described herein, X is a drug moiety such as an anticancer drug, and n is 2-8 when Ab is an antibody, or n can be 1-8 when Ab is an antibody fragment.
  • In an embodiment, the invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system.
  • In an embodiment, the invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is human kappa light chain.
  • In an aspect embodiment, the invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 143, 147, 159, 163, and 168 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
  • In an embodiment, the invention provides a modified antibody or antibody fragment thereof comprising a substitution of one or more amino acids with cysteine at the positions described herein. The sites for cysteine substitution are in the constant regions of the antibody and are thus applicable to a variety of antibodies, and the sites are selected to provide stable and homogeneous conjugates. The modified antibody or fragment can have two or more cysteine substitutions, and these substitutions can be used in combination with other antibody modification and conjugation methods as described herein.
  • In an embodiment, the invention provides pharmaceutical compositions comprising the immunoconjugate disclosed above, and methods to use the immunoconjugates.
  • In an embodiment, the invention provides a nucleic acid encoding the modified antibody or antibody fragment described herein having at least one cysteine substitution at a site described herein. The invention further provides host cells comprising these nucleic acids and methods to use the nucleic acid or host cells to express and produce the antibodies or fragments described herein.
  • In an embodiment, the invention provides a method to select an amino acid of an antibody that is suitable for replacement by cysteine to provide a good site for conjugation, comprising:
  • (1) identifying amino acids in the constant region of the antibody that have a suitable surface exposure to provide a set of initial candidate sites;
  • (2) for each initial candidate site, expressing an antibody wherein the native amino acid at that site is replaced by cysteine;
  • (3) for each expressed antibody, determining whether the expressed protein is substantially homogeneous after reduction and reoxidation to provide a functional antibody having a free cysteine at the initial candidate site,
  • (4) for each expressed protein that is substantially homogeneous and functional, conjugating the cysteine at the initial candidate site with a maleimide moiety and determining whether the thiol-maleimide linkage is stable at that site;
  • (5) removing from the set of initial candidate sites those sites for which the expressed antibody is not substantially homogeneous and functional, and those wherein the thiol-maleimide linkage is destabilized, to provide a set of advantaged sites for cysteine substitution.
  • Optionally, the method further comprises a step of determining the melting temperature for the conjugate of each advantaged cysteine substitution site, and eliminating from the set any sites where cysteine substitution and conjugation causes the melting temperature to differ by 5° C. or more from that of the native antibody.
  • In an embodiment, the invention provides a method to produce an immunoconjugate, which comprises attaching a Linker Unit (LU) or a Linker Unit-Payload combination (-LU-X) to a cysteine residue in an antibody or antibody fragment, wherein the cysteine is located at a cysteine substitution site selected from 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of a heavy chain of said antibody or antibody fragment, and positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system.
  • Other aspects and embodiments of the invention are described in greater detail herein.
      • 1. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region at a site selected from positions 121, 124, 152, 171, 174, 258, 292, 333, 334, 360, 375, and 392 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system.
      • 2. The immunoconjugate of embodiment 1, wherein the substitution of one or more amino acids with cysteine is selected from positions 121, 124, 152, 258, 334, 360, and 392.
      • 3. The immunoconjugate of embodiments 1 or 2, wherein said antibody or antibody fragment comprises a sequence selected from the group consisting of SEQ ID NOs: 4, 5, 10, 17, 18, 29, 35, 42, 43, 48, 50, 54, 290, 291, 292, 293, 294, and 295.
      • 4. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region at a site selected from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain.
      • 5. The immunoconjugate of embodiment 4, wherein the substitution of one or more amino acids with cysteine is selected from positions 145 or 165.
      • 6. The immunoconjugate of embodiment 4, wherein said antibody or antibody fragment comprises a sequence selected from the group consisting of SEQ ID NOs: 61, 62, 69, 71, 75, 76, and 77.
      • 7. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region at a site selected from positions 143, 147, 159, 163, and 168 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is human a lambda light chain.
      • 8. The immunoconjugate of embodiment 7, wherein said antibody or antibody fragment comprises a sequence selected from the group consisting of SEQ ID NOs: 92, 94, 96, 97, and 98.
      • 9. The immunoconjugate of embodiment 1, 2, or 3, wherein said modified antibody or antibody fragment further comprises a substitution of one or more amino acids with cysteine on its constant region at a site selected from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain.
      • 10. The immunoconjugate of embodiment 1, 2, or 3, wherein said modified antibody or antibody fragment further comprises a substitution of one or more amino acids with cysteine on its constant region selected from positions 143, 147, 159, 163, and 168 of a light chain of said antibody or antibody fragment, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is a human kappa light chain.
      • 11. An immunoconjugate comprising a modified antibody or antibody fragment thereof wherein said modified antibody or antibody fragment comprises a combination of substitutions of two or more amino acids with cysteine on a constant region of a heavy chain at positions 152 and 375, or at positions 327 and 375, wherein said positions are numbered according to the EU system.
      • 12. An immunoconjugate comprising a modified antibody or antibody fragment thereof wherein said modified antibody or antibody fragment comprises a combination of substitution of two or more amino acids with cysteine on its constant regions comprising position 107 of a light chain and 360 of a heavy chain, wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
      • 13. An immunoconjugate comprising a modified antibody or antibody fragment thereof wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region selected from positions 117, 119, 121, 124, 139, 152, 153, 155, 157, 164, 169, 171, 174, 189, 205, 207, 246, 258, 269, 274, 286, 288, 290, 292, 293, 320, 322, 326, 333, 334, 335, 337, 344, 355, 360, 375, 382, 390, 392, 398, 400 and 422 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system.
      • 14. An immunoconjugate comprising a modified antibody or antibody fragment thereof wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region selected from positions 107, 108, 109, 114, 129, 142, 143, 145, 152, 154, 156, 159, 161, 165, 168, 169, 170, 182, 183, 197, 199, and 203 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain.
      • 15. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine selected from positions 143, 145, 147, 156, 159, 163, and 168 on its constant region of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is a human lambda light chain.
      • 16. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a combination of substitution of two or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions at positions 375 of an antibody heavy chain and position 165 of an antibody light chain, or at position 334 of an antibody heavy chain at position 165 of an antibody light chain, and wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
      • 17. The immunoconjugate of any of embodiments 11, 12, and 16 wherein the drug antibody ratio is about 4.
      • 18. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a combination of substitution of three or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions selected from
        • a. positions 375 and 392 of the an antibody heavy chain and position 165 of an antibody light chain,
        • b. positions 334 and 375 of an antibody heavy chain and position 165 of an antibody light chain, and
        • c. positions 334 and 392 of an antibody heavy chain and position 165 of an antibody light chain,
        • and wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
      • 19. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a combination of substitution of three or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions selected from
        • a. positions 152, 375 and 392 of the an antibody heavy chain,
        • b. positions 152, 334 and 375 of an antibody heavy chain, and
        • c. positions 152, 334 and 392 of an antibody heavy chain, and wherein said positions are numbered according to the EU system.
      • 20. The immunoconjugates of embodiments 18 or 19 wherein the drug antibody ratio is about 6.
      • 21. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment thereof comprises a combination of substitution of four or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions at positions 334, 375, and 392 of an antibody heavy chain and position 165 of an antibody light chain, or at positions 333, 375, and 392 of an antibody heavy chain and at position 165 of an antibody light chain, and wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
      • 22. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment thereof comprises a combination of substitution of four or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions at positions 152, 334, 375, and 392 of an antibody heavy chain, or at positions 152, 333, 375, and 392 of an antibody heavy chain, and wherein said positions are numbered according to the EU system.
      • 23. The immunoconjugates of embodiment 21 or 22 wherein the drug antibody ratio is about 8.
      • 24. The immunoconjugate of any of embodiments 1-23 further comprising a drug moiety.
      • 25. The immunoconjugate of embodiment 24, wherein a drug moiety is attached to the modified antibody or antibody fragment through the sulfur of said cysteine and an optional linker.
      • 26. The immunoconjugate of embodiment 25, wherein said drug moiety is connected to said sulfur of said cysteine through a cleavable or non-cleavable linker.
      • 27. The immunoconjugate of embodiment 25, wherein said drug moiety is connected to said sulfur of said cysteine through a non-cleavable linker.
      • 28. The immunoconjugate of embodiment 25, wherein said immunoconjugate comprises a thiol-maleimide linkage.
      • 29. The immunoconjugate of embodiment 25, wherein said immunoconjugate comprises a —S—CH2—C(═O)— linkage or a disulfide linkage.
      • 30. The immunoconjugate of any of embodiments 25-29, wherein said drug moiety is a cytotoxic agent.
      • 31. The immunoconjugate of embodiment 30, wherein said drug moiety is selected from the group consisting of taxanes, DNA-alkylating agents (e.g., CC-1065 analogs), anthracyclines, tubulysin analogs, duocarmycin analogs, auristatin E, auristatin F, and maytansinoids.
      • 32. The immunoconjugate of any of embodiments 1-31, wherein said antibody is a monoclonal antibody.
      • 33. The immunoconjugate of any of embodiments 1-31, wherein said antibody is a chimeric antibody.
      • 34. The immunoconjugate of embodiment 31, wherein said antibody is a humanized or fully human antibody.
      • 35. The immunoconjugate of embodiment 31, wherein said antibody is a bispecific or multi-specific antibody.
      • 36. The immunoconjugate of any of embodiments 1-32, wherein said antibody or antibody fragment specifically binds to a cell surface marker characteristic of a tumor.
      • 37. A pharmaceutical composition comprising the immunoconjugate of any of embodiments 1-36.
      • 38. A modified antibody or antibody fragment thereof comprising a substitution of one or more amino acids with cysteine on its constant region selected from positions 117, 119, 121, 124, 139, 152, 153, 155, 157, 164, 169, 171, 174, 189, 205, 207, 246, 258, 269, 274, 286, 288, 290, 292, 293, 320, 322, 326, 333, 334, 335, 337, 344, 355, 360, 375, 382, 390, 392, 398, 400, and 422 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system.
      • 39. A modified antibody or antibody fragment thereof comprising a substitution of one or more amino acids with cysteine on its constant region selected from positions 107, 108, 109, 114, 129, 142, 143, 145, 152, 154, 156, 159, 161, 165, 168, 169, 170, 182, 183, 197, 199, and 203 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is human kappa light chain.
      • 40. A modified antibody or antibody fragment thereof comprising a substitution of one or more amino acids with cysteine on its constant region selected from positions 143, 145, 147, 156, 159, 163, 168 on its constant region of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
      • 41. The modified antibody or antibody fragment of embodiment 38, wherein said substitution is at least one cysteine, selected from positions 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of the heavy chain, and wherein said positions are numbered according to the EU system.
      • 42. The modified antibody or antibody fragment of embodiment 39, wherein said substitution is two to six cysteines, wherein said cysteines are at positions selected from 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of a heavy chain, and wherein said positions are numbered according to the EU system.
      • 43. The modified antibody or antibody fragment of embodiment 39, wherein said substitution is at least one cysteine, selected from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain.
      • 44. The modified antibody or antibody fragment of embodiment 40, wherein said substitution is two to six cysteines, wherein said cysteines are at positions selected from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain.
      • 45. The modified antibody or antibody fragment of embodiment 40, wherein said substitution is at least one cysteine, selected from positions 143, 147, 159, 163, and 168 of a light chain, wherein said positions are numbered according to the Kabat system, and wherein said light chain is a human lambda light chain.
      • 46. The modified antibody or antibody fragment of embodiment 40, wherein said substitution is two to six cysteines, wherein said cysteines are at positions selected from positions 143, 147, 159, 163, and 168 of a light chain, wherein said positions are numbered according to the Kabat system, and wherein said light chain is a human lambda light chain.
      • 47. The modified antibody or antibody fragment of any of embodiment 11, 12, 14-22, 38-47 which is further attached to a drug moiety, and wherein said drug moiety is attached to the modified antibody or antibody fragment through the sulfur of said cysteine and an optional linker.
      • 48. The modified antibody or antibody fragment of embodiment 47, wherein said drug moiety is attached to the sulfur of said cysteine through a Linker Unit
      • 49. The modified antibody or antibody fragment of any of embodiment 38-48, further comprising at least one Pcl or unnatural amino acid substitution or a peptide tag for enzyme-mediated conjugation and/or combinations thereof
      • 50. A nucleic acid encoding the modified antibody or antibody fragment of any of embodiment 38-49.
      • 51. A host cell comprising the nucleic acid of embodiment 50.
      • 52. A method of producing a modified antibody or antibody fragment comprising incubating the host cell of embodiment 49 under suitable conditions for expressing the antibody or antibody fragment, and isolating said antibody or antibody fragment.
      • 53. A method to select an amino acid of an antibody that is suitable for replacement by cysteine to provide a suitable site for conjugation, comprising
        • (1) identifying amino acids in the constant region of the antibody that have a suitable surface exposure to provide a set of initial candidate sites;
        • (2) for each initial candidate site, expressing an antibody wherein the native amino acid at that site is replaced by cysteine;
        • (3) for each expressed antibody, determining whether the expressed protein is substantially homogeneous after reduction and reoxidation to provide a functional antibody having a free cysteine at the initial candidate site,
        • (4) for each expressed protein that is substantially homogeneous and functional, conjugating the cysteine at the initial candidate site with a maleimide moiety and determining whether the thiol-maleimide linkage is destabilized at that site;
        • (5) removing from the set of initial candidate sites those sites for which the expressed antibody is not substantially homogeneous and functional, and those wherein the thiol-maleimide linkage is destabilized, to provide a set of advantaged sites for cysteine substitution.
      • 54. The method of embodiment 53, further comprising a step of determining the melting temperature for the conjugate of each advantaged cysteine substitution site, and eliminating from the set any sites where cysteine substitution and conjugation causes the melting temperature to differ by 5° C. or more from that of the parental antibody.
      • 55. The method of embodiment 53 or 54, further comprising producing an antibody or antibody fragment containing cysteine at one or more of the substitution sites identified.
      • 56. A method to produce an immunoconjugate, which comprises attaching a Linker Unit (LU) or a Linker Unit-Payload combination (-LU-X) to a cysteine residue in an antibody or antibody fragment, wherein the cysteine is located at a cysteine substitution site selected from 121, 124, 152, 171, 174, 258, 292, 333, 360, and 375 of a heavy chain of said antibody or antibody fragment, and positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system.
      • 57. The method of embodiment 56, wherein the immunoconjugate is of Formula (I):
  • Figure US20160067351A1-20160310-C00004
        • wherein Ab represents an antibody or antibody fragment comprising at least one cysteine residue at one of the preferred cysteine substitution sites described herein;
        • LU is a linker unit as described herein;
        • X is a payload or drug moiety;
        • and n is an integer from 1 to 16.
    DEFINITIONS
  • The term “amino acid” refers to canonical, synthetic, and unnatural amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the canonical amino acids. Canonical amino acids are proteinogenous amino acids encoded by the genetic code and include alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline serine, threonine, tryptophan, tyrosine, valine, as well as selenocysteine, pyrrolysine and its analog pyrroline-carboxy-lysine. Amino acid analogs refer to compounds that have the same basic chemical structure as a canonical amino acid, i.e., an α-carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., citrulline, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a canonical amino acid.
  • Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a canonical amino acid. The term “unnatural amino acid”, as used herein, is intended to represent amino acid structures that cannot be generated biosynthetically in any organism using unmodified or modified genes from any organism, whether the same or different. In addition, such “unnatural amino acids” typically require a modified tRNA and a modified tRNA synthetase (RS) for incorporation into a protein. This tRNA/RS pair preferentially incorporates the unnatural amino acid over canonical amino acids. Such orthogonal tRNA/RS pair is generated by a selection process as developed by Schultz et al. (see, e.g., Liu et al., (2010) Annu. Rev. Biochem. 79:413-444) or a similar procedure. The term “unnatural amino acid” does not include the natural occurring 22nd proteinogenic amino acid pyrrolysine (Pyl) as well as its demethylated analog pyrroline-carboxy-lysine (Pcl), because incorporation of both residues into proteins is mediated by the unmodified, naturally occurring pyrrolysyl-tRNA/tRNA synthetase pair and because Pyl and Pcl are generated biosynthetically (see, e.g., Ou et al., (2011) Proc. Natl. Acad. Sci. USA, 108:10437-10442; Cellitti et al., (2011) Nat. Chem. Biol. 27;7(8):528-30). See also U.S. provisional application 61/76,236, incorporated by reference, that sites specific amino acid residues in antibody light and heavy chains that can be substituted with Pcl.
  • The term “antibody” as used herein refers to a polypeptide of the immunoglobulin family that is capable of binding a corresponding antigen non-covalently, reversibly, and in a specific manner. For example, a naturally occurring IgG antibody is a tetramer comprising at least two heavy (H) chains (also referred to as “antibody heavy chain”) and two light (L) chains (also referred to as “antibody light chain”) inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hyper variability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • The term “antibody” includes, but is not limited to, monoclonal antibodies, human antibodies, humanized antibodies, camelid antibodies, chimeric antibodies, and anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention). The antibodies can be of any isotype/class (e.g., IgG, IgE, IgM, IgD, IgA and IgY), or subclass (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2).
  • Both the light and heavy chains are divided into regions of structural and functional homology. The terms “constant” and “variable” are used functionally. In this regard, it will be appreciated that the variable domains of both the light (VL) and heavy (VH) chain portions determine antigen recognition and specificity. Conversely, the constant domains of the light chain (CL) and the heavy chain (CH1, CH2 or CH3) confer important biological properties such as secretion, transplacental mobility, Fc receptor binding, complement binding, and the like. By convention, the numbering of the constant region domains increases as they become more distal from the antigen binding site or amino-terminus of the antibody. The N-terminus is a variable region and at the C-terminus is a constant region; the CH3 and CL domains actually comprise the carboxy-terminal domains of the heavy and light chain, respectively.
  • The term “antibody fragment” as used herein refers to either an antigen binding fragment of an antibody or a non-antigen binding fragment (e.g., Fc) of an antibody. The term “antigen binding fragment”, as used herein, refers to one or more portions of an antibody that retain the ability to specifically interact with (e.g., by binding, steric hindrance, stabilizing/destabilizing, spatial distribution) an epitope of an antigen. Examples of binding fragments include, but are not limited to, single-chain Fvs (scFv), disulfide-linked Fvs (sdFv), Fab fragments, F(ab′) fragments, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., Nature 341:544-546, 1989), which consists of a VH domain; and an isolated complementarity determining region (CDR), or other epitope-binding fragments of an antibody.
  • Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (“scFv”); see, e.g., Bird et al., Science 242:423-426, 1988; and Huston et al., Proc. Natl. Acad. Sci. 85:5879-5883, 1988). Such single chain antibodies are also intended to be encompassed within the term “antigen binding fragment.” These antigen binding fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
  • Antigen binding fragments can also be incorporated into single domain antibodies, maxibodies, minibodies, nanobodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (see, e.g., Hollinger and Hudson, Nature Biotechnology 23:1126-1136, 2005). Antigen binding fragments can be grafted into scaffolds based on polypeptides such as fibronectin type III (Fn3) (see U.S. Pat. No. 6,703,199, which describes fibronectin polypeptide monobodies).
  • Antigen binding fragments can be incorporated into single chain molecules comprising a pair of tandem Fv segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. 8:1057-1062, 1995; and U.S. Pat. No. 5,641,870).
  • The term “monoclonal antibody” or “monoclonal antibody composition” as used herein refers to polypeptides, including antibodies and antibody fragments that have substantially identical amino acid sequence or are derived from the same genetic source. This term also includes preparations of antibody molecules of single molecular composition. A monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • The term “human antibody”, as used herein, includes antibodies having variable regions in which both the framework and CDR regions are derived from sequences of human origin. Furthermore, if the antibody contains a constant region, the constant region also is derived from such human sequences, e.g., human germline sequences, or mutated versions of human germline sequences or antibody containing consensus framework sequences derived from human framework sequences analysis, for example, as described in Knappik et al., J. Mol. Biol. 296:57-86, 2000).
  • The human antibodies of the invention may include amino acid residues not encoded by human sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo, or a conservative substitution to promote stability or manufacturing).
  • The term “humanized” antibody, as used herein, refers to an antibody that retains the reactivity of a non-human antibody while being less immunogenic in humans. This can be achieved, for instance, by retaining the non-human CDR regions and replacing the remaining parts of the antibody with their human counterparts. See, e.g., Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984); Morrison and Oi, Adv. Immunol., 44:65-92 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988); Padlan, Molec. Immun., 28:489-498 (1991); Padlan, Molec. Immun., 31(3):169-217 (1994).
  • The term “recognize” as used herein refers to an antibody or antigen binding fragment thereof that finds and interacts (e.g., binds) with its epitope, whether that epitope is linear or conformational. The term “epitope” refers to a site on an antigen to which an antibody or antigen binding fragment of the invention specifically binds. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include techniques in the art, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance (see, e.g., Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
  • The term “affinity” as used herein refers to the strength of interaction between antibody and antigen at single antigenic sites. Within each antigenic site, the variable region of the antibody “arm” interacts through weak non-covalent forces with antigen at numerous sites; the more interactions, the stronger the affinity.
  • The term “isolated antibody” refers to an antibody that is substantially free of other antibodies having different antigenic specificities. An isolated antibody that specifically binds to one antigen may, however, have cross-reactivity to other antigens. Moreover, an isolated antibody may be substantially free of other cellular material and/or chemicals.
  • The term “conservatively modified variant” applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are “silent variations,” which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence.
  • For polypeptide sequences, “conservatively modified variants” include individual substitutions, deletions or additions to a polypeptide sequence which result in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention. The following eight groups contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)). In some embodiments, the term “conservative sequence modifications” are used to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence.
  • The term “optimized” as used herein refers to a nucleotide sequence has been altered to encode an amino acid sequence using codons that are preferred in the production cell or organism, generally a eukaryotic cell, for example, a yeast cell, a Pichia cell, a fungal cell, a Trichoderma cell, a Chinese Hamster Ovary cell (CHO) or a human cell. The optimized nucleotide sequence is engineered to retain completely or as much as possible the amino acid sequence originally encoded by the starting nucleotide sequence, which is also known as the “parental” sequence.
  • The terms “percent identical” or “percent identity,” in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same. Two sequences are “substantially identical” if two sequences have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity, optionally 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. Optionally, the identity exists over a region that is at least about 30 nucleotides (or 10 amino acids) in length, or more preferably over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.
  • For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • A “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman, Adv. Appl. Math. 2:482c (1970), by the homology alignment algorithm of Needleman and Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson and Lipman, Proc. Natl. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by manual alignment and visual inspection (see, e.g., Brent et al., Current Protocols in Molecular Biology, 2003).
  • Two examples of algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402, 1977; and Altschul et al., J. Mol. Biol. 215:403-410, 1990, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always >0) and N (penalty score for mismatching residues; always <0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: The cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a word length (W) of 11, an expectation (E) or 10, M=5, N=−4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a word length of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff, (1989) Proc. Natl. Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=−4, and a comparison of both strands.
  • The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787, 1993). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
  • The percent identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller, Comput. Appl. Biosci. 4:11-17, 1988) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch, J. Mol. Biol. 48:444-453, 1970) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
  • Other than percentage of sequence identity noted above, another indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequence.
  • The term “nucleic acid” is used herein interchangeably with the term “polynucleotide” and refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form. The term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are synthetic, naturally occurring, and non-naturally occurring, which have similar binding properties as the reference nucleic acid, and which are metabolized in a manner similar to the reference nucleotides. Examples of such analogs include, without limitation, phosphorothioates, phosphoramidates, methyl phosphonates, chiral-methyl phosphonates, 2-O-methyl ribonucleotides, peptide-nucleic acids (PNAs).
  • Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses silent variants thereof (e.g., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated. Specifically, as detailed below, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., (1991) Nucleic Acid Res. 19:5081; Ohtsuka et al., (1985) J. Biol. Chem. 260:2605-2608; and Rossolini et al., (1994) Mol. Cell. Probes 8:91-98).
  • The term “operably linked” in the context of nucleic acids refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, it refers to the functional relationship of a transcriptional regulatory sequence to a transcribed sequence. For example, a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or modulates the transcription of the coding sequence in an appropriate host cell or other expression system. Generally, promoter transcriptional regulatory sequences that are operably linked to a transcribed sequence are physically contiguous to the transcribed sequence, i.e., they are cis-acting. However, some transcriptional regulatory sequences, such as enhancers, need not be physically contiguous or located in close proximity to the coding sequences whose transcription they enhance.
  • The terms “polypeptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to canonical amino acid polymers as well as to non-canonical amino acid polymers. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.
  • The term “immunoconjugate” or “antibody conjugate” as used herein refers to the linkage of an antibody or an antibody fragment thereof with another agent, such as a chemotherapeutic agent, a toxin, an immunotherapeutic agent, an imaging probe, a spectroscopic probe, and the like. The linkage can be through one or multiple covalent bonds, or non-covalent interactions, and can include chelation. Various linkers, many of which are known in the art, can be employed in order to form the immunoconjugate. Additionally, the immunoconjugate can be provided in the form of a fusion protein that may be expressed from a polynucleotide encoding the immunoconjugate. As used herein, “fusion protein” refers to proteins created through the joining of two or more genes or gene fragments which originally coded for separate proteins (including peptides and polypeptides). Fusion proteins may be created by joining at the N- or C-terminus, or by insertions of genes or gene fragments into permissible regions of one of the partner proteins. Translation of the fusion gene results in a single protein with functional properties derived from each of the original proteins.
  • The term “subject” includes human and non-human animals. Non-human animals include all vertebrates, e.g., mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, and reptiles. Except when noted, the terms “patient” or “subject” are used herein interchangeably.
  • The term “cytotoxin”, or “cytotoxic agent” as used herein, refer to any agent that is detrimental to the growth and proliferation of cells and may act to reduce, inhibit, or destroy a cell or malignancy.
  • The term “anti-cancer agent” as used herein refers to any agent that can be used to treat a cell proliferative disorder such as cancer, including but not limited to, cytotoxic agents, chemotherapeutic agents, radiotherapy and radiotherapeutic agents, targeted anti-cancer agents, and immunotherapeutic agents.
  • The term “drug moiety” or “payload” are used interchangeably and refers to a chemical moiety that is conjugated to the antibody or antibody fragment of the invention, and can include any moiety that is useful to attach to an antibody or antibody fragment. For example, a drug moiety or payload can be an anti-cancer agent, an anti-inflammatory agent, an antifungal agent, an antibacterial agent, an anti-parasitic agent, an anti-viral agent, an anesthetic agent. In certain embodiments a drug moiety is selected from a V-ATPase inhibitor, a HSP90 inhibitor, an IAP inhibitor, an mTor inhibitor, a microtubule stabilizer, a microtubule destabilizers, an auristatin, a dolastatin, a maytansinoid, a MetAP (methionine aminopeptidase), an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor, an inhibitor of phosphoryl transfer reactions in mitochondria, a protein synthesis inhibitor, a kinase inhibitor, a CDK2 inhibitor, a CDK9 inhibitor, a proteasome inhibitor, a kinesin inhibitor, an HDAC inhibitor, a DNA damaging agent, a DNA alkylating agent, a DNA intercalator, a DNA minor groove binder and a DHFR inhibitor. Suitable examples include auristatins such as MMAE and MMAF; calicheamycins such as gamma-calicheamycin; and maytansinoids such as DM1 and DM4. Methods for attaching each of these to a linker compatible with the antibodies and method of the invention are known in the art. See, e.g., Singh et al., (2009) Therapeutic Antibodies: Methods and Protocols, vol. 525, 445-457. In addition, a payload can be a biophysical probe, a fluorophore, a spin label, an infrared probe an affinity probe, a chelator, a spectroscopic probe, a radioactive probe, a lipid molecule, a polyethylene glycol, a polymer, a spin label, DNA, RNA, a protein, a peptide, a surface, an antibody, an antibody fragment, a nanoparticle, a quantum dot, a liposome, a PLGA particle, a saccharide or a polysaccharide, a reactive functional group, or a binding agent that can connect the conjugate to another moiety, surface, etc.
  • The term “drug antibody ratio” (also referred to as “DAR”), refers to the number or payload or drug moieties linked to an antibody of the immunoconjugate. For example a drug antibody of ratio of 2 means that average of two drug moieties bound to an each antibody in a sample of immunoconjugates. Some individual immunoconjugates will in a sample with a drug antibody ratio of two might have none or only one drug moiety linked; others immunoconjugates in that sample will have two, three, four, or even more moieties on individual antibody. But the average in the sample will be two. There are different methods known in the art for measuring drug antibody ratios of immunoconjugates.
  • In an embodiment of this invention, the DAR in a sample of immunoconjugates can be “homogenous”. A “homogenous conjugation sample” is a sample with a narrow distribution of DAR. As an illustrative embodiment, in a homogenous conjugation sample having a DAR of 2, can contain within that sample antibodies that are not conjugated, and some antibodies having more than two moieties conjugated at about a DAR of two. “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to two moieties.
  • As an illustrative embodiment, in a homogenous conjugation sample having a DAR of 4, can contain within that sample antibodies that have more or fewer than four moieties conjugated at about a DAR of four. “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to four moieties.
    As an illustrative embodiment, in a homogenous conjugation sample having a DAR of 6, can contain within that sample antibodies that are have more or fewer than six moieties conjugated at about a DAR of six. “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to six moieties.
    As an illustrative embodiment, in a homogenous conjugation sample having a DAR of 8, can contain within that sample antibodies that has some antibodies having fewer or more than eight moieties conjugated at about a DAR of four. “Most of the sample” means have at least over 70%, or at least over 80% or at least over 90% of the antibodies in the sample will be conjugated to eight moieties.
  • An immunoconjugate having a “drug antibody ratio of about 2” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 1.6-2.4 moieties/antibody, 1.8-2.3 moieties/antibody, or 1.9-2.1 moieties/antibody.
  • An immunoconjugate having a “drug antibody ratio of about 4” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 3.6-4.4 moieties/antibody, 3.8-4.3 moieties/antibody, or 3.9-4.1 moieties/antibody.
  • An immunoconjugate having a “drug antibody ratio of about 6” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 5.6-6.4 moieties/antibody, 5.8-6.3 moieties/antibody, or 5.9-6.1 moieties/antibody.
  • An immunoconjugate having a “drug antibody ratio of about 8” refers to sample of immunoconjugates where in the drug antibody ratio can range from about 7.6-84 moieties/antibody, 7.8-8.3 moieties/antibody, or 7.9-8.1 moieties/antibody.
  • “Tumor” refers to neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • The term “anti-tumor activity” means a reduction in the rate of tumor cell proliferation, viability, or metastatic activity. A possible way of showing anti-tumor activity is to show a decline in growth rate of abnormal cells that arises during therapy or tumor size stability or reduction. Such activity can be assessed using accepted in vitro or in vivo tumor models, including but not limited to xenograft models, allograft models, MMTV models, and other known models known in the art to investigate anti-tumor activity.
  • The term “malignancy” refers to a non-benign tumor or a cancer. As used herein, the term “cancer” includes a malignancy characterized by deregulated or uncontrolled cell growth. Exemplary cancers include: carcinomas, sarcomas, leukemias, and lymphomas.
  • The term “cancer” includes primary malignant tumors (e.g., those whose cells have not migrated to sites in the subject's body other than the site of the original tumor) and secondary malignant tumors (e.g., those arising from metastasis, the migration of tumor cells to secondary sites that are different from the site of the original tumor).
  • As used herein, the term “an optical isomer” or “a stereoisomer” refers to any of the various stereo isomeric configurations which may exist for a given compound of the present invention and includes geometric isomers. It is understood that a substituent may be attached at a chiral center of a carbon atom. The term “chiral” refers to molecules which have the property of non-superimposability on their mirror image partner, while the term “achiral” refers to molecules which are superimposable on their mirror image partner. Therefore, the invention includes enantiomers, diastereomers or racemates of the compound. “Enantiomers” are a pair of stereoisomers that are non-superimposable mirror images of each other. A 1:1 mixture of a pair of enantiomers is a “racemic” mixture. The term is used to designate a racemic mixture where appropriate. “Diastereoisomers” are stereoisomers that have at least two asymmetric atoms, but which are not mirror-images of each other. The absolute stereochemistry is specified according to the Cahn-Ingold-Prelog R-S system. When a compound is a pure enantiomer the stereochemistry at each chiral carbon may be specified by either R or S. Resolved compounds whose absolute configuration is unknown can be designated (+) or (−) depending on the direction (dextro- or levorotatory) which they rotate plane polarized light at the wavelength of the sodium D line. Certain compounds described herein contain one or more asymmetric centers or axes and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)-.
  • Depending on the choice of the starting materials and procedures, the compounds can be present in the form of one of the possible isomers or as mixtures thereof, for example as pure optical isomers, or as isomer mixtures, such as racemates and diastereoisomer mixtures, depending on the number of asymmetric carbon atoms. The present invention is meant to include all such possible isomers, including racemic mixtures, diasteriomeric mixtures and optically pure forms. Optically active (R)- and (S)-isomers may be prepared using chiral synthons or chiral reagents, or may be resolved using conventional techniques. If the compound contains a double bond, the substituent may be E or Z configuration. If the compound contains a disubstituted cycloalkyl, the cycloalkyl substituent may have a cis- or trans-configuration. All tautomeric forms are also intended to be included.
  • As used herein, the terms “salt” or “salts” refers to an acid addition or base addition salt of a compound of the invention. “Salts” include in particular “pharmaceutical acceptable salts”. The term “pharmaceutically acceptable salts” refers to salts that retain the biological effectiveness and properties of the compounds of this invention and, which typically are not biologically or otherwise undesirable. In many cases, the compounds of the present invention are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.
  • Pharmaceutically acceptable acid addition salts can be formed with inorganic acids and organic acids, e.g., acetate, aspartate, benzoate, besylate, bromide/hydrobromide, bicarbonate/carbonate, bisulfate/sulfate, camphorsulfonate, chloride/hydrochloride, chlorotheophyllinate, citrate, ethandisulfonate, fumarate, gluceptate, gluconate, glucuronate, hippurate, hydroiodide/iodide, isethionate, lactate, lactobionate, laurylsulfate, malate, maleate, malonate, mandelate, mesylate, methylsulfate, naphthoate, napsylate, nicotinate, nitrate, octadecanoate, oleate, oxalate, palmitate, pamoate, phosphate/hydrogen phosphate/dihydrogen phosphate, polygalacturonate, propionate, stearate, succinate, sulfosalicylate, tartrate, tosylate and trifluoroacetate salts.
  • Inorganic acids from which salts can be derived include, for example, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like.
  • Organic acids from which salts can be derived include, for example, acetic acid, propionic acid, glycolic acid, oxalic acid, maleic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, toluenesulfonic acid, sulfosalicylic acid, and the like. Pharmaceutically acceptable base addition salts can be formed with inorganic and organic bases.
  • Inorganic bases from which salts can be derived include, for example, ammonium salts and metals from columns I to XII of the periodic table. In certain embodiments, the salts are derived from sodium, potassium, ammonium, calcium, magnesium, iron, silver, zinc, and copper; particularly suitable salts include ammonium, potassium, sodium, calcium and magnesium salts.
  • Organic bases from which salts can be derived include, for example, primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines, basic ion exchange resins, and the like. Certain organic amines include isopropylamine, benzathine, cholinate, diethanolamine, diethylamine, lysine, meglumine, piperazine and tromethamine.
  • The pharmaceutically acceptable salts of the present invention can be synthesized from a basic or acidic moiety, by conventional chemical methods. Generally, such salts can be prepared by reacting free acid forms of these compounds with a stoichiometric amount of the appropriate base (such as Na, Ca, Mg, or K hydroxide, carbonate, bicarbonate or the like), or by reacting free base forms of these compounds with a stoichiometric amount of the appropriate acid. Such reactions are typically carried out in water or in an organic solvent, or in a mixture of the two. Generally, use of non-aqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile is desirable, where practicable. Lists of additional suitable salts can be found, e.g., in “Remington's Pharmaceutical Sciences”, 20th ed., Mack Publishing Company, Easton, Pa., (1985); and in “Handbook of Pharmaceutical Salts: Properties, Selection, and Use” by Stahl and Wermuth (Wiley-VCH, Weinheim, Germany, 2002).
  • Any formula given herein is also intended to represent unlabeled forms as well as isotopically labeled forms of the compounds. Isotopically labeled compounds have structures depicted by the formulas given herein except that one or more atoms are replaced by an atom having a selected atomic mass or mass number. Examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as 2H, 3H, 11C, 13C, 14C, 15N, 18F 31P, 32P, 35S, 36Cl, 125I respectively. The invention includes various isotopically labeled compounds as defined herein, for example those into which radioactive isotopes, such as 3H and 14C, or those into which non-radioactive isotopes, such as 2H and 13C are present. Such isotopically labeled compounds are useful in metabolic studies (with 14C), reaction kinetic studies (with, for example 2H or 3H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients. In particular, an 18F or labeled compound may be particularly desirable for PET or SPECT studies. Isotopically-labeled compounds of formula (I) can generally be prepared by conventional techniques known to those skilled in the art or by processes analogous to those described in the accompanying Examples and Preparations using an appropriate isotopically-labeled reagents in place of the non-labeled reagent previously employed.
  • Further, substitution with heavier isotopes, particularly deuterium (i.e., 2H or D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements or an improvement in therapeutic index. It is understood that deuterium in this context is regarded as a substituent of a compound of the formula (I). The concentration of such a heavier isotope, specifically deuterium, may be defined by the isotopic enrichment factor. The term “isotopic enrichment factor” as used herein means the ratio between the isotopic abundance and the natural abundance of a specified isotope. If a substituent in a compound of this invention is denoted deuterium, such compound has an isotopic enrichment factor for each designated deuterium atom of at least 3500 (52.5% deuterium incorporation at each designated deuterium atom), at least 4000 (60% deuterium incorporation), at least 4500 (67.5% deuterium incorporation), at least 5000 (75% deuterium incorporation), at least 5500 (82.5% deuterium incorporation), at least 6000 (90% deuterium incorporation), at least 6333.3 (95% deuterium incorporation), at least 6466.7 (97% deuterium incorporation), at least 6600 (99% deuterium incorporation), or at least 6633.3 (99.5% deuterium incorporation).
  • As used herein, the term “pharmaceutically acceptable carrier” includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g., antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drug stabilizers, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, and the like and combinations thereof, as would be known to those skilled in the art (see, for example, Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing Company, 1990, pp. 1289-1329). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated.
  • The term “a therapeutically effective amount” of a compound of the present invention refers to an amount of the compound of the present invention that will elicit the biological or medical response of a subject, for example, reduction or inhibition of an enzyme or a protein activity, or ameliorate symptoms, alleviate conditions, slow or delay disease progression, or prevent a disease, etc. In one non-limiting embodiment, the term “a therapeutically effective amount” refers to the amount of a compound of the present invention that, when administered to a subject, is effective to at least partially alleviate, inhibit, prevent and/or ameliorate a condition, or a disorder or a disease, or at least partially inhibit activity of a targeted enzyme or receptor.
  • As used herein, the term “inhibit”, “inhibition” or “inhibiting” refers to the reduction or suppression of a given condition, symptom, or disorder, or disease, or a significant decrease in the baseline activity of a biological activity or process.
  • As used herein, the term “treat”, “treating” or “treatment” of any disease or disorder refers in one embodiment, to ameliorating the disease or disorder (i.e., slowing or arresting or reducing the development of the disease or at least one of the clinical symptoms thereof). In another embodiment “treat”, “treating” or “treatment” refers to alleviating or ameliorating at least one physical parameter including those which may not be discernible by the patient. In yet another embodiment, “treat”, “treating” or “treatment” refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both. In yet another embodiment, “treat”, “treating” or “treatment” refers to preventing or delaying the onset or development or progression of the disease or disorder.
  • As used herein, a subject is “in need of” a treatment if such subject would benefit biologically, medically or in quality of life from such treatment.
  • As used herein, the term “a,” “an,” “the” and similar terms used in the context of the present invention (especially in the context of the claims) are to be construed to cover both the singular and plural unless otherwise indicated herein or clearly contradicted by the context.
  • The term “thiol-maleimide” as used herein describes a group formed by reaction of a thiol with maleimide, having this general formula
  • Figure US20160067351A1-20160310-C00005
  • where Y and Z are groups to be connected via the thiol-maleimide linkage and can be linker units, and can be attached to antibodies or payloads. In some instances, Y is an engineered antibody according to the invention, and the sulfur atom shown in the formula is from a cysteine at one of the substitution sites described herein; while Z represents a linker unit connected to a payload.
  • “Linker Unit” (LU) as used herein refers to a covalent chemical connection between two moieties, such as an antibody and a payload. Each LU can be comprised of one or more components described herein as L1, L2, L3, L4, L5 and L6. The linker unit can be selected to provide suitable spacing between the connected moieties, or to provide certain physicochemical properties, or to allow cleavage of the linker unit under certain conditions.
  • “Cleavable” as used herein refers to a linker or linker unit (LU) that connects two moieties by covalent connections, but breaks down to sever the covalent connection between the moieties under physiological conditions. Cleavage may be enzymatic or non-enzymatic, but generally releases a payload from an antibody without degrading the antibody.
  • “Non-cleavable” as used herein refers to a linker or linker unit (LU) that is not susceptible to breaking down under physiological conditions. While the linker may be modified physiologically, it keeps the payload connected to the antibody until the antibody is substantially degraded, i.e., the antibody degradation precedes cleavage of the linker in vivo.
  • “Cyclooctyne” as used herein refers to an 8-membered ring containing a carbon-carbon triple bond (acetylene). The ring is optionally fused to one or two phenyl rings, which may be substituted with 1-4 C1-4 alkyl, C1-4 alkoxy, halo, hydroxyl, COOH, COOL1, —C(O)NH-L1, O-L1, or similar groups, and which may contain N, O or S as a ring member. In preferred embodiments, cyclooctyne can be a C8 hydrocarbon ring, particularly an isolated ring that is saturated aside from the triple bond, and may be substituted with F or Hydroxy, and may be linked to a linker or LU via —O—, —C(O), C(O)NH, or C(O)O.
  • “Cyclooctene” as used herein refers to an 8-membered ring containing at least one double bond, especially a trans-double bond. The ring is optionally fused to one or two phenyl rings, which may be substituted with 1-4 C1-4 alkyl, C1-4alkoxy, halo, hydroxyl, COOH, COOL1, —C(O)NH-L1, O-L1, or similar groups, and which may contain N, O or S as a ring member. In preferred embodiments, cyclooctene can be an isolated C8 hydrocarbon ring that is saturated aside from the trans double bond and is optionally substituted with F or Hydroxy, and may be linked to a linker or LU via —O—, —C(O), C(O)NH, or C(O)O.
  • All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context. The use of any and all examples, or exemplary language (e.g. “such as”) provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention otherwise claimed.
  • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIG. 1. Surface accessibility plot of amino acid residues in human IgG1 heavy chain (A) and kappa light chain (B). Surface accessibility was calculated using Surface Racer 5.0 and is expressed as Angstrom square [Å2].
  • FIG. 2. Location of selected 92 TAG mutations in the structure of a human IgG1 with a kappa light chain. Selected residues for TAG mutations are shown in black on only one of the two heavy chains and for one of the two kappa light chains (1HZH.pdb). Structures are shown using PyMOL, an open-source molecular modeling package (The PyMOL Molecular Graphics System, Version 1.5.0. Schrödinger. LLC).
  • FIG. 3. The amino acid sequence alignment of the heavy chain constant regions of trastuzumab and antibody 14090. Residues mutated to Cys in the trastuzumab antibody and in antibody 14090 are underlined. Amino acid residues in heavy chain are numbered by Eu numbering system (Edelman et al., 1969).
  • FIG. 4 Amino acid sequence alignment of constant regions of trastuzumab, human IgG1, IgG2, IgG3 and IgG4.
  • FIG. 5. The amino acid sequence alignment of the constant regions of human kappa and lambda light chains. A. Residues mutated to Cys in the kappa light chain of trastuzumab and in the lambda light chain of antibody 14090 are underlined. B. Residues selected for Cys mutations are shown in a PyMOL structure model of a human lambda light chain (Protein Structure Databank entry 3G6D.pdb)
  • FIG. 6. Analysis of trastuzumab Cys antibodies by non-reducing SDS-PAGE.
  • FIG. 7. Size exclusion chromatography of the trastuzumab LC-S156C mutant antibody (dashed line) and wild-type trastuzumab (solid line).
  • FIG. 8. Analysis of wild-type trastuzumab (A) and the trastuzumab LC-E158C mutant antibody (B) by reverse phase high pressure liquid chromatography (RP-HPLC).
  • FIG. 9. MS analysis of trastuzumab LC-R108C mutant antibody after Protein A purification (intact MS).
  • FIG. 10. Structure of MC-MMAF.
  • FIG. 11. Analysis of conjugation mixtures of trastuzumab Cys antibodies with MC-MMAF by RP-HPLC. RP-HPLC traces of the conjugation mixtures are shown as dashed lines. RP-HPLC traces of unmodified antibodies are shown as solid lines. A. LC-R108C-MMAF, B. HC-360C-MMAF, C. LC-S156C-MMAF, and D. HC-S275C-MMAF ADC.
  • FIG. 12. Analysis of conjugation mixtures of trastuzumab Cys antibodies with MC-MMAF by RP-HPLC. RP-HPLC traces of the conjugation mixtures are shown as dashed lines. RP-HPLC traces of unmodified antibodies are shown as solid lines. A. HC-S134C-MMAF, and B. HC-S136C-MMAF ADC.
  • FIG. 13. Analysis of trastuzumab Cys-MMAF ADCs by analytical size-exclusion chromatography (AnSEC). Trastuzumab HC-K290C-MMAF ADC (short dashed line), trastuzumab LC-R142C-MMAF ADC (dashed line), and trastuzumab LC-L154C-MMAF ADC (dotted line) are compared to unmodified wild-type trastuzumab (solid line).
  • FIG. 14. Thermal melting curve of unmodified wild-type trastuzumab and trastuzumab HC-T335C-MMAF, trastuzumab HC-S337C-MMAF and trastuzumab HC-K360C-MMAF ADCs.
  • FIG. 15. Cell proliferation assays for trastuzumab LC-S159C-MMAF with A. HCC1954, B. MDA-MB231 clone 16 and C. MDA-MB231 clone 40 cells.
  • FIG. 16. IC50 of trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16 cell proliferation assay.
  • FIG. 17. Cell proliferation assays for Antibody 14090 HC-S375C-MMAF ADC with A. CMK11-5 and B. Jurkat cells.
  • FIG. 18. Pharmacokinetics study of trastuzumab LC-Cys-MMAF ADCs displaying no significant drug lost. A. Wild-type unconjugated trastuzumab, B. LC-K107C-MMAF, C. LC-R108C-MMAF, D. LC-L154C-MMAF, and E. LC-S159C-MMAF ADC.
  • FIG. 19. Pharmacokinetics study of trastuzumab HC-Cys-MMAF ADCs displaying no significant drug lost. A. HC-K121C-MMAD, B. HC-L174C-MMAF, C. HC-E258C-MMAF, and D. HC-R292C-MMAF ADC.
  • FIG. 20. Pharmacokinetics study of trastuzumab Cys-MMAF ADCs displaying significant drug lost. A. LC-T129C-MMAF, B. LC-E143C-MMAF, C. HC-K246C-MMAF, and D. HC-R344C-MMAF ADC.
  • FIG. 21. Pharmacokinetics study of two trastuzumab Cys-MMAF ADCs displaying fast clearance in vivo. A. HC-T335C-MMAF and B. HC-S337C-MMAF ADC.
  • FIG. 22. In vivo efficacy studies of trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16 xenograft mouse model.
  • FIG. 23: Retention times of trastuzumab Pcl MMAF DAR 2 ADCs as measured by Hydrophobic Interaction Chromotography. ABA-MMAF is attached at a Pcl residue substituted for the indicated HC or LC residue. A) HC conjugated ADCs. B) LC conjugated ADCs. The retention time of unconjugated wild-type antibody is indicated (WT).
  • FIG. 24. Location of selected payload sites in the structure of a human IgG1 with a kappa light chain. Selected residues are shown in black on only one of the two heavy chains and for one of the two kappa light chains (1HZH.pdb). Three rotations of the structure are shown using PyMOL, an open-source molecular modeling package (The PyMOL Molecular Graphics System, Version 1.5.0. Schrödinger, LLC).
  • FIG. 25. Pharmacokinetics study of trastuzumab and antibody 14090 Cys-MMAF ADCs with DAR 4, 6 and 8 prepared with antibodies with 2, 3 or 4 Cys mutations. DAR 4 trastuzumab ADCs: HC-E258C-LC-S159C-MMAF (A), HC-S375C-LC-S159C-MMAF (B), HC-E258C-LC-E165C-MMAF (C), HC-S375C-LC-E165C-MMAF (D), HC-E152C-LC-R142C-MMAF (E), HC-P171C-LC-R142C-MMAF, and HC-E152C-LC-S159C-MMAF (G); DAR 4 antibody 14090 ADCs: HC-S375C-LC-A143C-MMAF (H), HC-K360C-LC-V159C-MMAF (I), and HC-S375C-LC-V159C-MMAF (J); K. DAR 6 trastuzumab ADCs HC-K334C-S375C-LC-E165C-MMAF and HC-K334C-K392C-LC-E165C-MMAF; L. DAR 8 trastuzumab ADCs HC-K334C-K360C-S375C-LC-E165C-MMAF, HC-K334C-K360C-K392C-LC-E165C-MMAF and HC-K334C-S375C-K392C-LC-E165C-MMAF. Antibody 14090 is mouse cross-reactive and therefore is cleared more rapidly that then the trastuzumab ADCs which do not bind to any mouse antigens.
  • DETAILED DESCRIPTION
  • The present invention provides methods of site-specific labeling of antibodies or antibody fragments by replacing one or more amino acids of a parental antibody or antibody fragment at specific positions with cysteine amino acids (“Cys”), such that the engineered antibodies or antibody fragments are capable of conjugation to various agents (e.g., cytotoxic agents). The present invention also provides immunoconjugates that are produced by using the methods described herein.
  • When a cysteine is engineered into a parental antibody or antibody fragment, the modified antibody or antibody fragment is first recovered from the expression medium with cysteine or glutathione (GSH) attached at the engineered cysteine site(s) via a disulfide linkage (Chen et al., (2009) mAbs 16, 353-571). The attached cysteine or GSH is then removed in a reduction step, which also reduces all native inter-chain disulfide bonds of the parental antibody or antibody fragment. In a second step these disulfide bonds are re-oxidized before conjugation occurs. The present disclosure shows that when cysteine is engineered at certain sites, the re-oxidation step does not proceed well, presumably due to formation of the incorrect disulfide bonds. Accordingly, the present invention provides unique sets of sites on the antibody heavy chain constant region and antibody light chain constant region, respectively, where Cys substitution as described herein produces modified antibodies or antibody fragments that perform well in the re-oxidation process, and also produce stable and well behaved immunoconjugates.
  • The site-specific antibody labeling according to the present invention can be achieved with a variety of chemically accessible labeling reagents, such as anti-cancer agents, fluorophores, peptides, sugars, detergents, polyethylene glycols, immune potentiators, radio-imaging probes, prodrugs, and other molecules.
  • Accordingly, the present invention provides methods of preparation of homogeneous immunoconjugates with a defined drug-to-antibody ratio for use in cancer therapy and other indications as well as imaging reagents. The present invention also provides immunoconjugates prepared thereby, as well as pharmaceutical compositions comprising these immunoconjugates. The methods of the instant invention can be used in combination with other conjugation methods known in the art.
  • The following enumerated embodiments represent certain aspects and variations of the invention:
  • Figure US20160067351A1-20160310-C00006
      • wherein Ab represents an antibody or antibody fragment comprising at least one cysteine residue at one of the preferred cysteine substitution sites described herein;
      • LU is a linker unit as described herein;
      • X is a payload or drug moiety;
      • and n is an integer from 1 to 16. In these embodiments, n is preferably about 2, about 4, about 6, or about 8. LU is typically a group of formula -L1-L2-L3-L4-L5-L6-, wherein L1, L2, L3, L4, L5 and L6 are independently selected from -A1-, -A1X2— and —X2—; wherein:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m—, —(O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)nNH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, or —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—;
      • each X2 is independently selected from a bond, R8,
  • Figure US20160067351A1-20160310-C00007
    Figure US20160067351A1-20160310-C00008
    Figure US20160067351A1-20160310-C00009
      •  —CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected from
  • Figure US20160067351A1-20160310-C00010
      • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
  • In some of these embodiments, the immunoconjugate comprises a group of the formula
  • Figure US20160067351A1-20160310-C00011
      • wherein the sulfur atom is the sulfur of a cysteine residue in a modified antibody or antibody fragment and is located at one of the substitution sites identified herein.
  • In any of the foregoing embodiments, the cysteine substitution site may be a position that corresponds to one of the sites identified by a position number, even though the position of the site in the sequence has been changed by a modification or truncation of the full-length antibody. Corresponding sites can be readily identified by alignment of an antibody or fragment with a full-length antibody.
  • 1. Site-Specific Cysteine Engineered Antibodies Site-Specific Labeling
  • The antibodies (e.g., a parent antibody, optionally containing one or more non-canonical amino acids) of the present invention are numbered according to the EU numbering system as set forth in Edelman et al., (1969) Proc. Natl. Acad. USA 63:78-85, except that the lambda light chain is numbered according to the Kabat numbering system as set forth in Kabat et al., (1991) Fifth Edition. NIH Publication No. 91-3242. Human IgG1 constant region is used as a representative throughout the application. However, the invention is not limited to human IgG1; corresponding amino acid positions can be readily deduced by sequence alignment. For example, FIG. 4 shows sequence alignment of human IgG1, IgG2, IgG3 and IgG4 heavy chain constant regions, so that an identified Cys engineering site in the IgG1 constant region can be readily identified for IgG2, IgG3, and IgG4 as shown in FIG. 4. For the light chain constant region, IgG1, IgG2, IgG3 and IgG4 are the same. Table 1 below lists the amino acid positions in the constant region of the heavy chain of an antibody that can be replaced by a cysteine. Table 2 lists the amino acid positions in the constant region of the kappa light chain of an antibody that can be replaced by a cysteine. Table 3 lists the amino acid positions in the constant region of the lambda light chain of an antibody that can be replaced by a cysteine.
  • TABLE 1
    Identified cysteine substitution sites in the heavy chain constant region
    of human IgG1 (Sites numbered according to EU numbering system).
    Surface
    EU accessibility SEQ ID
    number Residue [Å2] Selected HC Cys NO.
    117 SER 128.0 HC-S117C 2
    119 SER 79.1 HC-S119C 3
    121 LYS 135.9 HC-K121C 4
    124 SER 40.2 HC-S124C 5
    132 SER 34.4 HC-S132C 6
    134 SER 123.3 HC-S134C 7
    136 SER 182.9 HC-S136C 8
    139 THR 32.9 HC-T139C 9
    152 GLU 52.1 HC-E152C 10
    153 PRO 89.1 HC-P153C 11
    155 THR 69.0 HC-T155C 12
    157 SER 39.0 HC-S157C 13
    164 THR 125.4 HC-T164C 14
    165 SER 183.2 HC-S165C 15
    169 THR 60.0 HC-T169C 16
    171 PRO 33.3 HC-P171C 17
    174 LEU 68.1 HC-L174C 18
    176 SER 161.9 HC-S176C 19
    177 SER 68.1 HC-S177C 20
    189 PRO 86.4 HC-P189C 21
    191 SER 126.8 HC-S191C 22
    195 THR 111.3 HC-T195C 23
    197 THR 89.8 HC-T197C 24
    205 LYS 217.1 HC-K205C 25
    207 SER 50.0 HC-S207C 26
    212 ASP 97.0 HC-D212C 27
    246 LYS 55.1 HC-K246C 28
    258 GLU 42.1 HC-E258C 29
    269 GLU 189.2 HC-E269C 30
    274 LYS 137.8 HC-K274C 31
    286 ASN 119.4 HC-N286C 32
    288 LYS 181.8 HC-K288C 33
    290 LYS 177.0 HC-K290C 34
    292 ARG 251.5 HC-R292C 35
    293 GLU 83.3 HC-E293C 36
    294 GLN 73.5 HC-E294C 37
    320 LYS 55.0 HC-K320C 38
    322 LYS 78.3 HC-K322C 39
    326 LYS 212.7 HC-K326C 40
    330 ALA 96.3 HC-A330C 41
    333 GLU 84.7 HC-E333C 42
    334 LYS 49.6 HC-K334C 43
    335 THR 70.1 HC-T335C 44
    337 SER 15.1 HC-S337C 45
    344 ARG 98.2 HC-R344C 46
    355 ARG 249.4 HC-R355C 47
    360 LYS 113.9 HC-K360C 48
    362 GLN 40.8 HC-Q362C 49
    375 SER 28.9 HC-S375C 50
    382 GLU 21.8 HC-E382C 51
    389 ASN 189.5 HC-N389C 52
    390 ASN 36.4 HC-N390C 53
    392 LYS 81.8 HC-K392C 54
    393 THR 35.8 HC-T393C 55
    398 LEU 110.9 HC-L398C 56
    400 SER 81.3 HC-S400C 57
    413 ASP 79.6 HC-D413C 58
    415 SER 69.0 HC-S415C 59
    422 VAL 80.8 HC-V422C 60
  • TABLE 2
    Identified cysteine substitution sites in the kappa light chain constant region
    of human IgG1 (Sites numbered according to EU numbering system).
    Surface
    EU accessibility SEQ ID
    number Residue [Å2] Selected LC Cys NO.
    107 LYS 90 LC-K107C 61
    108 ARG 49 LC-R108C 62
    109 THR 148 LC-T109C 63
    112 ALA 50 LC-A112C 64
    114 SER 39 LC-S114C 65
    122 ASP 90 LC-D122C 66
    123 GLU 51 LC-E123C 67
    129 THR 41 LC-T129C 68
    142 ARG 55 LC-R142C 69
    143 GLU 117 LC-E143C 70
    145 LYS 160 LC-K145C 71
    152 ASN 157 LC-N152C 72
    154 LEU 117 LC-L154C 73
    156 SER 122 LC-S156C 74
    159 SER 22 LC-S159C 75
    161 GLU 66 LC-E161C 76
    165 GLU 74 LC-E165C 77
    168 SER 170 LC-S168C 78
    169 LYS 241 LC-K169C 79
    170 ASP 48 LC-D170C 80
    182 SER 59 LC-S182C 81
    183 LYS 131 LC-K183C 82
    188 LYS 201 LC-K188C 83
    190 LYS 167 LC-K190C 84
    191 VAL 58 LC-V191C 85
    197 THR 38 LC-T197C 86
    199 GLN 127 LC-Q199C 87
    203 SER 110 LC-5203C 88
    206 THR 70 LC-T206C 89
  • TABLE 3
    Identified cysteine substitution sites on the lambda light chain of
    human IgG1.
    Surface
    Kabat accessibility SEQ ID
    number Residue [Å2] Selected LC Cys NO.
    143 ALA 82 LC-A143C 92
    145 THR 106 LC-T145C 93
    147 ALA 14 LC-A147C 94
    156 LYS 233 LC-K156C 95
    159 VAL 28 LC-V159C 96
    163 THR 157 LC-T163C 97
    168 SER 166 LC-S168C 98
  • Because of the high sequence homology of constant regions of IgG1, IgG2, IgG3 and IgG4 antibodies, findings of the invention are not limited to any specific antibodies or antibody fragments.
  • In one embodiment, the present invention provides immunoconjugates comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises a substitution of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids on its heavy chain constant region chosen from positions identified in Table 1. In a specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 334, 360, 375, and 392 of the heavy chain. For example, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of two amino acids with cysteine on its constant region chosen from positions 121 and 124, 121 and 152, 121 and 171, 121 and 174, 121 and 258, 121 and 292, 121 and 333, 121 and 334, 121 and 360, 121 and 375, 121 and 392, 124 and 152, 124 and 171, 124 and 174, 124 and 258, 124 and 292, 124 and 333, 124 and 334, 124 and 360, 124 and 375, 124 and 392, 152 and 171, 152 and 174, 152 and 258, 152 and 292, 152 and 333, 152 and 334, 152 and 360, 152 and 375, 152 and 392, 171 and 174, 171 and 258, 171 and 292, 171 and 333, 171 and 360, 171 and 375, 174 and 258, 174 and 292, 174 and 333, 174 and 334, 174 and 360, 174 and 375, 174 and 392, 258 and 292, 258 and 333, 258 and 334, 258 and 360, 258 and 375, 258 and 392, 292 and 333, 292 and 334, 292 and 360, 292 and 375, 292 and 392, 333 and 334, 333 and 360, 333 and 375, 333 and 392; 334 and 360, 334 and 375, 334 and 392, 360 and 375, 360 and 392, or 375 and 392 of the heavy chain.
  • In another embodiment, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of three amino acids with cysteine on its constant region chosen from positions 121, 124 and 152; 121, 124 and 171; 121, 124 and 174; 121, 124 and 258; 121, 124 and 292; 121, 124 and 333; 121, 124 and 334; 121, 124 and 360; 121, 124 and 375; 121, 124 and 392; 121, 152 and 171; 121, 152 and 174; 121, 152 and 258; 121, 152 and 292; 121, 152 and 333; 121, 152 and 334; 121, 152 and 360; 121, 152 and 375; 121, 152 and 392; 121, 171 and 174; 121, 171 and 258; 121, 171 and 292; 121, 171 and 333; 121, 171 and 334; 121, 171 and 360; 121, 171 and 375; 121, 171 and 392; 121, 174 and 258, 121, 174 and 292; 121, 174 and 333; 121, 174 and 334; 121, 174 and 360; 121, 174 and 375; 121, 174 and 392; 121, 258 and 292; 121, 258 and 333; 121, 258 and 334; 121, 258 and 360; 121, 258 and 375; 121, 258 and 392; 121, 292 and 333; 121, 292 and 334; 121, 292 and 360; 121, 292 and 375; 121, 292 and 392; 121, 333 and 334; 121, 333 and 360; 121, 333 and 375; 121, 333 and 392; 121, 334 and 360; 121, 334 and 375; 121, 334 and 392; 121, 360 and 375; 121, 360 and 392; 121, 375 and 392; 124, 152 and 171; 124, 152 and 174; 124, 152 and 258; 124, 152 and 292; 124, 152 and 333; 124, 152 and 334; 124, 152 and 360; 124, 152 and 375; 124, 152 and 392; 124, 171 and 174; 124, 171 and 258; 124, 171 and 292; 124, 171 and 333; 124, 171 and 334; 124, 171 and 360; 124, 171 and 375; 124, 171 and 392; 124, 174 and 258; 124, 174 and 292; 124, 174 and 333; 124, 174 and 334; 124, 174 and 360; 124, 174 and 375; 124, 174 and 392; 124, 258 and 292; 124, 258 and 333; 124, 258 and 334; 124, 258 and 360; 124, 258 and 375; 124, 258 and 392; 124, 292 and 333; 124, 292 and 334; 124, 292 and 360; 124, 292 and 375; 124, 292 and 392; 124, 333 and 360; 124, 333 and 334; 124, 333 and 375; 124, 333 and 392; 124, 334 and 360; 124, 334 and 375; 124, 334 and 392; 124, 360 and 375; 124, 360 and 392; 124, 375 and 392; 152, 171 and 174; 152, 171 and 258; 152, 171 and 292; 152, 171 and 333; 152, 171 and 334; 152, 171 and 360; 152, 171 and 375; 152, 171 and 392; 152, 174 and 258; 152, 174 and 292; 152, 174 and 333; 152, 174 and 334; 152, 174 and 360; 152, 174 and 375; 152, 174 and 392; 152, 258 and 292; 152, 258 and 333; 152, 258 and 334; 152, 258 and 360; 152, 258 and 375; 152, 258 and 392; 152, 292 and 333; 152, 292 and 334; 152, 292 and 360; 152, 292 and 375; 152, 292 and 392; 152, 333 and 334; 152, 333 and 360; 152, 333 and 375; 152, 333 and 392; 152, 334 and 360; 152, 334 and 375; 152, 334 and 392; 152, 360 and 375; 152, 360 and 392; 152, 375 and 392; 171, 174 and 258; 171, 174 and 292; 171, 174 and 333; 171, 174 and 334; 171, 174 and 360; 171, 174 and 375; 171, 174 and 392; 171, 258 and 292; 171, 258 and 292; 171, 258 and 333; 171, 258 and 334; 171, 258 and 360; 171, 258 and 375; 171, 258 and 392; 171, 292 and 333; 171, 292 and 334; 171, 292 and 360; 171, 292 and 375; 171, 292 and 392; 171, 333 and 334; 171, 333 and 360; 171, 333 and 375; 171, 333 and 392; 171, 334 and 360; 171, 334 and 392; 171, 360 and 375; 171, 360 and 392; 171, 375 and 392; 174, 258 and 292; 174, 258 and 333; 174, 258 and 334; 174, 258 and 360; 174, 258 and 375; 174, 258 and 392; 174, 292 and 333; 174, 292 and 334; 174, 292 and 360; 174, 292 and 375; 174, 292 and 392; 174, 333 and 334; 174, 333 and 360; 174, 333 and 375; 174, 333 and 392; 174, 334 and 360; 174, 334 and 375; 174, 334 and 392; 174, 360 and 375; 174, 360 and 392; 174, 375 and 392; 258, 292 and 333; 258, 292 and 334; 258, 292 and 360; 258, 292 and 375; 258, 292 and 392; 258, 333 and 360; 258, 333 and 375; 258, 333 and 392; 258, 334 and 360; 258, 334 and 375; 258, 334 and 392; 258, 360 and 375; 258, 360 and 392; 258, 375 and 392; 292, 333 and 334; 292, 333 and 360; 292, 333 and 375; 292, 333 and 392; 292, 334 and 360; 292, 334 and 375; 292, 334 and 392; 292, 360 and 375; 292, 360 and 392; 292, 375 and 392; 333, 334 and 360; 333, 334 and 375; 333, 334 and 392; 333, 360 and 375, 333, 360 and 392; 333, 375 and 392; 334, 360 and 375; 334, 360 and 392; or 360, 375 and 392 of the heavy chain.
  • In an embodiment, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of four amino acids with cysteine on its constant region chosen from positions 152, 333, 375 and 392; or 152, 334, 375 and 392 of the heavy chain.
  • In a specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 2, 3, 9, 11, 12, 13, 14, 16, 21, 25, 26, 28, 30, 31, 32, 33, 34, 36, 38, 39, 40, 43, 44, 45, 46, 47, 51, 53, 54, 56, 57, or 60. In another specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 6, 7, 8, 15, 19, 20, 22, 23, 24, 27, 36, 37, 41, 49, 52, 55, 58, or 59.
  • In another embodiment, the present invention provides immunoconjugates comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises a substitution of one or more amino acids (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) on its light chain constant region chosen from positions identified in Table 2. In a specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 107, 108, 142, 145, 159, 161, and 165 of the light chain, wherein said light chain is human kappa light chain. For example, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of two amino acids with cysteine on its constant region chosen from positions 107 and 108; 107 and 142; 107 and 145; 107 and 159; 107 and 161; 107 and 165; 108 and 142; 108 and 145; 108 and 159; 108 and 161; 108 and 165; 142 and 145; 142 and 159; 142 and 161; 142 and 165; 145 and 159; 145 and 161; 145 and 165; 159 and 161; 159 and 165; 161 and 165 of the light chain, wherein said light chain is human kappa light chain. In another embodiment, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of three amino acids with cysteine on its constant region chosen from positions 107, 108 and 142; 107, 108 and 145; 107, 108 and 159; 107, 108 and 161; 107, 108 and 165; 107, 142 and 145; 107, 142 and 159; 107, 142 and 161; 107, 142 and 165; 107, 145 and 159; 107, 145 and 161; 107, 145 and 165; 107, 159 and 161; 107, 159 and 165; 107, 161 and 165; 108, 142 and 145; 108, 142 and 159; 108, 142 and 161; 108, 142 and 165; 108, 145 and 159; 108, 145 and 161; 108, 145 and 165; 108, 159 and 161; 108, 159 and 165; 108, 161 and 165; 142, 145 and 159; 142, 145 and 161; 142, 145 and 165; 142, 159 and 161; 142, 159 and 165; 142, 161 and 165; 145, 159 and 161; 145, 159 and 165; 145, 161 and 165; or 159, 161 and 165 of the light chain, wherein said light chain is human kappa light chain.
  • In a specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 63, 65, 68, 70, 72, 73, 74, 78, 79, 80, 81, 82, 83, 86, 87, or 88. In another specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 64, 66, 67, 84, 85, or 89 63, 64, 65, 66, 67, 68, 70, 72, 73, 74, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, or 89.
  • In another embodiment, the present invention provides immunoconjugates comprising a modified antibody or an antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises a substitution of one or more amino acids on its light chain constant region chosen from positions identified in Table 3. In a specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine on its constant region chosen from positions 143, 147, 159, 163, and 168 of the light chain, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain. For example, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of two amino acids with cysteine on its constant region chosen from positions 143 and 147; 143 and 159; 143 and 163; 143 and 168; 147 and 159; 147 and 163; 147 and 168; 159 and 163; 159 and 168; or 163 and 168 of the light chain, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain. In another embodiment, an immunoconjugate of the invention comprises a modified antibody or antibody fragment thereof and a drug moiety, wherein said modified antibody or antibody fragment comprises a substitution of three amino acids with cysteine on its constant region chosen from positions 143, 147 and 159; 143, 147 and 163; 143, 147 and 168; 143, 159 and 163; 143, 159 and 168; 143, 163 and 168; 147, 159 and 163; 147, 159 and 168; 147, 163 and 168; or 159, 163 and 168 of the light chain, wherein said light chain positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
  • In an embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 92, 94, 96, 97 or 98. In another specific embodiment, the present invention provides an immunoconjugate comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment thereof comprises SEQ ID NO: 93 or 95.
  • In an embodiment, the immunoconjugate can have an DAR of about 2 or about 4. In an embodiment, the present invention provides immunoconjugates comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment comprises a Cys substitution of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids on its heavy chain constant region chosen from positions identified in Table 1, and a Cys substitution of one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) amino acids on its light chain constant region chosen from positions identified in Table 2 or Table 3. In one embodiment, the present invention provides immunoconjugates comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment comprises a Cys substitution of one or more amino acids in its heavy chain constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 334, 360, 375 and 392; and a Cys substitution of one or more amino acids in its light chain constant region chosen from positions 107, 108, 142, 145, 159, 161, and 165, wherein said light chain is human kappa light chain. In an embodiment, a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 107 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 108 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 142 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 145 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 159 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 161 of a human kappa light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain. In a embodiment, a modified antibody or antibody fragment according to the present invention comprises a Cys substitution on position 375 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain. In an embodiment a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 334 and on position 375 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain. In another example, a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 334 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain. In an embodiment, an immunoconjugates of those combinations can have a DAR of about 4 or about 6.
  • In an embodiment, a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 334, on position 375 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain. In an embodiment, a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 333, on position 375 and on position 392 of a heavy chain, and a Cys substitution on position 165 of a human kappa light chain. In an embodiment, those combinations can have a DAR of about 4, 6, or 8.
  • In an embodiment, the present invention provides immunoconjugates comprising a modified antibody or antibody fragment thereof, and a drug moiety, wherein said modified antibody or antibody fragment comprises a Cys substitution of one or more amino acids in its heavy chain constant region chosen from positions 121, 124, 152, 171, 174, 258, 292, 333, 334 360, 375 and 392; and a Cys substitution of one or more amino acids in its light chain constant region chosen from positions 143, 147, 159, 163, and 168, wherein said light chain is human lambda light chain. For example, a modified antibody or antibody fragment according to the present invention may comprise a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 121 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 124 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 152 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 171 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 174 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 258 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 292 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 333 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 334 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 360 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 375 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 143 of a human lambda light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 147 of a human lambda light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 159 of a human lambda light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 163 of a human lambda light chain; or a Cys substitution on position 392 of a heavy chain, and a Cys substitution on position 168 of a human lambda light chain;
  • In an embodiment of the invention, the amino acid substitution described herein is cysteine comprising a thiol group. In some aspects of the invention, the thiol group is utilized for chemical conjugation, and is attached to a linker unit (LU) and/or drug moiety. In some embodiments, the immunoconjugates of the invention comprise a drug moiety selected from the group consisting of a V-ATPase inhibitor, a HSP90 inhibitor, an IAP inhibitor, an mTor inhibitor, a microtubule stabilizer, a microtubule destabilizers, an auristatin, a dolastatin, a maytansinoid, a MetAP (methionine aminopeptidase), an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor, proteasome inhibitors, an inhibitors of phosphoryl transfer reactions in mitochondria, a protein synthesis inhibitor, a kinase inhibitor, a CDK2 inhibitor, a CDK9 inhibitor, an kinesin inhibitor, an HDAC inhibitor, a DNA damaging agent, a DNA alkylating agent, a DNA intercalator, a DNA minor groove binder and a DHFR inhibitor. In some embodiments, the immunoconjugates of the invention comprise a drug moiety that is an anti-cancer agent. The modified antibody or antibody fragments of the present invention can be any formats known in the art, such as a monoclonal, chimeric, humanized, fully human, bispecific, or multispecific antibody or antibody fragment thereof.
  • According to the present invention, the modified antibody heavy chain and/or light chain (or antibody fragment thereof) may contain 1, 2, 3, 4, 5, 6, 7, 8, or more cysteine substitutions in its constant regions. In one embodiment, the modified antibodies or antibody fragments contain 2, 4, 6, 8, or more cysteine substitutions in its constant regions. In some embodiments, the modified antibody, antibody fragment or immunoconjugate thereof comprises 2 or 4 Cys substitutions.
  • In one embodiment, the parental antibody (antibody without cysteine substitution) is an IgG, IgM, IgE, or IgA antibody. In a specific embodiment, the parental antibody is an IgG1 antibody. In another specific embodiment, the parental antibody is an IgG2, IgG3, or IgG4 antibody.
  • The present invention also provides modified antibodies or antibody fragments thereof comprising a substitution of one or more amino acids on its heavy chain constant region chosen from positions identified in Table 1. In some embodiments, the present invention provides modified antibodies or antibody fragments thereof comprising a substitution of one or more amino acids on its light chain constant region chosen from positions identified in Table 2 or Table 3.
  • In certain embodiments, the modified antibodies or antibody fragments provided herein are labeled using the methods of the invention in combination with other conjugation methods known in the art including, but not limited to, chemoselective conjugation through lysine, histidine, tyrosine, formyl-glycine, pyrrolysine, pyrroline-carboxy-lysine, unnatural amino acids, and protein tags for enzyme-mediated conjugation (e.g., S6 tags).
  • 2. Conjugation Chemistry
  • The conjugated antibody or antibody fragment thereof provided herein is produced by post-translational modification of at least one cysteine residue that was incorporated into the antibody or antibody fragment thereof as described above by site-specific labeling methods. The conjugated antibody or antibody fragment can be prepared by methods known in the art for conjugation of a payload of interest to cysteine residues that occur naturally in proteins, and by methods described for conjugation to proteins engineered to contain an additional cysteine residue substituted for another amino acid of a natural protein sequence.
  • In certain embodiments the modified antibodies or antibody fragment thereof provided herein are conjugated using known methods wherein the incorporated cysteine (cys) is conjugated to a maleimide derivative as Scheme Ia below. Modified antibodies of the invention that undergo this type of conjugation contain a thiol-maleimide linkage.
  • Figure US20160067351A1-20160310-C00012
  • where:
  • LU is a Linker Unit (LU), and
  • X is a payload or drug moiety.
  • In other embodiments, the Cys incorporated into the modified antibodies or antibody fragment is conjugated by reaction with an alpha-halo carbonyl compound such as a chloro-, bromo-, or iodo-acetamide as shown in Scheme Ib below. It is understood that other leaving groups besides halogen, such as tosylate, triflate and other alkyl or aryl sulfonates, can be used as the leaving group Y. While Scheme Ib depicts reaction of a Cys thiol with an alpha-halo acetamide, the method includes any alkylation of a sulfur of an incorporated Cys with a group of the formula Y—CHR—C(═O)—, where R is H or C1-4 alkyl, Y is a leaving group (typically Cl, Br, or I, and optionally an alkylsulfonate or arylsulfonate); it is not limited to amides.
  • Figure US20160067351A1-20160310-C00013
  • Alternatively, the Cys incorporated into the modified antibodies or antibody fragment can be conjugated by reaction with an external thiol under conditions that induce formation of a disulfide bond between the external thiol and the sulfur atom of the incorporated cysteine residue as shown in Scheme Ic below. In these examples, R can be H; however, compounds where one or both R groups represent an alkyl group, e.g., Methyl, have been found to increase the stability of the disulfide.
  • Figure US20160067351A1-20160310-C00014
  • By way of example only, such post-translational modifications are illustrated in Schemes (Ia)-(Ic) above, where the starting structure represents a cysteine incorporated into a light chain or heavy chain of an antibody at one of the specific sites identified herein. Methods for performing each of these conjugation methods are well known in the art. An antibody can be modified by these methods in its light chains, or its heavy chains, or in both light and heavy chains. An antibody in which each light chain or each heavy chain has been modified to contain a single incorporated cysteine will generally contain two conjugation sites, since an antibody typically contains two light and two heavy chains.
  • Upon conjugation, the modified antibodies of the invention typically contain 1-12, frequently 2-8, and preferably 2, 4 or 6-LU-X (Linker Unit-Payload) moieties. In some embodiments, an antibody light or heavy chain is modified to incorporate two new Cys residues at two of the specific sites identified herein for Cys substitutions (or alternatively one Cys is incorporated in the light chain and one in the heavy chain), so the tetrameric antibody ultimately contains four conjugation sites. Similarly the antibody can be modified by replacement of 3 or 4 of its native amino acids with Cys at the specific sites identified herein, in light chain or heavy chain or a combination thereof, resulting in 6 or 8 conjugation sites in the tetrameric antibody.
  • X in these conjugates represents a payload, which can be any chemical moiety that is useful to attach to an antibody. In some embodiments, X is a drug moiety selected from a cytotoxin, an anti-cancer agent, an anti-inflammatory agent, an antifungal agent, an antibacterial agent, an anti-parasitic agent, an anti-viral agent, an immune potentiator, and an anesthetic agent or any other therapeutic, or biologically active moiety or drug moiety. In other embodiments, X is a label such as a biophysical probe, a fluorophore, an affinity probe, a spectroscopic probe, a radioactive probe, a spin label, or a quantum dot. In other embodiments, X is a chemical moiety that modifies the antibody's physicochemical properties such as a lipid molecule, a polyethylene glycol, a polymer, a polysaccharide, a liposome, or a chelator. In other embodiments, X is a functional or detectable biomolecule such as a nucleic acid, a ribonucleic acid, a protein, a peptide (e.g., an enzyme or receptor), a sugar or polysaccharide, an antibody, or an antibody fragment. In other embodiments, X is an anchoring moiety such as a nanoparticle, a PLGA particle, or a surface, or any binding moiety for specifically binding the conjugate to another moiety, such as a histidine tag, poly-G, biotin, avidin, streptavidin, and the like. In other embodiments, X is a reactive functional group that can be used to attach the antibody conjugate to another chemical moiety, such as a drug moiety, a label, another antibody, another chemical moiety, or a surface.
  • The Linker Unit (LU) can be any suitable chemical moiety that covalently attaches the thiol-reactive group (e.g., maleimide, alpha-halo carbonyl, vinyl carbonyl (e.g., acrylate or acrylamide), vinyl sulfone, vinylpyridine, or thiol) to a payload. Many suitable LUs are known in the art. For example, LU can be comprised of one, two, three, four, five, six, or more than six linkers referred to herein as L1, L2, L3, L4, L5 and L6. In certain embodiments the LU comprises a linker selected from a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or any combination thereof, and the LU optionally contains a self-immolative spacer.
  • In some embodiments, LU is a group of the formula -L1-L2-L3-L4- or -L1-L-L3-L4-L5-L6-. Linking groups L1, L2, L3, L4, L5 and L6 for use in LU include alkylene groups —(CH2)n— (where n is 1-20, typically 1-10 or 1-6), ethylene glycol units (—CH2CH2O—)n (where n is 1-20, typically 1-10 or 1-6), amides —C(═O)—NH— or —NH—C(═O)—, esters —C(═O)—O— or —O—C(═O)—, rings having two available points of attachment such as divalent phenyl, C3-8 cycloalkyl or C4-8 heterocyclyl groups, amino acids —NH—CHR*—C═O— or —C(═O)—CHR*—NH—, where R* is the side chain of a known amino acid (frequently one of the canonical amino acids, but also including e.g. norvaline, norleucine, homoserine, homocysteine, phenylglycine, citrulline, and other named alpha-amino acids), polypeptides of known amino acids (e.g., dipeptides, tripeptides, tetrapeptides, etc.), thiol-maleimide linkages (from addition of —SH to maleimide), —S—CR2— and other thiol ethers such as —S—CR2—C(═O)— or —C(═O)—CR2—S—, where R is as defined above for Scheme Ic, —CH2—C(═O)—, and disulfides (—S—S—), as well as combinations of any of these with other linkers described below, e.g., a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or a linker that comprises a self-immolative spacer.
  • In some embodiments when LU is -L1-L-L3-L4-L5-L6-, L1, L2, L3, L4, L5 and L6 can be selected from:
      • -A1-, -A1X2— and —X2—; wherein:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m—, —(O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)nNH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, or —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—;
      • each X2 is independently selected from a bond, R8,
  • Figure US20160067351A1-20160310-C00015
    Figure US20160067351A1-20160310-C00016
    Figure US20160067351A1-20160310-C00017
      •  —CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected from
  • Figure US20160067351A1-20160310-C00018
      • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
  • In some embodiments, at least one of L1, L2, L3, L4, L5 and L6 is a stable, or non-cleavable, linker. In some embodiments, at least one of L1, L2, L3, L4, L5 and L6 is a cleavable linker, which may be chemically cleavable (hydrazones, disulfides) or enzymatically cleavable. In some embodiments, the enzymatically cleavable linker is one readily cleaved by a peptidase: The Val-Cit linker (valine-citrulline), a dipeptide of two known amino acids, is one such linker. In other embodiments, the enzymatically cleavable linker is one that is triggered by activity of a glucuronidase:
  • Figure US20160067351A1-20160310-C00019
  • is an example of such a linker, which also comprises a self-immolative spacer that falls apart spontaneously under physiological conditions once glucuronidase cleaves the glycosidic linkage.
  • In some embodiments, the immunoconjugate of the invention comprises a modified cysteine residue of the formula IIA or IIB:
  • Figure US20160067351A1-20160310-C00020
  • wherein —CH2—S— represents the side chain of Cys incorporated at one of the selected Cys substitution sites described herein, and L2-L6 and X represent linking groups and payloads, respectively, as further described herein. In some embodiments of IIA, L2 is a bond. In some embodiments of JIB, L2 is NH or O. In some embodiments of both IIA and IIB, L3 is selected from (CH2)1-10 and (CH2CH2O)1-6. L4, L5 and L6 are additional optional linkers selected from those described herein. In certain embodiments, L6 can be a carbonyl (C═O) or a linker that comprises a self-immolative spacer.
  • In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein:
    • L1 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L2 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L3 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker, and
    • L4 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or a linker that comprises a self-immolative spacer.
  • In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L2 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L3 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker, and
    • L4 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or a linker that comprises a self-immolative spacer.
  • In some of the embodiments of LU at least one of L1, L2, L3, L4, L5 and L6 is a cleavable linker, and LU is considered cleavable. Similarly, in some of the embodiments of LU at least one of L1, L2, L3, L4, L5 and L6 is a non-cleavable linker. In certain of these embodiments, each linker of LU is non-cleavable, and LU is considered non-cleavable.
  • In some of the foregoing embodiments wherein LU is -L1-L2-L3-L4-, at least one of L1, L2, L3 and L4 is a linker selected from -A1-, -A1X2— and —X2—; wherein:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m—, —(O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —(((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)nNH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, or —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—;
      • each X2 is independently selected from a bond, R8,
  • Figure US20160067351A1-20160310-C00021
    Figure US20160067351A1-20160310-C00022
    Figure US20160067351A1-20160310-C00023
      •  —CHR4(CH2)nC(═O)NH—, —CHR4(CH2)—NHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected
  • Figure US20160067351A1-20160310-C00024
  • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
  • In these embodiments, the other linkers of LU are independently selected from a bond, -A1-, -A1X2—, —X2—, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker and a linker that comprises a self-immolative spacer.
  • In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—; where:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m—, —(O(C(R4)2)n)m—, —((CH2)nO)m, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —(((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)nNH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, or —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—;
      • each X2 is independently selected from a bond, R8
  • Figure US20160067351A1-20160310-C00025
    Figure US20160067351A1-20160310-C00026
    Figure US20160067351A1-20160310-C00027
      •  CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1 alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected from
  • Figure US20160067351A1-20160310-C00028
      • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9;
    • L2 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L3 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker, and
    • L4 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or a linker that comprises a self-immolative spacer.
  • In certain embodiments, L1 is C(═O)—CH2CH2—NH—C(═O)—CH2CH2—S—, so LU is —C(═O)—CH2CH2—NH—C(═O)—CH2CH2—S-L2-L3-L4-.
  • In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—; where:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —(O(CH2)n)m—, —((CH2)nO)m—, —((CH2)nO)m(CH2)n—, —(CH2)nC(═O)NH—, —(CH2)nNHC(═O)—, —NHC(═O)(CH2)n—, —C(═O)NH(CH2)nS—, —S(CH2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)(CH2)n—, —(CH2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, or —(O(CH2)n)mNHC(═O)(CH2)n—;
      • each X2 is independently selected from a bond, R8
  • Figure US20160067351A1-20160310-C00029
    Figure US20160067351A1-20160310-C00030
    Figure US20160067351A1-20160310-C00031
      •  -CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected
  • Figure US20160067351A1-20160310-C00032
      • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9;
    • L2 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L3 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L4 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or a linker that comprises a self-immolative spacer.
  • In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—; where:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(CH2)nS—, —(O(CH2)n)m, —((CH2)nO)m(CH2)n—, —NHC(═O)(CH2)n—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n— or —(O(CH2)n)mNHC(═O)(CH2)n—;
      • each X2 is independently selected from a bond, R8
  • Figure US20160067351A1-20160310-C00033
    Figure US20160067351A1-20160310-C00034
    Figure US20160067351A1-20160310-C00035
    Figure US20160067351A1-20160310-C00036
      •  —CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected
  • Figure US20160067351A1-20160310-C00037
      • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9;
    • L2 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker;
    • L3 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker or a photo-cleavable linker, and
    • L4 is a bond, a non-enzymatically cleavable linker, a non-cleavable linker, an enzymatically cleavable linker, a photo-stable linker, a photo-cleavable linker or a linker that comprises a self-immolative spacer.
      In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—; where:
      • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(CH2)nS—, —(O(CH2)n)m—, —((CH2)nO)m(CH2)n—, —NHC(═O)(CH2)n—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n— or —(O(CH2)n)OmNHC(═O)(CH2)n—;
      • each X2 is independently selected from a bond, R8
  • Figure US20160067351A1-20160310-C00038
    Figure US20160067351A1-20160310-C00039
    Figure US20160067351A1-20160310-C00040
    Figure US20160067351A1-20160310-C00041
      •  -CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
      • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
      • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
      • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
      • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected from
  • Figure US20160067351A1-20160310-C00042
      • R9 is independently selected from H and C1-6haloalkyl;
      • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
      • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9;
    • L2 is a bond, a non-enzymatically cleavable linker or a non-cleavable linker;
    • L3 is a bond, a non-enzymatically cleavable linker or a non-cleavable linker;
    • L4 is a bond, an enzymatically cleavable linker or a linker that comprises a self-immolative spacer.
      In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—;
    • L2 is a bond, -A2-, or -A2X2—;
    • L3 is a bond, -A3-, or -A3X2—;
    • L4 is a bond, -A4-, -A4X2—,
  • Figure US20160067351A1-20160310-C00043
    Figure US20160067351A1-20160310-C00044
    • A1 is —C(═O)NH—, —NHC(═O)—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m, —(O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —(((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)nNH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, or —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—;
    • A2 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m, —O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NR4—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —(CH2)nS—, —(C(R4)2)nS—, —S(CH2)n—, —S(C(R4)2)n—, —(CH2)nNH—, —(C(R4)2)nNH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)n(O(CH2)n)mOC(═O)NH(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mOC(═O)NH(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)nNH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, —(O(C(R4)2)n)mNHC(═O)(C(O2)n—,
  • Figure US20160067351A1-20160310-C00045
    • A3 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m, —(O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —(((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —(CH2)nS—, —(C(R4)2)nS—, —S(CH2)n—, —S(C(R4)2)n—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(O2)n—, —(CH2)n(O(CH2)n)mOC(═O)NH(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mOC(═O)NH(C(R4)2)n—, —(CH2)n(O(CH2)n)mOC(═O)—, —(C(R4)2)n(O(C(R4)2)n)mOC(═O)—, —(CH2)n(O(CH2)n)mC(═O)—, —(C(R4)2)n(O(C(R4)2)n)mC(═O)—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—,
  • Figure US20160067351A1-20160310-C00046
    • A4 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(C(R4)2)n—, —(O(CH2)n)m, —(O(C(R4)2)n)m—, —((CH2)nO)m—, —((C(R4)2)nO)m—, —((CH2)nO)m(CH2)n—, —(((C(R4)2)nO)mC(R4)2)n—, —(CH2)nC(═O)NH—, —(C(R4)2)nC(═O)NH—, —(CH2)nNHC(═O)—, —(C(R4)2)nNHC(═O)—, —NHC(═O)(CH2)n—, —NHC(═O)(C(R4)2)n—, —C(═O)NH(CH2)nS—, —C(═O)NH(C(R4)2)nS—, —S(CH2)nC(═O)NH—, —S(C(R4)2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)NH(C(R4)2)nNHC(═O)(C(R4)2)n—, —C(═O)(CH2)n—, —C(═O)(C(R4)2)n—, —(CH2)nC(═O)—, —(C(R4)2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(C(R4)2)n(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—, —(CH2)nNHC(═O)(CH2)n—, —(C(R4)2)nNHC(═O)(C(R4)2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(C(R4)2)—NH((C(R4)2)nO)m(C(R4)2)n—, —(O(CH2)n)mNHC(═O)(CH2)n—, or —(O(C(R4)2)n)mNHC(═O)(C(R4)2)n—;
      • each X2 is independently selected from a bond, R8
  • Figure US20160067351A1-20160310-C00047
    Figure US20160067351A1-20160310-C00048
    Figure US20160067351A1-20160310-C00049
    Figure US20160067351A1-20160310-C00050
      •  CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
    • each R4 is independently selected from H, C1 alkyl, side chains of known amino acids, —C(═O)OH and —OH,
    • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
    • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
    • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected from
  • Figure US20160067351A1-20160310-C00051
    • R9 is independently selected from H and C1-6haloalkyl;
    • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
    • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
      In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—;
    • L2 is a bond, -A2-, or -A2X2—;
    • L3 is a bond, -A3-, or -A3X2—;
    • L4 is a bond, -A4-, -A4X2—,
  • Figure US20160067351A1-20160310-C00052
    Figure US20160067351A1-20160310-C00053
    • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —(O(CH2)n)m—, ((CH2)nO)m—, —((CH2)nO)m(CH2)n—, —(CH2)nC(═O)NH—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nS—, —S(CH2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)(CH2)n—, —(CH2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n— or —(O(CH2)n)mNHC(═O)(CH2)n—;
    • A2 is —C(═O)NH—, —C(═O)NH(CH2)n—, —(O(CH2)n)m—, —(CH2)nO)m—, —((CH2)nO)m(CH2)n—, —(CH2)nC(═O)NH—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nS—, —S(CH2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)(CH2)n—, —(CH2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(O(CH2)n)mNHC(═O)(CH2)n— or
  • Figure US20160067351A1-20160310-C00054
    • A3 is —C(═O)NH—, —C(═O)NH(CH2)n—, —(O(CH2)n)m—, —((CH2)nO)m—, —((CH2)nO)m(CH2)n—, —(CH2)nC(═O)NH—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nS—, —S(CH2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)(CH2)n—, —(CH2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(O(CH2)n)mNHC(═O)(CH2)n— or
  • Figure US20160067351A1-20160310-C00055
    • A4 —C(═O)NH—, —C(═O)NH(CH2)n—, —(O(CH2)n)m—, —((CH2)nO)m—, —((CH2)nO)m(CH2)n—, —(CH2)nC(═O)NH—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nS—, —S(CH2)nC(═O)NH—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —C(═O)(CH2)n—, —(CH2)nC(═O)—, —(CH2)n(O(CH2)n)mNHC(═O)(CH2)n—, —(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n— or —(O(CH2)n)mNHC(═O)(CH2)n—;
    • each X2 is independently selected from a bond,
  • Figure US20160067351A1-20160310-C00056
      • —CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nNHC(═O)—, —C(═O)NH— and —NHC(═O)—;
    • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
    • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
    • each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
    • each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
      In certain embodiments the Linker Unit (LU) is -L1-L2-L3-L4-, wherein
    • L1 is a bond, -A1-, -A1X2— or —X2—;
    • L2 is a bond, -A2-, or -A2X2—;
    • L3 is a bond, -A3-, or -A3X2—;
    • L4 is a bond, -A4-, -A4X2—,
  • Figure US20160067351A1-20160310-C00057
    Figure US20160067351A1-20160310-C00058
    • A1 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(CH2)nS—, —(O(CH2)n)m, —((CH2)nO)m(CH2)n—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)n)m(CH2)n— or —(O(CH2)n)mNHC(═O)(CH2)n—;
    • A2 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(CH2)nS—, —(O(CH2)n)m—, —((CH2)nO)m(CH2)n—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(O(CH2)n)mNHC(═O)(CH2)n— or
  • Figure US20160067351A1-20160310-C00059
    • A3 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(CH2)nS—, —(O(CH2)n)m, —((CH2)nO)m(CH2)n—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)nO)m(CH2)n—, —(O(CH2)n)mNHC(═O)(CH2)n— or
  • Figure US20160067351A1-20160310-C00060
    • A4 is —C(═O)NH—, —C(═O)NH(CH2)n—, —C(═O)NH(CH2)nS—, —(O(CH2)n)m—, —((CH2)nO)m(CH2)n—, —NHC(═O)(CH2)n—, —(CH2)nNHC(═O)—, —C(═O)NH(CH2)nNHC(═O)(CH2)n—, —(CH2)nNH((CH2)O)m(CH2)n— or —(O(CH2)n)mNHC(═O)(CH2)n—;
      • each X2 is independently selected from a bond, R8
  • Figure US20160067351A1-20160310-C00061
    Figure US20160067351A1-20160310-C00062
    Figure US20160067351A1-20160310-C00063
    Figure US20160067351A1-20160310-C00064
      •  -CHR4(CH2)nC(═O)NH—, —CHR4(CH2)nHC(═O)—, —C(═O)NH— and —NHC(═O)—;
    • each R4 is independently selected from H, C1-4alkyl, side chains of known amino acids, —C(═O)OH and —OH,
    • each R5 is independently selected from H, C1-4alkyl, phenyl or C1-4alkyl substituted with 1 to 3 —OH groups;
    • each R6 is independently selected from H, fluoro, benzyloxy substituted with —C(═O)OH, benzyl substituted with —C(═O)OH, C1-4alkoxy substituted with —C(═O)OH and C1-4alkyl substituted with —C(═O)OH;
    • R7 is independently selected from H, C1-4alkyl, phenyl, pyrimidine and pyridine;
      • R8 is independently selected from
  • Figure US20160067351A1-20160310-C00065
  • R9 is independently selected from H and C1-6haloalkyl;
    each n is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9, and
    each m is independently selected from 1, 2, 3, 4, 5, 6, 7, 8 and 9.
  • In one embodiment, L1 is —(CH2)1-10—C(═O)—, e.g., —(CH2)5—C(═O)—; and L2, L3 and L4 each represent a bond.
  • In certain embodiments LU comprises a val-cit linker of this formula, wherein X represents a payload, typically a drug moiety such as one having anticancer activity:
  • Figure US20160067351A1-20160310-C00066
  • When L4-L5-L6 is a val-cit linker as shown above, L3 is preferably —(CH2)2-6—C(═O)—.
  • In certain embodiments the X group is a maytansinoid such as DM1 or DM4, or a dolastatin analog or derivative such as dolastatin 10 or 15 and auristatins MMAF or MMAE, or a calicheamicin such as N-acetyl-γ-calicheamicin, or a label or dye such as rhodamine or tetramethylrhodamine.
  • As used herein, a “linker” is any chemical moiety that is capable of connecting an antibody or a fragment thereof to an X group (payload) to form an immunoconjugate. Linkers can be susceptible to cleavage, such as, acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the compound or the antibody remains active. Alternatively, linkers can be substantially resistant to cleavage. A linker may or may not include a self-immolative spacer.
  • Non-limiting examples of the non-enzymatically cleavable linkers as used herein to conjugate an X1 group to the modified antibodies or antibody fragment thereof provided herein include, acid-labile linkers, linkers containing a disulfide moiety, linkers containing a triazole moiety, linkers containing a hydrazone moiety, linkers containing a thioether moiety, linkers containing a diazo moiety, linkers containing an oxime moiety, linkers containing an amide moiety and linkers containing an acetamide moiety.
  • Non-limiting examples of the enzymatically cleavable linkers as used herein to conjugate an X group to the modified antibodies or antibody fragment thereof provided herein include, but are not limited to, linkers that are cleaved by a protease, linkers that are cleaved by an amidase, and linkers that are cleaved by -glucuronidase or another glycosidase.
  • In certain embodiments, such enzyme cleavable linkers are linkers which are cleaved by cathepsin, including cathepsin Z, cathepsin B, cathepsin H and cathepsin C. In certain embodiments the enzymatically cleavable linker is a dipeptide cleaved by cathepsin, including dipeptides cleaved by cathepsin Z, cathepsin B, cathepsin H or cathepsin C. In certain embodiments the enzymatically cleavable linker is a cathepsin B-cleavable peptide linker. In certain embodiments the enzymatically cleavable linker is a cathepsin B-cleavable dipeptide linker. In certain embodiments the enzymatically cleavable dipeptide linker is valine-citrulline or phenylalanine-lysine. Other non-limiting examples of the enzymatically cleavable linkers as used herein conjugate an X group to the modified antibodies or antibody fragment thereof provided herein include, but are not limited to, linkers which are cleaved
  • by -glucuronidase, e.g.,
  • Figure US20160067351A1-20160310-C00067
  • See Ducry et al, Bioconjugate Chem, (2010) vol. 21(1), 5-13.
  • “Self-immolative spacers” are bifunctional chemical moieties covalently linked at one terminus to a first chemical moiety and at the other terminus to a second chemical moiety, thereby forming a stable tripartate molecule. A linker can comprise a self-immolative spacer bonded to a third chemical moiety that is cleavable from the spacer either chemically or enzymatically. Upon cleavage of a bond between the self-immolative spacer and the first chemical moiety or the third chemical moiety, self-immolative spacers undergo rapid and spontaneous intramolecular reactions and thereby separate from the second chemical moiety. These intramolecular reactions generally involve electronic rearrangements such as 1,4, or 1,6, or 1,8 elimination reactions or cyclizations to form highly favored five- or six-membered rings. In certain embodiments of the present invention, the first or third moiety is an enzyme cleavable group, and this cleavage results from an enzymatic reaction, while in other embodiments the first or third moiety is an acid labile group and this cleavage occurs due to a change in pH. As applied to the present invention, the second moiety is the “Payload” group as defined herein. In certain embodiments, cleavage of the first or third moiety from the self-immolative spacer results from cleavage by a proteolytic enzyme, while in other embodiments it results from cleaved by a hydrolase. In certain embodiments, cleavage of the first or third moiety from the self-immolative spacer results from cleavage by a cathepsin enzyme or a glucuronidase.
  • In certain embodiments, the enzyme cleavable linker is a peptide linker and the self-immolative spacer is covalently linked at one of its ends to the peptide linker and covalently linked at its other end to a drug moiety. This tripartite molecule is stable and pharmacologically inactive in the absence of an enzyme, but which is enzymatically cleavable by enzyme at a bond covalently linking the spacer moiety and the peptide moiety. The peptide moiety is cleaved from the tripartate molecule which initiates the self-immolating character of the spacer moiety, resulting in spontaneous cleavage of the bond covalently linking the spacer moiety to the drug moiety, to thereby effect release of the drug in pharmacologically active form.
  • In other embodiments, a linker comprises a self-immolative spacer that connects to the peptide, either directly or indirectly at one end, and to a payload at the other end; and the spacer is attached to a third moiety that can be cleaved from the spacer enzymatically, such as by a glucuronidase. Upon cleavage of the third moiety, the spacer degrades or rearranges in a way that causes the payload to be released. An example of a linker with this type of self-immolative spacer is this glucuronidase-cleavable linker, where hydrolysis of the acetal catalyzed by glucuronidase releases a phenolic compound that spontaneously decomposes under physiological conditions:
  • Figure US20160067351A1-20160310-C00068
  • Non-limiting examples of the self-immolative spacer optionally used in the conjugation of an X1 group to the modified antibodies or antibody fragment thereof provided herein include, but are not limited to, moieties which include a benzyl carbonyl moiety, a benzyl ether moiety, a 4-aminobutyrate moiety, a hemithioaminal moiety or a N-acylhemithioaminal moiety.
  • Other examples of self-immolative spacers include, but are not limited to, p-aminobenzyloxycarbonyl groups, aromatic compounds that are electronically similar to the p-aminobenzyloxycarbonyl group, such as 2-aminoimidazol-5-methanol derivatives and ortho or para-aminobenzylacetals. In certain embodiments, self-immolative spacers used herein which undergo cyclization upon amide bond hydrolysis, include substituted and unsubstituted 4-aminobutyric acid amides and 2-aminophenylpropionic acid amides.
  • In certain embodiments, the self-immolative spacer is
  • Figure US20160067351A1-20160310-C00069
  • while in other embodiments the self-immolative spacer is
  • Figure US20160067351A1-20160310-C00070
  • where n is 1 or 2. In other embodiments the self-immolative spacer is
  • Figure US20160067351A1-20160310-C00071
  • where n is 1 or 2. In other embodiments the self-immolative spacer is
  • Figure US20160067351A1-20160310-C00072
  • where n is 1 or 2. In other embodiments the self-immolative spacer is
  • Figure US20160067351A1-20160310-C00073
  • where n is 1 or 2. In other embodiments the self-immolative spacer is
  • Figure US20160067351A1-20160310-C00074
  • where n is 1 or 2.
  • Schemes (2a-2c) illustrate the post-translational modification of the modified antibodies or antibody fragment thereof provided herein wherein the Linker Unit (LU) is -L1-L2-L3-L4-, and L1 in each case is the group that reacts with the new Cys.
  • Figure US20160067351A1-20160310-C00075
  • Figure US20160067351A1-20160310-C00076
  • Figure US20160067351A1-20160310-C00077
  • In each of Schemes 2a-2c, the starting material is the replacement Cys residue in an antibody or antibody fragment modified as described herein, where the dashed bonds indicate connection to adjoining residues of the antibody or antibody fragment; each R is H or C1-4 alkyl, typically H or methyl; L2, L3 and L4 are components of the linking unit LU, such as those described above; X is the payload; and the group connecting L2 to the sulfur of the substitute Cys of the invention is L1.
  • In some embodiments of the invention, X is a reactive functional group that can be used to connect the conjugated antibody to another chemical moiety, by interacting with a suitable complementary functional group. Table 4 depicts some examples of reactive functional groups that X can represent, along with a complementary functional group that can be used to connect a conjugate comprising X to another compound. Methods for using X to connect to the corresponding complementary functional group are well known in the art. Connections using azide are typically done using ‘Click’ or copper-free click chemistry; reactions involving hydrazines, alkoxyamines or acyl hydrazines typically proceed through the formation of a Schiff base with one of the carbonyl functional groups.
  • TABLE 4
    X Complementary Reactive Functional Group for X
    a thiol a thiol, a maleimide, a haloacetamide, a vinyl
    sulfone, or a vinylpyridine
    an azide an alkene, alkyne, a phosphine-(thio)ester, a
    cyclooctyne, a cyclooctene or an oxanobornadiene
    a phosphine- an azide
    (thio)ester)
    an oxanobornadiene an azide or a tetrazine
    an alkyne an azide or a tetrazine
    an alkene a tetrazine
    a cyclooctyne an azide or a tetrazine
    a cyclooctene a tetrazine
    a norbomene a tetrazine
    a tetrazine a norbornene, an alkene, alkyne, a cyclooctyne or
    an oxanobornadiene
    an aldehyde a hydroxylamine, a hydrazine or
    NH2—NH—C(═O)—
    a ketone a hydroxylamine, a hydrazine or
    NH2—NH—C(═O)—
    a hydroxylamine an aldehyde or a ketone
    a hydrazine an aldehyde or a ketone
    NH2—NH—C(═O)— an aldehyde or a ketone
    a haloacetamide a thiol
    a thiol a thiol
    a maleimide a thiol
    a vinyl sulfone a thiol
    a vinylpyridine a thiol

    Exemplary products of the connections made using these components are depicted in Table 5, where Y1 represents an antibody of the invention, A1 represents a linking unit (LU) connecting the antibody to payload Xa, -L2-L3-L4- in Formula II-a represents a linker unit that can be present in a molecule to be connected to the conjugated antibody via Xa, and X1 represents a payload. Payload Xa is a reactive functional group, and Xb on Formula II-a is the corresponding complementary functional group, and Formula II-a itself represents a molecule to be connected to the conjugated antibody. The third column in Table 5 depicts a product from reaction of Xa with Xb.
  • TABLE 5
    Xb—L2—L3—L4—X1
    Y1—A1—Xa Formula (II-a) Y1—A1—X2—L2—L3—L4—X1
    Y1—A1—N3 HC≡C—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00078
    Y1—A1—N3 HC≡C—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00079
    Y1—A1—C≡CH N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00080
    Y1—A1—C≡CH N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00081
    Figure US20160067351A1-20160310-C00082
    NH2—O—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00083
    Figure US20160067351A1-20160310-C00084
    NH2—O—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00085
    Figure US20160067351A1-20160310-C00086
    CH3C(═O)—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00087
    Figure US20160067351A1-20160310-C00088
    HC(═O)—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00089
    Figure US20160067351A1-20160310-C00090
    HS—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00091
    Figure US20160067351A1-20160310-C00092
    Figure US20160067351A1-20160310-C00093
    Figure US20160067351A1-20160310-C00094
    Figure US20160067351A1-20160310-C00095
    Figure US20160067351A1-20160310-C00096
    Figure US20160067351A1-20160310-C00097
    Figure US20160067351A1-20160310-C00098
    HS—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00099
    Figure US20160067351A1-20160310-C00100
    Figure US20160067351A1-20160310-C00101
    Figure US20160067351A1-20160310-C00102
    Figure US20160067351A1-20160310-C00103
    HS—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00104
    Figure US20160067351A1-20160310-C00105
    NH2—NH—C(═O)—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00106
    Figure US20160067351A1-20160310-C00107
    NH2—NH—C(═O)—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00108
    Figure US20160067351A1-20160310-C00109
    R5C(═O)—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00110
    Figure US20160067351A1-20160310-C00111
    HC(═O)—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00112
    Figure US20160067351A1-20160310-C00113
    HS—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00114
    Y1—A1—N3
    Figure US20160067351A1-20160310-C00115
    Figure US20160067351A1-20160310-C00116
    Figure US20160067351A1-20160310-C00117
    N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00118
    Y1—A1—N3
    Figure US20160067351A1-20160310-C00119
    Figure US20160067351A1-20160310-C00120
    Figure US20160067351A1-20160310-C00121
    N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00122
    Y1—A1—N3
    Figure US20160067351A1-20160310-C00123
    Figure US20160067351A1-20160310-C00124
    Figure US20160067351A1-20160310-C00125
    N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00126
    Figure US20160067351A1-20160310-C00127
    Figure US20160067351A1-20160310-C00128
    Figure US20160067351A1-20160310-C00129
    Figure US20160067351A1-20160310-C00130
    Figure US20160067351A1-20160310-C00131
    Figure US20160067351A1-20160310-C00132
    Figure US20160067351A1-20160310-C00133
    Figure US20160067351A1-20160310-C00134
    Figure US20160067351A1-20160310-C00135
    Figure US20160067351A1-20160310-C00136
    Figure US20160067351A1-20160310-C00137
    Figure US20160067351A1-20160310-C00138
    Figure US20160067351A1-20160310-C00139
    N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00140
    Y1—A1—N3
    Figure US20160067351A1-20160310-C00141
    Figure US20160067351A1-20160310-C00142
    Figure US20160067351A1-20160310-C00143
    Figure US20160067351A1-20160310-C00144
    Figure US20160067351A1-20160310-C00145
    Figure US20160067351A1-20160310-C00146
    Figure US20160067351A1-20160310-C00147
    Figure US20160067351A1-20160310-C00148
    Y1—A1—N3
    Figure US20160067351A1-20160310-C00149
    Figure US20160067351A1-20160310-C00150
    Figure US20160067351A1-20160310-C00151
    N3—L2—L3—L4—X1
    Figure US20160067351A1-20160310-C00152
  • In certain embodiments, the modified antibody or antibody fragment thereof provided herein is conjugated with an “X group-to-antibody” (payload to antibody) ratio between about 1 and 16, such as 1-12, or 1, 2, 3, 4, 5, 6, 7, or 8, wherein the modified antibody or antibody fragment thereof contains 1, 2, 3, 4, 5, 6, 7, or 8 cysteine residues incorporated at the specific sites disclosed herein. For example, an “X group-to-antibody” ratio of 4 can be achieved by incorporating two Cys residues into the heavy chain of an antibody, which will contain 4 conjugation sites, two from each heavy chain Immunoconjugates of such antibodies will contain up to 4 payload groups, which may be alike or different and are preferably all alike. In another example, an “X group-to-antibody” ratio of 4 can be achieved by incorporating one Cys residue into the heavy chain and a second Cys residue into the light chain of an antibody resulting in 4 conjugation sites, two in the two heavy chains and two in the two light chains. A ratio 6, 8 or higher can be achieved by combinations of 3, 4 or more cysteine substitutions of the invention in heavy and light chain of the antibody. Substituting multiple cysteine groups into an antibody can lead to inappropriate disulfide formation and other problems. Thus for loading more than 4 payload groups onto one antibody molecule, the methods of the invention can alternatively be combined with methods that do not rely upon reactions at cysteine sulfur, such as acylations at lysine, or conjugation via S6 tags or Pcl methodology.
  • While the payload to antibody ratio has an exact value for a specific conjugate molecule, it is understood that the value will often be an average value when used to describe a sample containing many molecules, due to some degree of inhomogeneity, typically in the conjugation step. The average loading for a sample of an immunoconjugate is referred to herein as the drug to antibody ratio, or DAR. In some embodiments, the DAR is between about 1 and about 16, and typically is about 1, 2, 3, 4, 5, 6, 7, or 8. In some embodiments, at least 50% of a sample by weight is compound having the average ratio plus or minus 2, and preferably at least 50% of the sample is a conjugate that contains the average ratio plus or minus 1. Preferred embodiments include immunoconjugates wherein the DAR is about 2 or about 8, e.g., about 2, about 4, about 6 or about 8. In some embodiments, a DAR of ‘about n’ means the measured value for DAR is within 10% of n (in Formula (I)).
  • 3. Further Alteration of the Framework of Fc Region
  • The present invention provides site-specific labeled immunoconjugates. The immunoconjugates of the invention may comprise modified antibodies or antibody fragments thereof that further comprise modifications to framework residues within VH and/or VL, e.g. to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to “back-mutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived. To return the framework region sequences to their germline configuration, the somatic mutations can be “back-mutated” to the germline sequence by, for example, site-directed mutagenesis. Such “back-mutated” antibodies are also intended to be encompassed by the invention.
  • Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T-cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Patent Publication No. 20030153043 by Carr et al.
  • In addition or alternative to modifications made within the framework or CDR regions, antibodies of the invention may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity. Furthermore, an antibody of the invention may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody. Each of these embodiments is described in further detail below.
  • In one embodiment, the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425 by Bodmer et al. The number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • In another embodiment, the Fc hinge region of an antibody is mutated to decrease the biological half-life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Pat. No. 6,165,745 by Ward et al.
  • In yet other embodiments, the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector functions of the antibody. For example, one or more amino acids can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen-binding ability of the parent antibody. The effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in, e.g., U.S. Pat. Nos. 5,624,821 and 5,648,260, both by Winter et al.
  • In another embodiment, one or more amino acids selected from amino acid residues can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC). This approach is described in, e.g., U.S. Pat. No. 6,194,551 by Idusogie et al.
  • In another embodiment, one or more amino acid residues are altered to thereby alter the ability of the antibody to fix complement. This approach is described in, e.g., the PCT Publication WO 94/29351 by Bodmer et al. In a specific embodiment, one or more amino acids of an antibody or antibody fragment thereof of the present invention are replaced by one or more allotypic amino acid residues, such as those shown in FIG. 4 for the IgG1 subclass and the kappa isotype. Allotypic amino acid residues also include, but are not limited to, the constant region of the heavy chain of the IgG1, IgG2, and IgG3 subclasses as well as the constant region of the light chain of the kappa isotype as described by Jefferis et al., MAbs. 1:332-338 (2009).
  • In yet another embodiment, the Fc region is modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fcγ receptor by modifying one or more amino acids. This approach is described in, e.g., the PCT Publication WO 00/42072 by Presta. Moreover, the binding sites on human IgG1 for FcγR1, FcγRII, FcγRIII and FcRn have been mapped and variants with improved binding have been described (see Shields et al., J. Biol. Chem. 276:6591-6604, 2001).
  • In still another embodiment, the glycosylation of an antibody is modified. For example, an aglycosylated antibody can be made (i.e., the antibody lacks glycosylation). Glycosylation can be altered to, for example, increase the affinity of the antibody for “antigen.” Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such aglycosylation may increase the affinity of the antibody for antigen. Such an approach is described in, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861 by Co et al.
  • Additionally or alternatively, an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation. For example, EP 1,176,195 by Hang et al. describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation. PCT Publication WO 03/035835 by Presta describes a variant CHO cell line, Lec13 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also Shields et al., (2002) J. Biol. Chem. 277:26733-26740). PCT Publication WO 99/54342 by Umana et al. describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., beta(1,4)-N acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also Umana et al., Nat. Biotech. 17:176-180, 1999).
  • In another embodiment, the antibody is modified to increase its biological half-life. Various approaches are possible. For example, one or more of the following mutations can be introduced: T252L, T254S, or T256F, as described in U.S. Pat. No. 6,277,375 to Ward. Alternatively, to increase the biological half-life, the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022 by Presta et al.
  • 4. Antibody Conjugates
  • The present invention provides site-specific labeling methods, modified antibodies and antibody fragments thereof, and immunoconjugates prepared accordingly. Using the methods of the invention, a modified antibody or antibody fragments thereof can be conjugated to a label, such as a drug moiety, e.g., an anti-cancer agent, an autoimmune treatment agent, an anti-inflammatory agent, an antifungal agent, an antibacterial agent, an anti-parasitic agent, an anti-viral agent, or an anesthetic agent, or an imaging reagent, such as a chelator for PET imaging, or a fluorescent label, or a MRI contrast reagent. An antibody or antibody fragments can also be conjugated using several identical or different labeling moieties combining the methods of the invention with other conjugation methods.
  • In certain embodiments, the immunoconjugates of the present invention comprise a drug moiety selected from a V-ATPase inhibitor, a HSP90 inhibitor, an IAP inhibitor, an mTor inhibitor, a microtubule stabilizer, a microtubule destabilizer, an auristatin, a dolastatin, a maytansinoid, a MetAP (methionine aminopeptidase), an inhibitor of nuclear export of proteins CRM1, a DPPIV inhibitor, proteasome inhibitors, an inhibitor of phosphoryl transfer reactions in mitochondria, a protein synthesis inhibitor, a kinase inhibitor, a CDK2 inhibitor, a CDK9 inhibitor, an HDAC inhibitor, a DNA damaging agent, a DNA alkylating agent, a DNA intercalator, a DNA minor groove binder, topoisomerase inhibitors, RNA synthesis inhibitors, kinesin inhibitors, inhibitors of protein-protein interactions, and a DHFR inhibitor.
  • Further, the modified antibodies or antibody fragments of the present invention may be conjugated to a drug moiety that modifies a given biological response. Drug moieties are not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be an immune modulator, such as an immune potentiator, a small molecule immune potentiator, a TLR agonist, a CpG oligomer, a TLR2 agonist, a TLR4 agonist, a TLR7 agonist, a TLR9 agonist, a TLR8 agonist, a T-cell epitope peptide or a like. The drug moiety may also be an oligonucleotide, a siRNA, a shRNA, a cDNA or a like. Alternatively, the drug moiety may be a protein, peptide, or polypeptide possessing a desired biological activity. Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, cholera toxin, or diphtheria toxin, a protein such as tumor necrosis factor, α-interferon, β-interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, a cytokine, an apoptotic agent, an anti-angiogenic agent, or, a biological response modifier such as, for example, a lymphokine.
  • In one embodiment, the modified antibodies or antibody fragments of the present invention are conjugated to a drug moiety, such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin. Examples of cytotoxin include but not limited to, taxanes (see, e.g., International (PCT) Patent Application Nos. WO 01/38318 and PCT/US03/02675), DNA-alkylating agents (e.g., CC-1065 analogs), anthracyclines, tubulysin analogs, duocarmycin analogs, auristatin E, auristatin F, maytansinoids, and cytotoxic agents comprising a reactive polyethylene glycol moiety (see, e.g., Sasse et al., J. Antibiot. (Tokyo), 53, 879-85 (2000), Suzawa et al., Bioorg. Med. Chem., 8, 2175-84 (2000), Ichimura et al., J. Antibiot. (Tokyo), 44, 1045-53 (1991), Francisco et al., Blood (2003) (electronic publication prior to print publication), U.S. Pat. Nos. 5,475,092, 6,340,701, 6,372,738, and 6,436,931, U.S. Patent Application Publication No. 2001/0036923 A1, Pending U.S. patent application Ser. Nos. 10/024,290 and 10/116,053, and International (PCT) Patent Application No. WO 01/49698), taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, and puromycin and analogs or homologs thereof. Therapeutic agents also include, for example, anti-metabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), ablating agents (e.g., mechlorethamine, thiotepa chlorambucil, meiphalan, carmustine (BSNU) and lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin, anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine and vinblastine). (See e.g., Seattle Genetics US20090304721).
  • Other examples of therapeutic cytotoxins that can be conjugated to the modified antibodies or antibody fragments of the invention include duocarmycins, calicheamicins, maytansines and auristatins, and derivatives thereof. An example of a calicheamicin antibody conjugate is commercially available (Mylotarg™; Wyeth-Ayerst).
  • For further discussion of types of cytotoxins, linkers and methods for conjugating therapeutic agents to antibodies, see also Saito et al., (2003) Adv. Drug Deliv. Rev. 55:199-215; Trail et al., (2003) Cancer Immunol. Immunother. 52:328-337; Payne, (2003) Cancer Cell 3:207-212; Allen, (2002) Nat. Rev. Cancer 2:750-763; Pastan and Kreitman, (2002) Curr. Opin. Investig. Drugs 3:1089-1091; Senter and Springer, (2001) Adv. Drug Deliv. Rev. 53:247-264.
  • According to the present invention, modified antibodies or antibody fragments thereof can also be conjugated to a radioactive isotope to generate cytotoxic radiopharmaceuticals, referred to as radioimmunoconjugates. Examples of radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include, but are not limited to, iodine131, indium111, yttrium90, and lutetium177. Methods for preparing radioimmunoconjugates are established in the art. Examples of radioimmunoconjugates are commercially available, including Zevalin™ (DEC Pharmaceuticals) and Bexxar™ (Corixa Pharmaceuticals), and similar methods can be used to prepare radioimmunoconjugates using the antibodies of the invention. In certain embodiments, the macrocyclic chelator is 1,4,7,10-tetraazacyclododecane-N,N′,N″,N′″-tetraacetic acid (DOTA) which can be attached to the antibody via a linker molecule. Such linker molecules are commonly known in the art and described in Denardo et al., (1998) Clin. Cancer Res. 4(10):2483-90; Peterson et al., (1999) Bioconjug. Chem. 10(4):553-7; and Zimmerman et al., (1999) Nucl. Med. Biol. 26(8):943-50, each incorporated by reference in their entireties.
  • The present invention further provides modified antibodies or fragments thereof that specifically bind to an antigen. The modified antibodies or fragments may be conjugated or fused to a heterologous protein or polypeptide (or fragment thereof, preferably to a polypeptide of at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids) to generate fusion proteins. In particular, the invention provides fusion proteins comprising an antibody fragment described herein (e.g., a Fab fragment, Fd fragment, Fv fragment, F(ab)2 fragment, a VH domain, a VH CDR, a VL domain or a VL CDR) and a heterologous protein, polypeptide, or peptide.
  • In some embodiments, modified antibody fragments without antigen binding specificity, such as but not limited to, modified Fc domains with engineered cysteine residue(s) according to the present invention, are used to generate fusion proteins comprising such an antibody fragment (e.g., engineered Fc) and a heterologous protein, polypeptide, or peptide.
  • Additional fusion proteins may be generated through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”). DNA shuffling may be employed to alter the activities of antibodies of the invention or fragments thereof (e.g., antibodies or fragments thereof with higher affinities and lower dissociation rates). See, generally, U.S. Pat. Nos. 5,605,793, 5,811,238, 5,830,721, 5,834,252, and 5,837,458; Patten et al., (1997) Curr. Opinion Biotechnol. 8:724-33; Harayama, (1998) Trends Biotechnol. 16(2):76-82; Hansson et al., (1999) J. Mol. Biol. 287:265-76; and Lorenzo and Blasco, (1998) Biotechniques 24(2):308-313 (each of these patents and publications are hereby incorporated by reference in its entirety). Antibodies or fragments thereof, or the encoded antibodies or fragments thereof, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination. A polynucleotide encoding an antibody or fragment thereof that specifically binds to an antigen may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.
  • Moreover, the modified antibodies or antibody fragments thereof of the present invention can be conjugated to marker sequences, such as a peptide to facilitate purification. In preferred embodiments, the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), among others, many of which are commercially available. As described in Gentz et al., (1989) Proc. Natl. Acad. Sci. USA 86:821-824, for instance, hexa-histidine provides for convenient purification of the fusion protein. Other peptide tags useful for purification include, but are not limited to, the hemagglutinin (“HA”) tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., (1984) Cell 37:767), and the “FLAG” tag (A. Einhauer et al., J. Biochem. Biophys. Methods 49: 455-465, 2001). According to the present invention, antibodies or antibody fragments can also be conjugated to tumor-penetrating peptides in order to enhance their efficacy.
  • In other embodiments, modified antibodies or antibody fragments of the present invention are conjugated to a diagnostic or detectable agent. Such immunoconjugates can be useful for monitoring or prognosing the onset, development, progression and/or severity of a disease or disorder as part of a clinical testing procedure, such as determining the efficacy of a particular therapy. Such diagnosis and detection can accomplished by coupling the antibody to detectable substances including, but not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidin/biotin and avidin/biotin; fluorescent materials, such as, but not limited to, Alexa Fluor 350, Alexa Fluor 405, Alexa Fluor 430, Alexa Fluor 488, Alexa Fluor 500, Alexa Fluor 514, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 555, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 610, Alexa Fluor 633, Alexa Fluor 647, Alexa Fluor 660, Alexa Fluor 680, Alexa Fluor 700, Alexa Fluor 750, umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminol; bioluminescent materials, such as but not limited to, luciferase, luciferin, and aequorin; radioactive materials, such as, but not limited to, iodine (131I, 125I, 123I, and 121I,), carbon (14C), sulfur (35S), tritium (3H), indium (115In, 113In, 112In, and 111In,), technetium (99Tc), thallium (201Ti), gallium (68Ga, 67Ga), palladium 103Pd), molybdenum (99Mo), xenon (133Xe), fluorine (18F), 153Sm, 177Lu, 159Gd, 149Pm, 140La, 175Yb, 166Ho, 90Y, 47Sc, 186Re, 188Re, 142Pr, 105Rn, 97Ru, 68Ge, 57Co, 65Zn, 85Sr, 32P, 153Gd, 169Yb, 51Cr, 54Mn, 75Se, 64Cu, 113Sn, and 117Sn; and positron emitting metals using various positron emission tomographies, and non-radioactive paramagnetic metal ions.
  • Modified antibodies or antibody fragments of the invention may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
  • 5. Pharmaceutical Composition
  • To prepare pharmaceutical or sterile compositions including immunoconjugates, the immunoconjugates of the invention are mixed with a pharmaceutically acceptable carrier or excipient. The compositions can additionally contain one or more other therapeutic agents that are suitable for treating or preventing cancer (breast cancer, colorectal cancer, lung cancer, multiple myeloma, ovarian cancer, liver cancer, gastric cancer, pancreatic cancer, acute myeloid leukemia, chronic myeloid leukemia, osteosarcoma, squamous cell carcinoma, peripheral nerve sheath tumors (e.g., schwannoma), head and neck cancer, bladder cancer, esophageal cancer, Barretts esophageal cancer, glioblastoma, clear cell sarcoma of soft tissue, malignant mesothelioma, neurofibromatosis, renal cancer, melanoma, prostate cancer, benign prostatic hyperplasia (BPH), gynacomastica, and endometriosis).
  • Formulations of therapeutic and diagnostic agents can be prepared by mixing with physiologically acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions, lotions, or suspensions (see, e.g., Hardman et al., Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y., 2001; Gennaro, Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y., 2000; Avis, et al. (eds.), Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY, 1993; Lieberman, et al. (eds.), Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY, 1990; Lieberman, et al. (eds.) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY, 1990; Weiner and Kotkoskie, Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y., 2000).
  • Selecting an administration regimen for a therapeutic depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the immunogenicity of the entity, and the accessibility of the target cells in the biological matrix. In certain embodiments, an administration regimen maximizes the amount of therapeutic delivered to the patient consistent with an acceptable level of side effects. Accordingly, the amount of biologic delivered depends in part on the particular entity and the severity of the condition being treated. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules is available (see, e.g., Wawrzynczak, Antibody Therapy, Bios Scientific Pub. Ltd, Oxfordshire, UK, 1996; Kresina (ed.), Monoclonal Antibodies, Cytokines and Arthritis, Marcel Dekker, New York, N.Y., 1991; Bach (ed.), Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases, Marcel Dekker, New York, N.Y., 1993; Baert et al., New Engl. J. Med. 348:601-608, 2003; Milgrom et al., New Engl. J. Med. 341:1966-1973, 1999; Slamon et al., New Engl. J. Med. 344:783-792, 2001; Beniaminovitz et al., New Engl. J. Med. 342:613-619, 2000; Ghosh et al., New Engl. J. Med. 348:24-32, 2003; Lipsky et al., New Engl. J. Med. 343:1594-1602, 2000).
  • Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects. Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
  • Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors known in the medical arts.
  • Compositions comprising antibodies or fragments thereof of the invention can be provided by continuous infusion, or by doses at intervals of, e.g., one day, one week, or 1-7 times per week. Doses may be provided intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, or by inhalation. A specific dose protocol is one involving the maximal dose or dose frequency that avoids significant undesirable side effects.
  • For the immunoconjugates of the invention, the dosage administered to a patient may be 0.0001 mg/kg to 100 mg/kg of the patient's body weight. The dosage may be between 0.0001 mg/kg and 20 mg/kg, 0.0001 mg/kg and 10 mg/kg, 0.0001 mg/kg and 5 mg/kg, 0.0001 and 2 mg/kg, 0.0001 and 1 mg/kg, 0.0001 mg/kg and 0.75 mg/kg, 0.0001 mg/kg and 0.5 mg/kg, 0.0001 mg/kg to 0.25 mg/kg, 0.0001 to 0.15 mg/kg, 0.0001 to 0.10 mg/kg, 0.001 to 0.5 mg/kg, 0.01 to 0.25 mg/kg or 0.01 to 0.10 mg/kg of the patient's body weight. The dosage of the antibodies or fragments thereof of the invention may be calculated using the patient's weight in kilograms (kg) multiplied by the dose to be administered in mg/kg.
  • Doses of the immunoconjugates the invention may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or at least 6 months. In a specific embodiment, does of the immunoconjugates of the invention are repeated every 3 weeks.
  • An effective amount for a particular patient may vary depending on factors such as the condition being treated, the overall health of the patient, the method route and dose of administration and the severity of side effects (see, e.g., Maynard et al., A Handbook of SOPs for Good Clinical Practice, Interpharm Press, Boca Raton, Fla., 1996; Dent, Good Laboratory and Good Clinical Practice, Urch Publ., London, UK, 2001).
  • The route of administration may be by, e.g., topical or cutaneous application, injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular, intraocular, intraarterial, intracerebrospinal, intralesional, or by sustained release systems or an implant (see, e.g., Sidman et al., Biopolymers 22:547-556, 1983; Langer et al., J. Biomed. Mater. Res. 15:167-277, 1981; Langer, Chem. Tech. 12:98-105, 1982; Epstein et al., Proc. Natl. Acad. Sci. USA 82:3688-3692, 1985; Hwang et al., Proc. Natl. Acad. Sci. USA 77:4030-4034, 1980; U.S. Pat. Nos. 6,350,466 and 6,316,024). Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection. In addition, pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. See, e.g., U.S. Pat. Nos. 6,019,968, 5,985,320, 5,985,309, 5,934,272, 5,874,064, 5,855,913, 5,290,540, and 4,880,078; and PCT Publication Nos. WO 92/19244, WO 97/32572, WO 97/44013, WO 98/31346, and WO 99/66903, each of which is incorporated herein by reference their entirety.
  • A composition of the present invention may also be administered via one or more routes of administration using one or more of a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Selected routes of administration for the immunoconjugates of the invention include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. Parenteral administration may represent modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion. Alternatively, a composition of the invention can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically. In one embodiment, the immunoconjugates of the invention is administered by infusion. In another embodiment, the immunoconjugates of the invention is administered subcutaneously.
  • If the immunoconjugates of the invention are administered in a controlled release or sustained release system, a pump may be used to achieve controlled or sustained release (see Langer, supra; Sefton, CRC Crit. Ref Biomed. Eng. 14:20, 1987; Buchwald et al., Surgery 88:507, 1980; Saudek et al., N. Engl. J. Med. 321:574, 1989). Polymeric materials can be used to achieve controlled or sustained release of the therapies of the invention (see e.g., Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla., 1974; Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York, 1984; Ranger and Peppas, J. Macromol. Sci. Rev. Macromol. Chem. 23:61, 1983; see also Levy et al., Science 228:190, 1985; During et al., Ann. Neurol. 25:351, 1989; Howard et al., J. Neurosurg. 7 1:105, 1989; U.S. Pat. No. 5,679,377; U.S. Pat. No. 5,916,597; U.S. Pat. No. 5,912,015; U.S. Pat. No. 5,989,463; U.S. Pat. No. 5,128,326; PCT Publication No. WO 99/15154; and PCT Publication No. WO 99/20253. Examples of polymers used in sustained release formulations include, but are not limited to, poly(-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N-vinyl pyrrolidone), poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and polyorthoesters. In one embodiment, the polymer used in a sustained release formulation is inert, free of leachable impurities, stable on storage, sterile, and biodegradable. A controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138, 1984).
  • Controlled release systems are discussed in the review by Langer, Science 249:1527-1533, 1990). Any technique known to one of skill in the art can be used to produce sustained release formulations comprising one or more immunoconjugates of the invention. See, e.g., U.S. Pat. No. 4,526,938, PCT publication WO 91/05548, PCT publication WO 96/20698, Ning et al., Radiotherapy & Oncology 39:179-189, 1996; Song et al., PDA Journal of Pharmaceutical Science & Technology 50:372-397, 1995; Cleek et al., Pro. Int'l. Symp. Control. Rel. Bioact. Mater. 24:853-854, 1997; and Lam et al., Proc. Int'l. Symp. Control Rel. Bioact. Mater. 24:759-760, 1997, each of which is incorporated herein by reference in their entirety.
  • If the immunoconjugates of the invention are administered topically, they can be formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well-known to one of skill in the art. See, e.g., Remington's Pharmaceutical Sciences and Introduction to Pharmaceutical Dosage Forms, 19th ed., Mack Pub. Co., Easton, Pa. (1995). For non-sprayable topical dosage forms, viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity, in some instances, greater than water are typically employed. Suitable formulations include, without limitation, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, and the like, which are, if desired, sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, such as, for example, osmotic pressure. Other suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient, in some instances, in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as Freon™) or in a squeeze bottle. Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms if desired. Examples of such additional ingredients are well-known in the art.
  • If the compositions comprising the immunoconjugates are administered intranasally, it can be formulated in an aerosol form, spray, mist or in the form of drops. In particular, prophylactic or therapeutic agents for use according to the present invention can be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas). In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges (composed of, e.g., gelatin) for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
  • Methods for co-administration or treatment with a second therapeutic agent, e.g., a cytokine, steroid, chemotherapeutic agent, antibiotic, or radiation, are known in the art (see, e.g., Hardman et al., (eds.) (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, 10.sup.th ed., McGraw-Hill, New York, N.Y.; Poole and Peterson (eds.) (2001) Pharmacotherapeutics for Advanced Practice: A Practical Approach, Lippincott, Williams & Wilkins, Phila., Pa.; Chabner and Longo (eds.) (2001) Cancer Chemotherapy and Biotherapy, Lippincott, Williams & Wilkins, Phila., Pa.). An effective amount of therapeutic may decrease the symptoms by at least 10%; by at least 20%; at least about 30%; at least 40%, or at least 50%.
  • Additional therapies (e.g., prophylactic or therapeutic agents), which can be administered in combination with the immunoconjugates of the invention may be administered less than 5 minutes apart, less than 30 minutes apart, 1 hour apart, at about 1 hour apart, at about 1 to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 10 hours to about 11 hours apart, at about 11 hours to about 12 hours apart, at about 12 hours to 18 hours apart, 18 hours to 24 hours apart, 24 hours to 36 hours apart, 36 hours to 48 hours apart, 48 hours to 52 hours apart, 52 hours to 60 hours apart, 60 hours to 72 hours apart, 72 hours to 84 hours apart, 84 hours to 96 hours apart, or 96 hours to 120 hours apart from the immunoconjugates of the invention. The two or more therapies may be administered within one same patient visit.
  • In certain embodiments, the immunoconjugates of the invention can be formulated to ensure proper distribution in vivo. For example, the blood-brain barrier (BBB) excludes many highly hydrophilic compounds. To ensure that the therapeutic compounds of the invention cross the BBB (if desired), they can be formulated, for example, in liposomes. For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., Ranade, (1989) J. Clin. Pharmacol. 29:685). Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun 153:1038); antibodies (Bloeman et al., (1995) FEBS Lett. 357:140; Owais et al., (1995) Antimicrob. Agents Chemother. 39:180); surfactant protein A receptor (Briscoe et al., (1995) Am. J. Physiol. 1233:134); p 120 (Schreier et al, (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Lett. 346:123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4:273.
  • The invention provides protocols for the administration of pharmaceutical composition comprising immunoconjugates of the invention alone or in combination with other therapies to a subject in need thereof. The therapies (e.g., prophylactic or therapeutic agents) of the combination therapies of the present invention can be administered concomitantly or sequentially to a subject. The therapy (e.g., prophylactic or therapeutic agents) of the combination therapies of the present invention can also be cyclically administered. Cycling therapy involves the administration of a first therapy (e.g., a first prophylactic or therapeutic agent) for a period of time, followed by the administration of a second therapy (e.g., a second prophylactic or therapeutic agent) for a period of time and repeating this sequential administration, i.e., the cycle, in order to reduce the development of resistance to one of the therapies (e.g., agents) to avoid or reduce the side effects of one of the therapies (e.g., agents), and/or to improve, the efficacy of the therapies.
  • The therapies (e.g., prophylactic or therapeutic agents) of the combination therapies of the invention can be administered to a subject concurrently.
  • The term “concurrently” is not limited to the administration of therapies (e.g., prophylactic or therapeutic agents) at exactly the same time, but rather it is meant that a pharmaceutical composition comprising antibodies or fragments thereof the invention are administered to a subject in a sequence and within a time interval such that the antibodies of the invention can act together with the other therapy or therapies to provide an increased benefit than if they were administered otherwise. For example, each therapy may be administered to a subject at the same time or sequentially in any order at different points in time; however, if not administered at the same time, they should be administered sufficiently close in time so as to provide the desired therapeutic or prophylactic effect. Each therapy can be administered to a subject separately, in any appropriate form and by any suitable route. In various embodiments, the therapies (e.g., prophylactic or therapeutic agents) are administered to a subject less than 15 minutes, less than 30 minutes, less than 1 hour apart, at about 1 hour apart, at about 1 hour to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 10 hours to about 11 hours apart, at about 11 hours to about 12 hours apart, 24 hours apart, 48 hours apart, 72 hours apart, or 1 week apart. In other embodiments, two or more therapies (e.g., prophylactic or therapeutic agents) are administered to a within the same patient visit.
  • The prophylactic or therapeutic agents of the combination therapies can be administered to a subject in the same pharmaceutical composition. Alternatively, the prophylactic or therapeutic agents of the combination therapies can be administered concurrently to a subject in separate pharmaceutical compositions. The prophylactic or therapeutic agents may be administered to a subject by the same or different routes of administration.
  • The invention having been fully described, it is further illustrated by the following examples and claims, which are illustrative and are not meant to be further limiting.
  • EXAMPLES Example 1 Selection of Surface Accessible Sites for Cys Mutation in Human IgG1 Heavy Chain and Kappa Light Chain
  • Surface exposed residues in the constant region of human IgG1 heavy and human kappa light chains were identified in a crystal structure of an hIgG1/kappa antibody (Protein Databank structure entry 1HZH.pdb, Table 6, Table 7, FIG. 1) using the computer program Surface Racer 5.0, as described by Tsodikov et al, “A novel computer program for fast exact calculation of accessible and molecular surface areas and average surface curvature,” J. Comput. Chem., 23, 600-609 (2002). 88 residues were selected for Cys substitution, 59 sites in hIgG heavy chain and 29 in human kappa light chain, based on the following criteria: 1) select residues in CH1, CH2 and CH3 domains of the constant regions of heavy chain and the constant regions of light chain; 2) select surface exposed residues but circumvent globally exposed residues and the C-terminal region to avoid inter-antibody dimer formation; 3) focus on polar or charged residues such as Ser, Thr, Lys, Arg, Glu, and Asp; and 4) exclude residues in FcRn binding domain, Protein A binding domain, and heavy chain hinge region.
  • Criterion 1) namely the selection of Cys substitution sites in the constant region of the antibody, assures transferability of the conjugation sites to many different antibodies. Criterion 2) is based on observation of inter-antibody dimer formation for Cys substitutions of prominently exposed residues (residues excluded based on this criteria are listed in Table 6). Based on the IgG crystal structure, the putative orientation of the Cys side chain was taking into consideration: residues for which the Cys side chain may be partially shielded from interactions with another antibody but may still be reactive with a small molecular payload, were favored over residues with larger surface accessibility but with an orientation that may enable interactions with a large macromolecule such as dimer formation. Criterion 3) was implemented to favor conservative mutations in order to minimize destabilizing effects of the mutations on the antibody. Similarly, criterion 4) was used to avoid functional changes to the antibody such as effects on FcRn and Protein A binding which may affect the antibody's pharmacokinetic properties or may result in the loss of a purification handle, respectively. Residues excluded based on criterion 4 are listed in Table 6. The location of the 88 selected mutation sites in the structure model of hIgG1/kappa indicates that the selected sites are surface accessible (FIG. 2).
  • TABLE 6
    Surface accessibility of amino acid residues in human IgG1 heavy chain.
    Surface accessibility was calculated using Surface Racer 5.0 and is
    expressed as Angstrom square [Å2]. “Excluded sites” indicate the
    sites that are excluded from selection due to the reasons mentioned
    in example 1. “Selected sites” are the sites that are selected for
    substitution to Cys in the invention.
    Surface Reason for
    accessibility exclusion Selected
    Eu number Residue [Å2] (if applicable) sites
    117 SER 128 HC-S117C
    118 ALA 2
    119 SER 79 HC-S119C
    120 THR 71
    121 LYS 136 HC-K121C
    122 GLY 21
    123 PRO 2
    124 SER 40 HC-S124C
    125 VAL 0
    126 PHE 1
    127 PRO 0
    128 LEU 0
    129 ALA 0
    130 PRO 0
    131 SER 0
    132 SER 34 HC-S132C
    133 LYS 87
    134 SER 123 HC-S134C
    135 THR 1
    136 SER 183 HC-S136C
    137 GLY 84
    138 GLY 40
    139 THR 33 HC-T139C
    140 ALA 0
    141 ALA 0
    142 LEU 0
    143 GLY 0
    144 CYS 0
    145 LEU 0
    146 VAL 0
    147 LYS 0
    148 ASP 1
    149 TYR 0
    150 PHE 0
    151 PRO 0
    152 GLU 52 HC-E152C
    153 PRO 89 HC-P153C
    154 VAL 10
    155 THR 69 HC-T155C
    156 VAL 0
    157 SER 39 HC-S157C
    158 TRP 0
    159 ASN 4
    160 SER 164 Dimer
    161 GLY 35 Dimer
    162 ALA 115 Dimer
    163 LEU 17
    164 THR 125 HC-T164C
    165 SER 183 HC-S165C
    166 GLY 20
    167 VAL 12
    168 HIS 5
    169 THR 60 HC-T169C
    170 PHE 0
    171 PRO 33 HC-P171C
    172 ALA 9
    173 VAL 0
    174 LEU 68 HC-L174C
    175 GLN 0
    176 SER 162 HC-S176C
    177 SER 68 HC-S177C
    178 GLY 8
    179 LEU 0
    180 TYR 6
    181 SER 0
    182 LEU 2
    183 SER 0
    184 SER 0
    185 VAL 0
    186 VAL 0
    187 THR 30
    188 VAL 0
    189 PRO 86 HC-P189C
    190 SER 21
    191 SER 127 HC-S191C
    192 SER 17
    193 LEU 0
    194 GLY 18
    195 THR 111 HC-T195C
    196 GLN 79
    197 THR 90 HC-T197C
    198 TYR 0
    199 ILE 25
    200 CYS 0
    201 ASN 8
    202 VAL 0
    203 ASN 22
    204 HIS 0
    205 LYS 217 HC-K205C
    206 PRO 66
    207 SER 50 HC-S207C
    208 ASN 91
    209 THR 24
    210 LYS 234 Dimer
    211 VAL 30
    212 ASP 97 HC-D212C
    213 LYS 70
    214 LYS 146
    215 ALA 0
    216 GLU 79
    217 PRO 0
    218 LYS 4
    219 SER 149
    220 CYS 7
    221 ASP 0 Hinge
    222 LYS 208 Hinge
    223 THR 112 Hinge
    224 HIS 1 Hinge
    225 THR 22 Hinge
    226 CYS 12 Hinge
    227 PRO 22 Hinge
    228 PRO 133 Hinge
    229 CYS 7 Hinge
    230 PRO 84 Hinge
    231 ALA 114 Hinge
    232 PRO 49 Hinge
    233 GLU 114 Hinge
    234 LEU 90
    235 LEU 88
    236 GLY 9
    237 GLY 46
    238 PRO 14
    239 SER 9
    240 VAL 0
    241 PHE 0
    242 LEU 0
    243 PHE 1
    244 PRO 34
    245 PRO 0
    246 LYS 55 HC-K246C
    247 PRO 18
    248 LYS 47
    249 ASP 1
    250 THR 0 FcRn binding
    251 LEU 0
    252 MET 53 Protein A, FcRn
    binding
    253 ILE 155 Protein A
    binding
    254 SER 157 Protein A, FcRn
    binding
    255 ARG 103
    256 THR 86 FcRn binding
    257 PRO 0 FcRn binding
    258 GLU 42 HC-E258C
    259 VAL 0 FcRn binding
    260 THR 0
    261 CYS 0
    262 VAL 0
    263 VAL 0
    264 VAL 0
    265 ASP 11 FcRn binding
    266 VAL 0
    267 SER 10
    268 HIS 79
    269 GLU 189 HC-E269C
    270 ASP 23
    271 PRO 20
    272 GLU 152
    273 VAL 19
    274 LYS 138 HC-K274C
    275 PHE 2
    276 ASN 1
    277 TRP 0
    278 TYR 14
    279 VAL 0
    280 ASP 66
    281 GLY 72
    282 VAL 141
    283 GLU 80
    284 VAL 25
    285 HIS 133
    286 ASN 119 HC-N286C
    287 ALA 67
    288 LYS 182 HC-K288C
    289 THR 5
    290 LYS 177 HC-K290C
    291 PRO 51
    292 ARG 252 HC-R292C
    293 GLU 83 HC-E293C
    294 GLU 73 HC-E294C
    295 GLN 170
    296 TYR 29
    297 ASN 61 Glycosylation
    298 SER 125 Glycosylation
    299 THR 2 Glycosylation
    300 TYR 28
    301 ARG 18
    302 VAL 0
    303 VAL 10
    304 SER 0
    305 VAL 17
    306 LEU 0
    307 THR 27 FcRn binding
    308 VAL 0 FcRn binding
    309 LEU 122
    310 HIS 4 Protein A
    binding
    311 GLN 145 Protein A, FcRn
    binding
    312 ASP 14
    313 TRP 0
    314 LEU 6 Protein A
    binding
    315 ASN 151 Protein A
    binding
    316 GLY 12
    317 LYS 81
    318 GLU 49
    319 TYR 0
    320 LYS 55 HC-K320C
    321 CYS 0
    322 LYS 78 HC-K322C
    323 VAL 0
    324 SER 0
    325 ASN 0
    326 LYS 213 HC-K326C
    327 ALA 10
    328 LEU 9
    329 PRO 158
    330 ALA 96 HC-A330C
    331 PRO 44
    332 ILE 32
    333 GLU 85 HC-E333C
    334 LYS 50 HC-K334C
    335 THR 70 HC-T335C
    336 ILE 13
    337 SER 15 HC-S337C
    338 LYS 0
    339 ALA 37
    340 LYS 217 Protein A
    binding
    341 GLY 37
    342 GLN 235
    343 PRO 42
    344 ARG 98 HC-R344C
    345 GLU 105
    346 PRO 0
    347 GLN 24
    348 VAL 3
    349 TYR 3
    350 THR 0
    351 LEU 0
    352 PRO 38
    353 PRO 0
    354 SER 0
    355 ARG 249 HC-R355C
    356 ASP 53
    357 GLU 0
    358 LEU 36
    359 THR 144 Dimer
    360 LYS 114 HC-K360C
    361 ASN 155
    362 GLN 41 HC-Q362C
    363 VAL 0
    364 SER 0
    365 LEU 0
    366 THR 0
    367 CYS 0
    368 LEU 0
    369 VAL 0
    370 LYS 1
    371 GLY 0
    372 PHE 0
    373 TYR 23
    374 PRO 0
    375 SER 29 HC-S375C
    376 ASP 9
    377 ILE 11
    378 ALA 11
    379 VAL 4
    380 GLU 18 FcRn binding
    381 TRP 0
    382 GLU 22 HC-E382C
    383 SER 1
    384 ASN 147
    385 GLY 102 Dimer
    386 GLN 161
    387 PRO 99
    388 GLU 4
    389 ASN 189 HC-N389C
    390 ASN 36 HC-N390C
    391 TYR 44
    392 LYS 82 HC-K392C
    393 THR 36 HC-T393C
    394 THR 0
    395 PRO 72
    396 PRO 47
    397 VAL 9
    398 LEU 111 HC-L398C
    399 ASP 0
    400 SER 81 HC-S400C
    401 ASP 68
    402 GLY 29
    403 SER 0
    404 PHE 22
    405 PHE 0
    406 LEU 0
    407 TYR 0
    408 SER 0
    409 LYS 0
    410 LEU 0
    411 THR 0
    412 VAL 0
    413 ASP 80 HC-D413C
    414 LYS 83
    415 SER 69 HC-S415C
    416 ARG 53
    417 TRP 0
    418 GLN 108
    419 GLN 177
    420 GLY 39
    421 ASN 35
    422 VAL 81 HC-V422C
    423 PHE 0
    424 SER 2
    425 CYS 0
    426 SER 0
    427 VAL 0
    428 MET 0 FcRn binding
    429 HIS 0
    430 GLU 14
    431 ALA 22
    432 LEU 1
    433 HIS 227 Protein A
    binding
    434 ASN 126 Protein A, FcRn
    binding
    435 HIS 28
    436 TYR 54
    437 THR 36
    438 GLN 82
    439 LYS 12
    440 SER 62
    441 LEU 2
    442 SER 34
    443 LEU 101
    444 SER 70 Dimer
  • TABLE 7
    Surface accessibility of amino acid residues in human kappa light
    chain. Surface accessibility was calculated using Surface Racer 5.0 and
    is expressed as Angstrom squared [Å2]. “Selected sites”
    indicate the sites selected for substitution to Cys in the invention.
    Surface accessibility
    EU number Residue [Å2] Selected sites
    107 LYS 90 LC-K107C
    108 ARG 49 LC-R108C
    109 THR 148 LC-T109C
    110 VAL 77
    111 ALA 16
    112 ALA 50 LC-A112C
    113 PRO 2
    114 SER 39 LC-S114C
    115 VAL 0
    116 PHE 0
    117 ILE 0
    118 PHE 0
    119 PRO 0
    120 PRO 0
    121 SER 0
    122 ASP 90 LC-D122C
    123 GLU 51 LC-E123C
    124 GLN 0
    125 LEU 21
    126 LYS 230
    127 SER 101
    128 GLY 12
    129 THR 41 LC-T129C
    130 ALA 0
    131 SER 0
    132 VAL 0
    133 VAL 0
    134 CYS 0
    135 LEU 0
    136 LEU 0
    137 ASN 5
    138 ASN 18
    139 PHE 0
    140 TYR 0
    141 PRO 3
    142 ARG 55 LC-R142C
    143 GLU 117 LC-E143C
    144 ALA 7
    145 LYS 160 LC-K145C
    146 VAL 11
    147 GLN 22
    148 TRP 0
    149 LYS 48
    150 VAL 0
    151 ASP 59
    152 ASN 157 LC-N152C
    153 ALA 51
    154 LEU 117 LC-L154C
    155 GLN 26
    156 SER 122 LC-S156C
    157 GLY 114
    158 ASN 19
    159 SER 22 LC-S159C
    160 GLN 36
    161 GLU 66 LC-E161C
    162 SER 8
    163 VAL 14
    164 THR 5
    165 GLU 74 LC-E165C
    166 GLN 8
    167 ASP 13
    168 SER 170 LC-S168C
    169 LYS 241 LC-K169C
    170 ASP 48 LC-D170C
    171 SER 1
    172 THR 0
    173 TYR 0
    174 SER 0
    175 LEU 0
    176 SER 0
    177 SER 0
    178 THR 0
    179 LEU 0
    180 THR 13
    181 LEU 21
    182 SER 59 LC-S182C
    183 LYS 131 LC-K183C
    184 ALA 32
    185 ASP 52
    186 TYR 0
    187 GLU 77
    188 LYS 201 LC-K188C
    189 HIS 42
    190 LYS 167 LC-K190C
    191 VAL 58 LC-V191C
    192 TYR 0
    193 ALA 0
    194 CYS 0
    195 GLU 12
    196 VAL 0
    197 THR 38 LC-T197C
    198 HIS 4
    199 GLN 127 LC-Q199C
    200 GLY 11
    201 LEU 17
    202 ARG 343
    203 SER 110 LC-S203C
    204 PRO 69
    205 VAL 30
    206 THR 70 LC-T206C
    207 LYS 44
    208 SER 47
    209 PHE 5
    210 ASN 44
    211 ARG 89
    212 GLY 15
    213 GLU 107
    214 CYS 58
  • Example 2 Preparation of Trastuzumab Cys Mutant Antibodies
  • DNA encoding variable regions of heavy and light chains of trastuzumab were chemically synthesized and cloned into two mammalian expression vectors, pOG-HC and pOG-LC that contain constant regions of human IgG1 and human kappa light chain, resulting in two wild-type constructs, pOG-trastuzumab HC and pOG-trastuzumab LC, respectively. In the vectors the expression of antibody heavy and light chain constructs in mammalian cells is driven by a CMV promoter. The vectors contain a synthetic 24 amino acid signal sequence: MKTFILLLWVLLLWVIFLLPGATA (SEQ ID NO: 99), in the N-terminal of heavy chain or light chain to guide their secretion from mammalian cells. The signal sequence has been validated to be efficient in directing protein secretion in hundreds of mammalian proteins in 293 Freestyle™ cells. Oligonucleotide directed mutagenesis was employed to prepare Cys mutant constructs in trastuzumab. 88 pairs of mutation primers (Table 8) were chemically synthesized that correspond to the 88 Cys mutation sites selected in the constant regions of human IgG1 heavy chain and kappa light chain as described in Example 1. The sense and anti-sense mutation primer pairs were mixed prior to PCR amplification. PCR reactions were performed by using PfuUltra II Fusion HS DNA Polymerase (Stratagene) with pOG-trastuzumab HC and pOG-trastuzumab LC as the templates. After PCR reactions, the PCR products were confirmed on agarose gels, and treated with DPN I followed by transformation in DH5a cells (Klock et al., (2009) Methods Mol Biol. 498:91-103).
  • Sequences of 88 Cys mutant constructs were confirmed by DNA sequencing. The full length amino acid sequence of wild-type trastuzumab heavy chain is shown as SEQ ID NO:1 and that of the light chain as SEQ ID NO:90. The encoded protein sequence of the constant region of 59 trastuzumab HC Cys mutant constructs (SEQ ID NO:2 through SEQ ID NO:60) and 29 trastuzumab LC Cys mutant constructs (SEQ ID NO:61 to SEQ ID NO:89) are shown in Table 9 and Table 10, respectively Amino acid residues in human IgG1 heavy chain and human kappa light chain are numbered by Eu numbering system (Edelman et al, (1969) Proc Natl Acad Sci USA, 63:78-85).
  • TABLE 8
    DNA sequences of mutation primers used to prepare 88 Cys
    mutations heavy and light chains of human IgG1.
    Mutation Primer SEQ ID
    sites name Sequence NO.
    LC-K107C LC-CYS-S1 GTGGAGATCTGTCGAACGGTGGCCGCTC 100
    CCAGCGTGTTCA
    LC-CYS-A1 ACCGTTCGACAGATCTCCACCTTGGTACC 101
    CTGTCCGAAC
    LC-R108C LC-CYS-S2 GGAGATCAAATGCACGGTGGCCGCTCCC 102
    AGCGTGTTCATCT
    LC-CYS-A2 GCCACCGTGCATTTGATCTCCACCTTGGT 103
    ACCCTGTCCGA
    LC-T109C LC-CYS-S3 GATCAAACGATGTGTGGCCGCTCCCAGC 104
    GTGTTCATCTTCC
    LC-CYS-A3 GCGGCCACACATCGTTTGATCTCCACCTT 105
    GGTACCCTGTC
    LC-A112C LC-CYS-S4 ACGGTGGCCTGTCCCAGCGTGTTCATCTT 106
    CCCCCCCAGCGA
    LC-CYS-A4 CACGCTGGGACAGGCCACCGTTCGTTTG 107
    ATCTCCACCTTG
    LC-S114C LC-CYS-S5 GCCGCTCCCTGCGTGTTCATCTTCCCCCC 108
    CAGCGACGAGCA
    LC-CYS-A5 ATGAACACGCAGGGAGCGGCCACCGTTC 109
    GTTTGATCTCCA
    LC-D122C LC-CYS-S6 CCCCCAGCTGTGAGCAGCTGAAGAGCGG 110
    CACCGCCAGCGT
    LC-CYS-A6 CAGCTGCTCACAGCTGGGGGGGAAGATG 111
    AACACGCTGGGA
    LC-E123C LC-CYS-S7 CCCAGCGACTGTCAGCTGAAGAGCGGCA 112
    CCGCCAGCGTG
    LC-CYS-A7 TTCAGCTGACAGTCGCTGGGGGGGAAGA 113
    TGAACACGCTG
    LC-T129C LC-CYS-S10 AGAGCGGCTGTGCCAGCGTGGTGTGCCT 114
    GCTGAACAACTT
    LC-CYS-A10 CACGCTGGCACAGCCGCTCTTCAGCTGCT 115
    CGTCGCTGGGG
    LC-R142C LC-CYS-S11 TCTACCCCTGTGAGGCCAAGGTGCAGTG 116
    GAAGGTGGACAA
    LC-CYS-A11 TTGGCCTCACAGGGGTAGAAGTTGTTCA 117
    GCAGGCACACCA
    LC-E143C LC-CYS-S12 TACCCCCGGTGTGCCAAGGTGCAGTGGA 118
    AGGTGGACAAC
    LC-CYS-A12 ACCTTGGCACACCGGGGGTAGAAGTTGT 119
    TCAGCAGGCACA
    LC-K145C LC-CYS-S13 CGGGAGGCCTGCGTGCAGTGGAAGGTGG 120
    ACAACGCCCTGC
    LC-CYS-A13 CACTGCACGCAGGCCTCCCGGGGGTAGA 121
    AGTTGTTCAGCA
    LC-N152C LC-CYS-S14 AAGGTGGACTGTGCCCTGCAGAGCGGCA 122
    ACAGCCAGGAGA
    LC-CYS-A14 TGCAGGGCACAGTCCACCTTCCACTGCAC 123
    CTTGGCCTCCC
    LC-L154C LC-CYS-S15 GACAACGCCTGTCAGAGCGGCAACAGCC 124
    AGGAGAGCGTCA
    LC-CYS-A15 TGCCGCTCTGACAGGCGTTGTCCACCTTC 125
    CACTGCACCTTG
    LC-S156C LC-CYS-S16 GCCCTGCAGTGTGGCAACAGCCAGGAGA 126
    GCGTCACCGAGCA
    LC-CYS-A16 GCTGTTGCCACACTGCAGGGCGTTGTCCA 127
    CCTTCCACTGCA
    LC-S159C LC-CYS-S18 AGCGGCAACTGTCAGGAGAGCGTCACCG 128
    AGCAGGACAGCAA
    LC-CYS-A18 CTCTCCTGACAGTTGCCGCTCTGCAGGGC 129
    GTTGTCCACCT
    LC-E161C LC-CYS-S19 AACAGCCAGTGCAGCGTCACCGAGCAGG 130
    ACAGCAAGGACT
    LC-CYS-A19 GTGACGCTGCACTGGCTGTTGCCGCTCTG 131
    CAGGGCGTTGT
    LC-E165C LC-CYS-S20 GAGCGTCACCTGTCAGGACAGCAAGGAC 132
    TCCACCTACAGC
    LC-CYS-A20 CTGTCCTGACAGGTGACGCTCTCCTGGCT 133
    GTTGCCGCTCT
    LC-S168C LC-CYS-S21 GAGCAGGACTGCAAGGACTCCACCTACA 134
    GCCTGAGCAGCA
    LC-CYS-A21 GAGTCCTTGCAGTCCTGCTCGGTGACGCT 135
    CTCCTGGCTGT
    LC-K169C LC-CYS-S22 CAGGACAGCTGTGACTCCACCTACAGCC 136
    TGAGCAGCACC
    LC-CYS-A22 GTGGAGTCACAGCTGTCCTGCTCGGTGAC 137
    GCTCTCCTGG
    LC-D170C LC-CYS-S23 ACAGCAAGTAGTCCACCTACAGCCTGAG 138
    CAGCACCCTGAC
    LC-CYS-A23 TAGGTGGACTACTTGCTGTCCTGCTCGGT 139
    GACGCTCTCCT
    LC-S182C LC-CYS-S24 TGACCCTGTGCAAGGCCGACTACGAGAA 140
    GCATAAGGTGTA
    LC-CYS-A24 GTCGGCCTTGCACAGGGTCAGGGTGCTG 141
    CTCAGGCTGTAG
    LC-K183C LC-CYS-S25 GACCCTGAGCTGTGCCGACTACGAGAAG 142
    CATAAGGTGTAC
    LC-CYS-A25 TAGTCGGCACAGCTCAGGGTCAGGGTGC 143
    TGCTCAGGCTGT
    LC-K188C LC-CYS-S26 GACTACGAGTGCCATAAGGTGTACGCCT 144
    GCGAGGTGAC
    LC-CYS-A26 ACCTTATGGCACTCGTAGTCGGCCTTGCT 145
    CAGGGTCAGG
    LC-K190C LC-CYS-S27 GAGAAGCATTGCGTGTACGCCTGCGAGG 146
    TGACCCACCAG
    LC-CYS-A27 GGCGTACACGCAATGCTTCTCGTAGTCGG 147
    CCTTGCTCAGG
    LC-V191C LC-CYS-S28 AGCATAAGTAGTACGCCTGCGAGGTGAC 148
    CCACCAGGGCCT
    LC-CYS-A28 CAGGCGTACTACTTATGCTTCTCGTAGTC 149
    GGCCTTGCTCA
    LC-T197C LC-CYS-S29 GCGAGGTGTGTCACCAGGGCCTGTCCAG 150
    CCCCGTGACCAA
    LC-CYS-A29 CCTGGTGACACACCTCGCAGGCGTACA 151
    CCTTATGCTTCT
    LC-Q199C LC-CYS-S30 GTGACCCACTGTGGCCTGTCCAGCCCCGT 152
    GACCAAGAGCT
    LC-CYS-A30 GACAGGCCACAGTGGGTCACCTCGCAGG 153
    CGTACACCTTAT
    LC-5203C LC-CYS-S31 GGCCTGTCCTGTCCCGTGACCAAGAGCTT 154
    CAACAGGGGCGA
    LC-CYS-A31 GTCACGGGACAGGACAGGCCCTGGTGGG 155
    TCACCTCGCAGG
    LC-T206C LC-CYS-S32 CAGCCCCGTGTGCAAGAGCTTCAACAGG 156
    GGCGAGTGCTAA
    LC-CYS-A32 AAGCTCTTGCACACGGGGCTGGACAGGC 157
    CCTGGTGGGTC
    HC-S117C HC-CYS-S1 CCGTCTCCTGCGCTAGCACCAAGGGCCC 158
    CAGCGTGTTC
    HC-CYS-A1 GGTGCTAGCGCAGGAGACGGTGACCAGG 159
    GTTCCTTGAC
    HC-S119C HC-CYS-S2 TCCTCGGCTTGTACCAAGGGCCCCAGCGT 160
    GTTCCCCCTGG
    HC-CYS-A2 CCCTTGGTACAAGCCGAGGAGACGGTGA 161
    CCAGGGTTCCTT
    HC-K121C HC-CYS-S3 CTAGCACCTGTGGCCCCAGCGTGTTCCCC 162
    CTGGCCCCCA
    HC-CYS-A3 GCTGGGGCCACAGGTGCTAGCCGAGGAG 163
    ACGGTGACCAG
    HC-S124C HC-CYS-S4 AGGGCCCCTGTGTGTTCCCCCTGGCCCCC 164
    AGCAGCAAGA
    HC-CYS-A4 GGGGAACACACAGGGGCCCTTGGTGCTA 165
    GCCGAGGAGACG
    HC-S132C HC-CYS-S5 CCCCCAGCTGCAAGAGCACCAGCGGCGG 166
    CACAGCCGCCCT
    HC-CYS-A5 GGTGCTCTTGCAGCTGGGGGCCAGGGGG 167
    AACACGCTGGGG
    HC-S134C HC-CYS-S6 AGCAGCAAGTGTACCAGCGGCGGCACAG 168
    CCGCCCTGGGCT
    HC-CYS-A6 CCGCTGGTACACTTGCTGCTGGGGGCCA 169
    GGGGGAACACG
    HC-S136C HC-CYS-S7 AGAGCACCTGTGGCGGCACAGCCGCCCT 170
    GGGCTGCCTGGT
    HC-CYS-A7 GTGCCGCCACAGGTGCTCTTGCTGCTGGG 171
    GGCCAGGGGGA
    HC-T139C HC-CYS-S8 AGCGGCGGCTGTGCCGCCCTGGGCTGCC 172
    TGGTGAAGGACT
    HC-CYS-A8 CAGGGCGGCACAGCCGCCGCTGGTGCTC 173
    TTGCTGCTGGGG
    HC-E152C HC-CYS-S9 TACTTCCCCTGTCCCGTGACCGTGTCCTG 174
    GAACAGCGGA
    HC-CYS-A9 GGTCACGGGACAGGGGAAGTAGTCCTTC 175
    ACCAGGCAGC
    HC-P153C HC-CYS-S10 TCCCCGAGTGCGTGACCGTGTCCTGGAAC 176
    AGCGGAGCCCT
    HC-CYS-A10 CACGGTCACGCACTCGGGGAAGTAGTCC 177
    TTCACCAGGCAG
    HC-T155C HC-CYS-S11 GAGCCCGTGTGCGTGTCCTGGAACAGCG 178
    GAGCCCTGACCT
    HC-CYS-A11 CAGGACACGCACACGGGCTCGGGGAAGT 179
    AGTCCTTCACCA
    HC-S157C HC-CYS-S12 TGACCGTGTGCTGGAACAGCGGAGCCCT 180
    GACCTCCGGCGT
    HC-CYS-A12 CTGTTCCAGCACACGGTCACGGGCTCGG 181
    GGAAGTAGTCCT
    HC-T164C HC-CYS-S13 GGAGCCCTGTGCTCCGGCGTGCACACCTT 182
    CCCCGCCGTGCT
    HC-CYS-A13 ACGCCGGAGCACAGGGCTCCGCTGTTCC 183
    AGGACACGGTCA
    HC-S165C HC-CYS-S14 CCCTGACCTGTGGCGTGCACACCTTCCCC 184
    GCCGTGCTGCA
    HC-CYS-A14 TGTGCACGCCACAGGTCAGGGCTCCGCT 185
    GTTCCAGGACAC
    HC-T169C HC-CYS-S15 GCGTGCACTGCTTCCCCGCCGTGCTGCAG 186
    AGCAGCGGCCT
    HC-CYS-A15 GGCGGGGAAGCAGTGCACGCCGGAGGTC 187
    AGGGCTCCGCTG
    HC-P171C HC-CYS-S16 CACACCTTCTGTGCCGTGCTGCAGAGCAG 188
    CGGCCTGTACA
    HC-CYS-A16 CAGCACGGCACAGAAGGTGTGCACGCCG 189
    GAGGTCAGGGCT
    HC-L174C HC-CYS-S17 CCGCCGTGTGTCAGAGCAGCGGCCTGTA 190
    CAGCCTGTCCA
    HC-CYS-A17 GCTGCTCTGACACACGGCGGGGAAGGTG 191
    TGCACGCCGGAG
    HC-S176C HC-CYS-S18 TGCTGCAGTGCAGCGGCCTGTACAGCCT 192
    GTCCAGCGTGGT
    HC-CYS-A18 ACAGGCCGCTGCACTGCAGCACGGCGGG 193
    GAAGGTGTGCACG
    HC-S177C HC-CYS-S19 CTGCAGAGCTGTGGCCTGTACAGCCTGTC 194
    CAGCGTGGTGA
    HC-CYS-A19 TACAGGCCACAGCTCTGCAGCACGGCGG 195
    GGAAGGTGTGCA
    HC-P189C HC-CYS-S21 TGACAGTGTGCAGCAGCAGCCTGGGCAC 196
    CCAGACCTACAT
    HC-CYS-A21 CTGCTGCTGCACACTGTCACCACGCTGGA 197
    CAGGCTGTACA
    HC-S191C HC-CYS-S22 TGCCCAGCTGCAGCCTGGGCACCCAGAC 198
    CTACATCTGCAA
    HC-CYS-A22 CCCAGGCTGCAGCTGGGCACTGTCACCA 199
    CGCTGGACAGGCT
    HC-T195C HC-CYS-S23 GCCTGGGCTGTCAGACCTACATCTGCAAC 200
    GTGAACCACAA
    HC-CYS-A23 GTAGGTCTGACAGCCCAGGCTGCTGCTG 201
    GGCACTGTCACCA
    HC-T197C HC-CYS-S24 GCACCCAGTGCTACATCTGCAACGTGAA 202
    CCACAAGCCCA
    HC-CYS-A24 GCAGATGTAGCACTGGGTGCCCAGGCTG 203
    CTGCTGGGCACT
    HC-K205C HC-CYS-S25 TGAACCACTGTCCCAGCAACACCAAGGT 204
    GGACAAGAGAGT
    HC-CYS-A25 TGTTGCTGGGACAGTGGTTCACGTTGCAG 205
    ATGTAGGTCTGG
    HC-5207C HC-CYS-S26 ACAAGCCCTGCAACACCAAGGTGGACAA 206
    GAGAGTGGAGC
    HC-CYS-A26 CTTGGTGTTGCAGGGCTTGTGGTTCACGT 207
    TGCAGATGTAG
    HC-D212C HC-CYS-S27 ACCAAGGTGTGCAAGAGAGTGGAGCCCA 208
    AGAGCTGCGACA
    HC-CYS-A27 CACTCTCTTGCACACCTTGGTGTTGCTGG 209
    GCTTGTGGTTCA
    HC-K246C HC-CYS-S28 TCCCCCCCTGTCCCAAGGACACCCTGATG 210
    ATCAGCAGGA
    HC-CYS-A28 GTCCTTGGGACAGGGGGGGAACAGGAAC 211
    ACGGAGGGTCCG
    HC-E258C HC-CYS-S29 AGGACCCCCTGCGTGACCTGCGTGGTGG 212
    TGGACGTGAG
    HC-CYS-A29 CAGGTCACGCAGGGGGTCCTGCTGATCA 213
    TCAGGGTGTCCT
    HC-E269C HC-CYS-S30 TGAGCCACTGTGACCCAGAGGTGAAGTT 214
    CAACTGGTACG
    HC-CYS-A30 CTCTGGGTCACAGTGGCTCACGTCCACCA 215
    CCACGCAGGTC
    HC-K274C HC-CYS-S32 CCAGAGGTGTGCTTCAACTGGTACGTGG 216
    ACGGCGTGGAGG
    HC-CYS-A32 CCAGTTGAAGCACACCTCTGGGTCCTCGT 217
    GGCTCACGTCCA
    HC-N286C HC-CYS-S35 GAGGTGCACTGTGCCAAGACCAAGCCCA 218
    GAGAGGAGCAGT
    HC-CYS-A35 GGTCTTGGCACAGTGCACCTCCACGCCGT 219
    CCACGTACCAGT
    HC-K288C HC-CYS-S36 CACAACGCCTGTACCAAGCCCAGAGAGG 220
    AGCAGTACAACA
    HC-CYS-A36 GGCTTGGTACAGGCGTTGTGCACCTCCAC 221
    GCCGTCCACGT
    HC-K290C HC-CYS-S37 GCCAAGACCTGTCCCAGAGAGGAGCAGT 222
    ACAACAGCACCT
    HC-CYS-A37 CTCTCTGGGACAGGTCTTGGCGTTGTGCA 223
    CCTCCACGCCGT
    HC-R292C HC-CYS-S38 ACCAAGCCCTGTGAGGAGCAGTACAACA 224
    GCACCTACAGGGT
    HC-CYS-A38 CTGCTCCTCACAGGGCTTGGTCTTGGCGT 225
    TGTGCACCTCCA
    HC-E293C HC-CYS-S39 CAAGCCCAGATGCGAGCAGTACAACAGC 226
    ACCTACAGGGTG
    HC-CYS-A39  GTACTGCTCGCATCTGGGCTTGGTCTTGG 227
    CGTTGTGCACCT
    HC-E294C HC-CYS-S40 GCCCAGAGAGTGTCAGTACAACAGCACC 228
    TACAGGGTGGT
    HC-CYS-A40 TTGTACTGACACTCTCTGGGCTTGGTCTT 229
    GGCGTTGTGCA
    HC-K320C HC-CYS-S41 CAAGGAATACTGCTGCAAGGTCTCCAAC 230
    AAGGCCCTGCCA
    HC-CYS-A41 GACCTTGCAGCAGTATTCCTTGCCGTTCA 231
    GCCAGTCCTGGT
    HC-K322C HC-CYS-S42 TACAAGTGCTGCGTCTCCAACAAGGCCCT 232
    GCCAGCCCCCA
    HC-CYS-A42 GTTGGAGACGCAGCACTTGTATTCCTTGC 233
    CGTTCAGCCAGT
    HC-K326C HC-CYS-S43 GGTCTCCAACTGTGCCCTGCCAGCCCCCA 234
    TCGAAAAGACC
    HC-CYS-A43 GGCAGGGCACAGTTGGAGACCTTGCACT 235
    TGTATTCCTTGC
    HC-A330C HC-CYS-S44 GCCCTGCCATGTCCCATCGAAAAGACCA 236
    TCAGCAAGGCCA
    HC-CYS-A44 TTCGATGGGACATGGCAGGGCCTTGTTG 237
    GAGACCTTGCACT
    HC-E333C HC-CYS-S45 GCCCCCATCTGCAAGACCATCAGCAAGG 238
    CCAAGGGCCAGC
    HC-CYS-A45 GATGGTCTTGCAGATGGGGGCTGGCAGG 239
    GCCTTGTTGGAGA
    HC-K334C HC-CYS-S46 CCCATCGAATGCACCATCAGCAAGGCCA 240
    AGGGCCAGCCA
    HC-CYS-A46 GCTGATGGTGCATTCGATGGGGGCTGGC 241
    AGGGCCTTGTTG
    HC-T335C HC-CYS-S47 TCGAAAAGTGCATCAGCAAGGCCAAGGG 242
    CCAGCCACGGGA
    HC-CYS-A47 CTTGCTGATGCACTTTTCGATGGGGGCTG 243
    GCAGGGCCTTGT
    HC-S337C HC-CYS-S48 AGACCATCTGCAAGGCCAAGGGCCAGCC 244
    ACGGGAGCCCCA
    HC-CYS-A48 CCTTGGCCTTGCAGATGGTCTTTTCGATG 245
    GGGGCTGGCAGG
    HC-R344C HC-CYS-S50 GGCCAGCCATGCGAGCCCCAGGTGTACA 246
    CCCTGCCTCCAT
    HC-CYS-A50 CTGGGGCTCGCATGGCTGGCCCTTGGCCT 247
    TGCTGATGGTCT
    HC-R355C HC-CYS-S51 CTCCATCCTGCGACGAGCTGACCAAGAA 248
    CCAGGTGTCCCT
    HC-CYS-A51 CAGCTCGTCGCAGGATGGAGGCAGGGTG 249
    TACACCTGGGGCT
    HC-K360C HC-CYS-S52 AGCTGACCTGCAACCAGGTGTCCCTGAC 250
    CTGTCTGGTGA
    HC-CYS-A52 CACCTGGTTGCAGGTCAGCTCGTCCCGGG 251
    ATGGAGGCAGG
    HC-Q362C HC-CYS-S53 CCAAGAACTGCGTGTCCCTGACCTGTCTG 252
    GTGAAGGGCTT
    HC-CYS-A53 TCAGGGACACGCAGTTCTTGGTCAGCTCG 253
    TCCCGGGATGGA
    HC-S375C HC-CYS-S54 TTCTACCCCTGCGACATCGCCGTGGAGTG 254
    GGAGAGCAACG
    HC-CYS-A54 GGCGATGTCGCAGGGGTAGAAGCCCTTC 255
    ACCAGACAGGTCA
    HC-E382C HC-CYS-S55 TGGAGTGGTGCAGCAACGGCCAGCCCGA 256
    GAACAACTACA
    HC-CYS-A55 GGCCGTTGCTGCACCACTCCACGGCGAT 257
    GTCGCTGGGGTAG
    HC-N389C HC-CYS-S56 AGCCCGAGTGCAACTACAAGACCACCCC 258
    CCCAGTGCTGGA
    HC-CYS-A56 CTTGTAGTTGCACTCGGGCTGGCCGTTGC 259
    TCTCCCACTCCA
    HC-N390C HC-CYS-S57 CCCGAGAACTGCTACAAGACCACCCCCC 260
    CAGTGCTGGACA
    HC-CYS-A57 GGTCTTGTAGCAGTTCTCGGGCTGGCCGT 261
    TGCTCTCCCACT
    HC-K392C HC-CYS-S58 GAACAACTACTGCACCACCCCCCCAGTG 262
    CTGGACAGCGAC
    HC-CYS-A58 GGGGTGGTGCAGTAGTTGTTCTCGGGCTG 263
    GCCGTTGCTCT
    HC-T393C HC-CYS-S59 AACTACAAGTGTACCCCCCCAGTGCTGG 264
    ACAGCGACGGCA
    HC-CYS-A59 TGGGGGGGTACACTTGTAGTTGTTCTCGG 265
    GCTGGCCGTTG
    HC-L398C HC-CYS-S60 CCCCAGTGTGTGACAGCGACGGCAGCTT 266
    CTTCCTGTACA
    HC-CYS-A60 GTCGCTGTCACACACTGGGGGGGTGGTC 267
    TTGTAGTTGTTCT
    HC-S400C HC-CYS-S61 TGCTGGACTGCGACGGCAGCTTCTTCCTG 268
    TACAGCAAGCT
    HC-CYS-A61 GCTGCCGTCGCAGTCCAGCACTGGGGGG 269
    GTGGTCTTGTAGT
    HC-D413C HC-CYS-S62 TGACCGTGTGCAAGTCCAGGTGGCAGCA 270
    GGGCAACGTGTT
    HC-CYS-A62 ACCTGGACTTGCACACGGTCAGCTTGCTG 271
    TACAGGAAGAAG
    HC-S415C HC-CYS-S63 TGGACAAGTGCAGGTGGCAGCAGGGCAA 272
    CGTGTTCAGCT
    HC-CYS-A63 CTGCCACCTGCACTTGTCCACGGTCAGCT 273
    TGCTGTACAGG
    HC-V422C HC-CYS-S64 AGGGCAACTGCTTCAGCTGCAGCGTGAT 274
    GCACGAGGCCCT
    HC-CYS-A64 GCAGCTGAAGCAGTTGCCCTGCTGCCAC 275
    CTGGACTTGTCCA
  • TABLE 9
    Amino acid sequences of the constant region of
    Cys mutant constructs in human IgG1 heavy chain.
    SEQ ID NO: 1 is the sequence for full-length
    trastuzumab (human IgG1). SEQ ID NO: 2 to
    SEQ ID NO: 60 indicate the sequence ID numbers
    for 59 Cys mutant constructs in human IgG1
    heavy chain, showing only the sequences of the
    constant region.
    SEQ ID NO: 1
    EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVAR
    IYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWG
    GDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
    DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
    YICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP
    KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
    STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
    VYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV
    LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 2
    CASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 3
    SACTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 4
    SASTCGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 5
    SASTKGPCVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 6
    SASTKGPSVFPLAPSCKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 7
    SASTKGPSVFPLAPSSKCTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 8
    SASTKGPSVFPLAPSSKSTCGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 9
    SASTKGPSVFPLAPSSKSTSGGCAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 10
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 11
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPECVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 12
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVCVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 13
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVCWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 14
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALCSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 15
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTCG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 16
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHCFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 17
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFCAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 18
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVCQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 19
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQCSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 20
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSCGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 21
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVCSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 22
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSCSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 23
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGCQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 24
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQCYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 25
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHCPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 26
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPCNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 27
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVCKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 28
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPCPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 29
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPCVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 30
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHCDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 31
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVCFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 32
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHCAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 33
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNACTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 34
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTCPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 35
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPCEEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 36
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPRCEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 37
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPRECQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 38
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYCCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 39
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCCVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 40
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNCALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 41
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPCPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 42
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPICKTSKAKGQPREPQVYTLPPSREEMTKNQVSLTC
    LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
    QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 43
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIECTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 44
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKCISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 45
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTICKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 46
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPCEPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 47
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSCEEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 48
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTCNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 49
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNCVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 50
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 51
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWCSNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 52
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPECNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 53
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENCYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 54
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYCTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 55
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKCTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 56
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVCDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 57
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDCDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 58
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVCKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 59
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKCR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 60
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNCFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO 290:
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIECTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 291
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIECTISKAKGQPREPQVYTLPPSREEMTKNQVSLT
    CLVKGFYPSDIAVEWESNGQPENNYCTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 292
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
    VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
    PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
    SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG
    KEYKCKVSNKALPAPIECTISKAKGQPREPQVYTLPPSREEMTCNQVSLT
    CLVKGFYPCDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
    WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    SEQ ID NO: 293
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
    LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
    TKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS
    RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
    TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIECTISKAKGQP
    REPQVYTLPPSREEMTCNQVSLTCLVKGFYPSDIAVEWESNGQPE
    NNYCTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
    HNHYTQKSLSLSPGK
    SEQ ID NO: 294
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
    LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSN
    TKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS
    RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
    TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIECTISKAKGQP
    REPQVYTLPPSREEMTKNQVSLTCLVKGFYPCDIAVEWESNGQPE
    NNYCTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
    HNHYTQKSLSLSPGK
    SEQ ID NO: 295
    SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPCPVTVSWNSG
    ALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPS
    NTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI
    SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
    STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ
    PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPCDIAVEWESNGQP
    ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA
    LHNHYTQKSLSLSPGK
  • TABLE 10
    Amino acid sequences of the constant region of 29 
    human kappa light chain Cys mutant constructs. 
    SEQ ID NO: 61 is the sequence of the constant 
    region of wild-type human kappa light chain. 
    SEQ ID NO: 62 to SEQ ID NO: 90 indicate the 
    sequence ID numbers for 29 Cys mutant constructs
    in the constant region of human kappa light 
    chain.
    SEQ ID NO: 61
    CRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 62
    KCTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 63
    KRCVAAPSVFIPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
    GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV
    TKSFNRGEC
    SEQ ID NO: 64
    KRTVACPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 65
    KRTVAACVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
    GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV
    TKSFNRGEC
    SEQ ID NO: 66
    KRTVAAPSVFIFPPSCEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 67
    KRTVAAPSVFIFPPSDCQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 68
    KRTVAAPSVFIFPPSDEQLKSGCASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 69
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPCEAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 70
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRCAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 71
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREACVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 72
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDCALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 73
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNACQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 74
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    CGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 75
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNCQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 76
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQCSVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 77
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTCQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 78
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDCKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 79
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSCDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 80
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKCSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 81
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLCKADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 82
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSCADYEKHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 83
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYECHKVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 84
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHCVYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 85
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKCYACEVTHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 86
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVCHQGLSSP
    VTKSFNRGEC
    SEQ ID NO: 87
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHCGLSSP
    VTKSFNRGEC
    SEQ ID NO: 88
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSCP
    VTKSFNRGEC
    SEQ ID NO: 89
    KRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ
    SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
    VCKSFNRGEC
    SEQ ID NO: 90
    DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIY
    SASFLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTF
    GQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ
    WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV
    THQGLSSPVTKSFNRGEC
  • Example 3 Transfer of the Trastuzumab Heavy Chain and Light Chain Cys Mutations to Different Antibodies
  • For trastuzumab, all Cys mutations for the attachment of drug payloads were chosen to be in the constant region of its human IgG1 heavy and human kappa light chain. Because constant regions of antibodies are highly conserved in primary sequence and structure, Cys mutant residues that are identified as good payload attachment sites in the context of trastuzumab will also serve as preferred attachment residues in other antibodies. To demonstrate the transferability of these generic conjugation sites to other antibodies, we cloned a set of Cys mutations into antibody 14090. Antibody 14090 is an antibody with a human IgG1 heavy chain and a human lambda light chain that binds to a different target protein than trastuzumab. The DNA encoding variable region of antibody 14090 was cloned into seven selected pOG trastuzumab HC Cys mutant plasmid constructs (SEQ ID NO listed in Table 11) to replace the variable regions of trastuzumab constructs in the plasmids as described in Example 2. As result, the amino acid sequences of the heavy chain constant regions in corresponding seven Cys constructs of antibody 14090 and trastuzumab are identical (FIG. 3). Subsequent examples show that these sites can be conjugated readily. Conversely, due to a high degree of similarity in primary sequences and in tertiary structures for different human IgG isotypes (FIG. 4), Cys mutations on the kappa light chain of trastuzumab can readily be transferred to equivalent light chains on human antibodies containing different isotype heavy chains. In the same way, the sites identified in the constant region of IgG1 may be transferred to IgG2, IgG3 and IgG4.
  • Example 4 Cysteine Mutations in Human Lambda Light Chains
  • Human lambda and kappa light chains have little amino acid sequence similarity (FIG. 5A). Mutations in the lambda light chain of antibody 14090 were selected based on the approximate similarity of the locations of the residues in a protein crystal structure model (Protein Databank structure entry 3G6D.pdb) of a Fab containing the human lambda light chain in reference to the desirable residues in the kappa light chain of trastuzumab (FIGS. 5 A and B). Seven additional Cys mutant constructs were generated in antibody 14090-lambda light chain plasmid using oligonucleotide directed mutagenesis (Higuchi et al. 1988) in combination with PIPE cloning strategy (Klock and Lesley, 2009). The mutation primers used to generate Cys point mutations in the lambda light chain are listed in Table 12. The secretion of antibody 14090 is also directed by the synthetic 24 amino acid signal sequence: MKTFILLLWVLLLWVIFLLPGATA (SEQ ID NO: 99). Sequences of antibody 14090 Cys constructs were confirmed by DNA sequencing. The sequence for the constant region of human wild-type lambda light chain is shown as SEQ ID NO:91. The encoded protein sequences of seven Cys mutant constructs in the light chain (SEQ ID NO:92 to SEQ ID NO:98) are shown in Table 13. Subsequent examples will show that these Cys mutants are efficiently conjugated with an ADC payload. Because all of these mutants are in the constant region of the human lambda light chain, these conjugation sites can readily be transferred to other antibodies with lambda light chains.
  • TABLE 11
    Sequence ID numbers of trastuzumab heavy chain Cys constructs
    used for cloning of the variable region of antibody 14090.
    Sequence ID NO: of trastuzumab HC Cys construct
    SEQ ID NO: 5 
    SEQ ID NO: 8 
    SEQ ID NO: 9 
    SEQ ID NO: 10
    SEQ ID NO: 18
    SEQ ID NO: 48
    SEQ ID NO: 50
  • TABLE 12
    Nucleotide sequences of primers used in
    mutagenesis of seven Cys mutant constructs in
    lambda light chain of human IgG1.
    SEQ
    Mutation Primer ID
    sites name Sequence NO.
    LC-A143C Seq-0017 CCGGGATGCGTGACAGTGGCCTGG 276
    AAGGCAGATAGC
    Seq-0018 TGTCACGCATCCCGGGTAGAAGTCA 277
    CTTATGAGACA
    LC-T145C Seq-0019 GCCGTGTGTGTGGCCTGGAAGGCA 278
    GATAGCAGCCCC
    Seq-0020 GGCCACACACACGGCTCCCGGGTA 279
    GAAGTCACTTAT
    LC-A147C Seq-0021 ACAGTGTGTTGGAAGGCAGATAGC 280
    AGCCCCGTCAAG
    Seq-0022 CTTCCAACACACTGTCACGGCTCCC 281
    GGGTAGAAGTC
    LC-K156C Seq-0023 CCCGTCTGTGCGGGAGTGGAGACC 282
    ACCACACCCTCC
    Seq-0024 TCCCGCACAGACGGGGCTGCTATCT 283
    GCCTTCCAGGC
    LC-V159C Seq-0025 GCGGGATGTGAGACCACCACACCC 284
    TCCAAACAAAGC
    Seq-0026 GGTCTCACATCCCGCCTTGACGGGG 285
    CTGCTATCTGC
    LC-T163C Seq-0027 ACCACCTGTCCCTCCAAACAAAGCA 286
    ACAACAAGTAC
    Seq-0028 GGAGGGACAGGTGGTCTCCACTCC 287
    CGCCTTGACGGG
    LC-S168C Seq-0029 AAACAATGCAACAACAAGTACGCG 288
    GCCAGCAGCTAT
    Seq-0030 GTTGTTGCATTGTTTGGAGGGTGTG 289
    GTGGTCTCCAC
  • TABLE 13
    Amino acid sequence of the constant region of Cys 
    mutant constructs in antibody 14090 lambda light 
    chain. SEQ ID NO: 91 is the sequence for the 
    constant region of wild-type human lambda light 
    chain. SEQ ID NO: 91 to SEQ ID NO: 98 indicate 
    the sequences of the 7 Cys mutants in the constant 
    region of human lambda light chain of antibody
    14090.
    SEQ ID NO: 91
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAG
    VETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 92
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGCVTVAWKADSSPVKAG
    VETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 93
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVCVAWKADSSPVKAG
    VETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 94
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVCWKADSSPVKAG
    VETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 95
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVCAG
    VETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 96
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAG
    CETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 97
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAG
    VETTCPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
    SEQ ID NO: 98
    QPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAG
    VETTTPSKQCNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
    ECS
  • Example 5 Expression and Purification of Cys Mutant Antibodies in 293 Freestyle™ Cells
  • Cys mutants of the trastuzumab antibody were expressed in 293 Freestyle™ cells by co-transfecting heavy chain and light chain plasmids using transient transfection method as described previously (Meissner, et al., Biotechnol Bioeng. 75:197-203 (2001)). The DNA plasmids used in co-transfection were prepared using Qiagen plasmid preparation kit according to manufacturer's protocol. 293 Freestyle™ cells were cultured in suspension in Freestyle™ expression media (Invitrogen) at 37° C. under 5% CO2. On the day before transfection, cells were split to 0.7×106 cells/ml into fresh media. On the day of transfection, the cell density typically reached 1.5×106 cells/ml. The cells were transfected with a mixture of heavy chain and light chain plasmids at the ratio of 1:1 using PEI method (Meissner et al., 2001). The transfected cells were further cultured for five days. The media from the culture was harvested by centrifugation of the culture at 2000×g for 20 min and filtered through 0.2 micrometer filters. The expressed antibodies were purified from the filtered media using Protein A-Sepharose™ (GE Healthcare Life Sciences). Antibody IgGs were eluted from the Protein A-Sepharose™ column by the elution buffer (pH 3.0) and immediately neutralized with 1 M Tris-HCl (pH 8.0) followed by a buffer exchange to PBS.
  • Expression levels of 88 Cys trastuzumab mutant antibodies in transiently transfected 293 Freestyle™ are similar to that of wild-type trastuzumab, with an average yield at 18.6 mg/L+/−9.5 mg/L (Table 14), suggesting that single point mutations in the selected sites did not significantly alter retention of the expressed antibody by the cells' secretion machinery. Analysis of the purified trastuzumab Cys mutant antibodies using non-reducing SDS PAGE indicates that the Cys mutant antibodies did not form oligomers disulfide-linked by the engineered cysteines (FIG. 6). Size exclusion chromatography (FIG. 7) further supported the conclusion that all Cys mutant trastuzumab antibodies are monomeric. HPLC reverse phase analysis of the mutant antibodies also suggests that majority of the Cys mutant antibodies are indistinguishable from wild-type trastuzumab in terms of retention time and homogeneity (FIG. 8). Analysis of non-reduced deglycosylated full length trastuzumab LC-R108C by mass spectrometry (intact LC-MS) revealed that the majority of the antibody was modified by two cysteines (FIG. 9 and Table 15). These observations are consistent with a previous publication indicating that the thiol group of the engineered cysteine in the trastuzumab Cys mutant antibodies is modified by cysteine when expressed in 293 Freestyle™ cells, and that the modification needs to be removed by reducing reagents before conjugation with any thiol reactive reagents (Chen, et al., mAbs 1:6, 563-571, 2009).
  • The Cys mutants of antibody 14090 were also expressed in 293 Freestyle™ cells by co-transfecting HC and LC plasmids using PEI method as described (Meissner et al., 2001). The expression levels of the Cys mutants of antibody 14090 are similar to that of wild-type antibody 14090 (Table 16).
  • TABLE 14
    Yield of trastuzumab Cys mutant antibodies transiently expressed in
    293 Freestyle ™ cells. Yields were measured by UV absorbance at
    280 nm after Protein A purification.
    trastuzumab Purified trastuzumab Purified
    Cys mutant Ab (mg/L) Cys Mutant Ab (mg/L)
    HC-S117C 46.9 HC-R355C 30.1
    HC-S119C 22.5 HC-K360C 32.0
    HC-K121C 22.1 HC-Q362C 20.7
    HC-S124C 17.8 HC-S375C 33.3
    HC-S132C 30.9 HC-E382C 35.3
    HC-S134C 18.6 HC-N389C 28.7
    HC-S136C 21.2 HC-N390C 34.5
    HC-T139C 25.9 HC-K392C 28.2
    HC-E152C 13.0 HC-T393C 6.6
    HC-P153C 10.8 HC-L398C 5.1
    HC-T155C 18.4 HC-S400C 4.1
    HC-S157C 16.9 HC-D413C 27.6
    HC-T164C 20.2 HC-S415C 10.6
    HC-S165C 20.6 HC-V422C 5.0
    HC-T169C 8.2 LC-K107C 11.0
    HC-P171C 24.6 LC-R108C 27.0
    HC-L174C 15.2 LC-T109C 13.1
    HC-S176C 13.4 LC-A112C 10.5
    HC-S177C 30.0 LC-S114C 21.2
    HC-P189C 11.7 LC-D122C 25.5
    HC-K205C 13.3 LC-E123C 20.1
    HC-S207C 2.5 LC-T129C 7.1
    HC-D212C 26.5 LC-R142C 14.6
    HC-K246C 12.0 LC-E143C 10.0
    HC-E258C 18.7 LC-K145C 13.0
    HC-E269C 6.3 LC-N152C 12.0
    HC-K273C 20.7 LC-L154C 13.1
    HC-N286C 15.0 LC-S156C 12.0
    HC-K288C 20.9 LC-S159C 26.6
    HC-K290C 20.0 LC-E161C 20.0
    HC-R292C 21.0 LC-E165C 5.0
    HC-E293C 31.2 LC-S168C 12.0
    HC-E294C 37.5 LC-K169C 4.0
    HC-K320C 23.6 LC-D170C 5.0
    HC-K322C 35.1 LC-S182C 8.8
    HC-K326C 28.0 LC-K183C 12.6
    HC-A330C 27.1 LC-K188C 12.0
    HC-E333C 10.3 LC-K190C 5.2
    HC-K334C 14.0 LC-V191C 29.9
    HC-T335C 7.0 LC-T197C 19.0
    HC-S337C 6.9 LC-Q199C 16.8
    HC-R344C 32.6 LC-S203C 26.2
    LC-T206C 27.8
  • TABLE 15
    Theoretical and observed mass for trastuzumab LC-R108C antibody
    after purification from 293 Freestyle ™ cells.
    Theoretical Observed
    Antibody species mass (Da) mass (Da)
    LC-R108C 145063 145071
    LC-R108C-Cys adduct +1 Cys 145181 145189
    LC-R108C-Cys double adduct + 2 Cys 145299 145311
  • TABLE 16
    Yield of antibody 14090 Cys mutants transiently expressed in
    293 Freestyle ™ cells.
    Antibody 14090 Cys mutant Ab yield (mg/L)
    HC-S124C 4.72
    HC-S136C 3.64
    HC-T139C 4.59
    HC-E152C 2.93
    HC-L174C 5.26
    HC-E258C 5.86
    HC-K360C 4.86
    LC-A143C 4.63
    LC-T145C 6.98
    LC-A147C 8.37
    LC-K156C 5.74
    LC-V159C 9.67
    LC-T163C 9.98
    LC-S168C 5.61
  • Example 6 Reduction, Re-Oxidation and Conjugation of Cys Mutant Antibodies with MC-MMAF
  • Because engineered Cys in antibodies expressed in mammalian cells are modified by adducts (disulfides) such as glutathione (GSH) and/or Cysteine during their biosynthesis (Chen et al. 2009), the modified Cys in the product as initially expressed is unreactive to thiol reactive reagents such as maleimido or bromo- or iodo-acetamide groups. To conjugate the engineered cysteine after expression, the glutathione or cysteine adducts need to be removed by reducing these disulfides, which generally entails reducing all of the disulfides in the expressed protein. This can be accomplished by first exposing the antibody to a reducing agent such as dithiothreitol (DTT) followed by a procedure that allows for the re-oxidation of all native disulfide bonds of the antibody to restore and/or stabilize the functional antibody structure. Accordingly, in order to reduce all native disulfide bonds and the disulfide bound between the cysteine or GSH adducts of the engineered cysteine residue, freshly prepared DTT was added to previously purified Cys mutants of trastuzumab and antibody 14090, to a final concentration of 20 mM. After the antibody incubation with DTT at 37° C. for 1 hour, the mixtures were dialyzed at 4° C. against PBS for three days with daily buffer exchange to remove DTT and re-oxidize the native disulfide bonds. An alternative method is to remove the reducing reagents through a desalting column, Sephadex G-25. Once the protein is fully reduced, 1 mM oxidized ascorbate (dehydro-ascorbic acid) is added to the desalted samples and the re-oxidation incubations are carried out for 20 hours. Both methods have produced similar results. However, attempts to follow the re-oxidation protocols previously described in the literature using CuSO4 resulted in protein precipitation. All examples herein use the dialysis protocol described above. Reoxidation restores intra-chain disulfides, while dialysis allows cysteines and glutathiones connected to the newly-introduced cysteine(s) to dialyze away.
  • After re-oxidation, the antibodies are ready for conjugation. Maleimide-MMAF (MC-MMAF, 10 equivalents relative to the antibody, FIG. 10) was added to re-oxidized antibodies in PBS buffer (pH7.2). The incubations were carried out from 1 hour to 24 hours. The conjugation process was monitored by reverse-phase HPLC, which is able to separate conjugated antibodies from non-conjugated ones. The conjugation reaction mixtures were analyzed on a PRLP-S 4000A column (50 mm×2.1 mm, Agilent) heated to 80° C. and elution of the column was carried out by a linear gradient of 30-60% acetonitrile in water containing 0.1% TFA at a flow rate of 1.5 ml/min. The elution of proteins from the column was monitored at 280 nm, 254 nm and 215 nm. The reverse-phase HPLC trace of a typical conjugation mixture is shown in FIG. 11.
  • When the conjugation mixtures were analyzed by reverse-phase HPLC, many Cys sites generated homogenous conjugation products, as suggested by uniform, single peak elution profiles (FIG. 11), while some Cys sites generated heterogeneous conjugation products (FIG. 12). The procedures described above involve reduction and re-oxidation of native disulfide bonds as well as the reduction of bonds between the cysteine and GSH adducts of the engineered cysteine residues. During the re-oxidation process, the engineered cysteine residue may interfere with reforming of the proper native disulfide bonds through a process of disulfide shuffling. This may lead to the formation of mismatched disulfide bonds, either between the engineered cysteine and a native cysteine residue or between incorrectly matched native disulfide bonds. Such mismatched disulfide bonds may affect the retention of the antibody on the reverse-phase HPLC column. The mismatch processes may also result in unpaired cysteine residues other than the desired engineered cysteine. Attachment of the maleimide-MMAF to different positions on the antibody affects the retention time differently (see discussion of homogenously conjugated ADCs below). In addition, incomplete re-oxidation will leave the antibody with native cysteine residues that will react with maleimide-MMAF in addition to the desired conjugation with the engineered cysteine residue. Any process that hinders proper and complete formation of the native disulfide bonds will result in a complex HPLC profile (FIG. 11) upon conjugation to Maleimide-MMAF. The yield of the uniform ADC as measured by UV absorption of the unpurified reaction mixtures, varied depending on the Cys mutations (Table 17). Using the reduction/re-oxidation protocol and conjugation procedures described above 65 of the 88 Cys mutant trastuzumab antibodies resulted in homogeneous conjugation products and these sites are advantageous sites for Cys replacements to be made when making cysteine-engineered antibodies for conjugation.
  • These 65 Cys-MMAF ADCs were analyzed in details in various assays: Differential scanning fluorimetry (DSF) was used to measure thermal stability. Analytical size exclusion chromatograph (AnSEC) was used to measure aggregation. In vitro antigen dependent cell killing potency was measured by cell viability assays and pharmacokinetics behavior was measured in mice. These assays and the respective results are described in more detail below.
  • To evaluate the aggregation state of trastuzumab Cys-MMAF ADCs, the ADCs were analyzed in a size exclusion chromatography column (GE, Superdex200, 3.2/30) at a flow rate of 0.1 ml/min in PBS. All 65 Cys-MMAF ADCs were monomeric. The majority of the ADCs contain less than 10% oligomer (FIG. 13, Table 18), indicating that conjugation of MC-MMAF to trastuzumab Cys mutant constructs at the selected sites did not cause aggregation of the antibody.
  • TABLE 17
    Yield of MMAF ADCs generated with trastuzumab Cys mutant
    constructs. “Hetero” indicates a heterogeneous mixture of species
    shown in reverse phase HPLC with different retention times.
    trastuzumab Yield Yield
    Cys-MMAF ADC (mg/L) Cys construct (mg/L)
    HC-S117C 6.9 HC-R344C 33.4
    HC-S119C 15.3 HC-R355C 24.3
    HC-K121C 4.4 HC-K360C 26.5
    HC-S124C 13.2 HC-Q362C hetero
    HC-S132C Hetero HC-S375C 34.3
    HC-S134C Hetero HC-E382C 34.9
    HC-S136C Hetero HC-N389C hetero
    HC-T139C 11.1 HC-N390C 33.1
    HC-E152C 7.8 HC-K392C 20.8
    HC-P153C 8.2 HC-T393C hetero
    HC-T155C 12.9 HC-L398C 3.4
    HC-S157C 13.5 HC-S400C 1.7
    HC-T164C 13.7 HC-D413C hetero
    HC-S165C Hetero HC-S415C hetero
    HC-T169C 4.7 HC-V422C 3.6
    HC-P171C 14.7 LC-K107C 1.6
    HC-L174C 9.1 LC-R108C 12.2
    HC-S176C Hetero LC-T109C 8.4
    HC-S177C Hetero LC-A112C hetero
    HC-P189C 7.7 LC-S114C 16.9
    HC-S191C Hetero LC-D122C Hetero
    HC-T195C Hetero LC-E123C Hetero
    HC-T197C Hetero LC-T129C 4.0
    HC-K205C 11.3 LC-R142C 11.3
    HC-S207C 1.0 LC-E143C 4.0
    HC-D212C Hetero LC-K145C 8.7
    HC-K246C 9.0 LC-N152C 7.2
    HC-E258C 10.1 LC-L154C 1.3
    HC-E269C 5.6 LC-S156C 7.2
    HC-K274C 15.3 LC-S159C 12.3
    HC-N286C 12.9 LC-E161C 12.0
    HC-K288C 14.4 LC-E165C 2.0
    HC-K290C 8.0 LC-S168C 3.1
    HC-R292C 10.3 LC-K169C 2.5
    HC-E293C 15.0 LC-D170C 2.2
    HC-E294C Hetero LC-S182C 7.9
    HC-K320C 18.9 LC-K183C 3.8
    HC-K322C 29.1 LC-K188C 7.2
    HC-K326C 22.8 LC-K190C Hetero
    HC-A330C Hetero LC-V191C Hetero
    HC-E333C 7.4 LC-T197C 16.4
    HC-K334C 11.2 LC-Q199C 10.3
    HC-T335C 5.2 LC-S203C 13.5
    HC-S337C 1.4 LC-T206C Hetero
  • TABLE 18
    Percentage of oligomer in trastuzumab Cys-MMAF ADC preparations
    as determined by analytical size-exclusion chromatography.
    trastuzumab Oligomer Conjugation Oligomer
    Cys-MMAF ADC (%) site (%)
    HC-S117C b.d. HC-R344C 9.5
    HC-S119C 3.2 HC-R355C b.d.
    HC-K121C b.d. HC-K360C b.d.
    HC-S124C b.d. HC-S375C b.d.
    HC-T139C 4.8 HC-E382C b.d.
    HC-E152C b.d. HC-N390C b.d.
    HC-P153C b.d. HC-K392C b.d.
    HC-T155C b.d. HC-L398C b.d.
    HC-S157C b.d. HC-S400C 9.2
    HC-T164C b.d. HC-V422C b.d.
    HC-T169C b.d. LC-K107C b.d.
    HC-P171C b.d. LC-R108C b.d.
    HC-L174C b.d. LC-T109C b.d.
    HC-P189C b.d. LC-S114C b.d.
    HC-K205C b.d. LC-T129C b.d.
    HC-S207C b.d. LC-R142C b.d.
    HC-K246C b.d. LC-E143C 13.1
    HC-E258C b.d. LC-K145C b.d.
    HC-E269C b.d. LC-N152C b.d.
    HC-K274C 11.7 LC-L154C 7.3
    HC-N286C 9.2 LC-S156C 6.1
    HC-K288C b.d. LC-S159C 2.8
    HC-K290C b.d. LC-E161C b.d.
    HC-R292C b.d. LC-E165C b.d.
    HC-E293C b.d. LC-S168C b.d.
    HC-K320C b.d. LC-K169C b.d.
    HC-K322C b.d. LC-D170C b.d.
    HC-K326C b.d. LC-S182C 6.9
    HC-E333C b.d. LC-K183C b.d.
    HC-K334C b.d. LC-K188C b.d.
    HC-T335C b.d. LC-T197C b.d.
    HC-S337C b.d. LC-Q199C 6.3
    LC-S203C b.d.
    b.d.: Below detection limit.
  • Example 7 In Vitro Thermal Stability Assay of Trastuzumab Cys-MMAF ADCs
  • Conjugation of MMAF payload to trastuzumab may stabilize or destabilize the antibody, leading to changes in melting temperature of the antibody, which can be determined by differential scanning fluorimetry (DSF) that is based on temperature induced denaturation monitored by an environmentally sensitive dye, such as sypro orange. ADC samples were aliquoted in triplicate to 384-well plates into PBS (6.7 mM sodium phosphate pH7.2; 150 mM NaCl). In each well, 8 μl of 0.25 mg/ml antibody was mixed with 2 μl 25× sypro orange dye (Invitrogen). Plates were sealed and analyzed in a Roche LightCycler 480 system with a temperature ramp from 30 to 85° C. with 20 fluorescence scans recorded per degree C. Melting temperatures were determined from the first derivative of the fluorescence intensity vs. time curves.
  • A typical thermal shift assay for wild-type trastuzumab revealed two melting transitions (Tm), Tm1 at 69.7° C. and Tm2 at 81.2° C., respectively (Table 19). When trastuzumab Cys-MMAF ADCs were subjected to protein thermal stability assays, it was evident that conjugation of MC-MMAF to the antibodies induced different Tm changes depending on the sites of conjugation (Table 19). When MC-MMAF was conjugated to majority of the Cys sites in either CH1 or CH3 domains, the resulting ADCs, for example HC-K356C-MMAF, showed a similar pattern as that of wild-type anti-Her with little changes in Tm1 and Tm2. However, when MC-MMAF was conjugated to Cys sites located in the CH2 domain, a decrease in Tm1 was observed for most sites while the Tm2 remained largely unchanged. The Tm1 decrease observed for most CH2 domain Cys-MMAF conjugates ranged from 5° C. to 26° C. The two ADCs with the largest decrease in Tm1 are HC-T335C-MMAF and HC-S337C-MMAF, with Tm1 at 42° C. and 45° C., respectively (FIG. 14). The results indicate that the location of MC-MMAF conjugation can have a significant impact on the stability of the ADCs.
  • TABLE 19
    Melting temperatures Tm1 and Tm2 of trastuzumab Cys-MMAF
    ADCs observed by differential scanning fluorimetry (DSF).
    trastuzumab
    Cys-MMAF ADC HC domain Tm1 [° C.] Tm2 [° C.]
    wild type antibody n.a. 69.71 81.18
    HC-S117C CH1 69.09 79.85
    HC-S119C CH1 69.28 78.58
    HC-K121C CH1 69.63 78.52
    HC-S124C CH1 69.27 80.56
    HC-T139C CH1 69.09 80.74
    HC-E152C CH1 69.63 80.83
    HC-P153C CH1 69.71 78.52
    HC-T155C CH1 69.27 80.83
    HC-S157C CH1 69.72 80.81
    HC-T164C CH1 69.17 80.7
    HC-T169C CH1 68.74 80.47
    HC-P171C CH1 69.27 77.18
    HC-L174C CH1 69.89 80.03
    HC-P189C CH1 69.09 81.27
    HC-K205C CH1 69.54 80.65
    HC-S207C CH1 69.00 80.65
    HC-K246C CH2 64.65 80.74
    HC-E258C CH2 65.32 81.03
    HC-E269C CH2 65.36 81.01
    HC-K274C CH2 67.14 81.09
    HC-N286C CH2 67.22 81.09
    HC-K288C CH2 65.54 80.83
    HC-K290C CH2 69.00 80.65
    HC-R292C CH2 67.49 80.56
    HC-E293C CH2 64.34 81.03
    HC-K320C CH2 60.60 80.59
    HC-K322C CH2 62.41 80.70
    HC-K326C CH2 63.05 80.74
    HC-E333C CH2 63.67 80.92
    HC-K334C CH2 64.65 80.47
    HC-T335C CH2 42.93 80.04
    HC-S337C CH2 45.56 80.48
    HC-R344C CH3 69.50 80.92
    HC-R355C CH3 68.18 81.25
    HC-K360C CH3 69.28 80.92
    HC-S375C CH3 68.20 81.36
    HC-E382C CH3 69.36 80.74
    HC-N390C CH3 68.73 80.92
    HC-K392C CH3 67.05 80.92
    HC-L398C CH3 68.47 81.36
    HC-S400C CH3 68.65 81.27
    HC-V422C CH3 69.98 81.45
    LC-K107C n.a. 69.45 80.29
    LC-R108C n.a. 70.10 n.d.1
    LC-T109C n.a. 68.47 80.21
    LC-T129C n.a. 68.47 80.12
    LC-R142C n.a. 69.00 78.61
    LC-E143C n.a. 69.83 80.59
    LC-K145C n.a. 69.00 80.65
    LC-N152C n.a. 67.49 81.09
    LC-L154C n.a. 68.47 80.65
    LC-S156C n.a. 68.83 80.47
    LC-S159C n.a. 69.50 79.93
    LC-E161C n.a. 68.65 80.12
    LC-E165C n.a. 69.27 79.76
    LC-S168C n.a. 69.54 79.67
    LC-K169C n.a. 69.09 80.29
    LC-D170C n.a. 68.83 80.12
    LC-S182C n.a 69.18 80.29
    LC-K183C n.a 69.09 80.47
    LC-K188C n.a 68.74 80.65
    LC-T197C n.a 69.63 80.74
    LC-Q199C n.a 69.54 80.21
    LC-S203C n.a 68.84 80.92
    n.d. Not determined because a broad transition in Tm2 prevented accurate Tm determination.,
    n.a. Not applicable
  • Example 8 Cell Proliferation Assays to Measure In Vitro Cell Killing Potency of Cys ADCs
  • Cells that naturally express target antigens or cell lines engineered to express target antigens are frequently used to assay the activity and potency of ADCs. For evaluation of the cell killing potency of trastuzumab ADCs in vitro, two engineered cell lines, MDA-MB231 clone 16 and clone 40, and HCC1954 cells were employed (Clinchy B, Gazdar A, Rabinovsky R, Yefenof E, Gordon B, Vitetta E S. Breast Cancer Res Treat. (2000) 61:217-228). MDA-MB231 clone 16 cells stably express high copy numbers (˜5×105 copies/cell) of recombinant human Her2 while clone 40 expresses low copy numbers (˜5×103 copies/cell) of human Her2. HCC1954 cells endogenously express high level (˜5×105 copies/cell) of human Her2 in the surface. For determination of the cell killing potency of antibody 14090 ADCs, CMK11-5 and Jurkat cells were used. While CMK11-5 cells express a high level of the antigen for antibody 14090 in the cell surface there is no detectable antigen expression in Jurkat cells. An antigen dependent cytotoxic effect should only kill cells that express sufficient antigen in the cell surface and not cells lacking the antigen. The cell proliferation assays were conducted with Cell-Titer-Glo™ (Promega) five days after cells were incubated with various concentrations of ADCs (Riss et al., (2004) Assay Drug Dev Technol. 2:51-62). In some studies, the cell based assays are high throughput and conducted in an automated system (Melnick et al., (2006) Proc Natl Acad Sci USA. 103:3153-3158).
  • Trastuzumab Cys-MMAF ADCs specifically killed MDA-MB231 clone 16 and HCC1954 but not MDA-MB231 clone 40 cells (FIG. 15). IC50 of the trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16 cell assays ranges from 30 pM to 200 pM (Table 20, FIG. 16). Similarly, antibody 14090 Cys-MMAF ADC displayed antigen dependent cell killing in cell proliferation assays. The antibody 14090 Cys-MMAF ADCs killed antigen expressing CMK11-5 cells but not antigen negative Jurkat cells (FIG. 17). The IC50 of the antibody 14090-MMAF ADC in CMK11-5 proliferation assay is in the range of 400 pM to 1 nM (Table 21).
  • TABLE 20
    IC50 of trastuzumab Cys-MMAF ADCs in MDA-MB231 clone 16
    Her2+ cell proliferation assay.
    trastuzumab trastuzumab
    Cys-MMAF ADC IC50 (μM) Cys-MMAF ADC IC50 (μM)
    HC-S117C 1.55E−04 HC-R344C 2.75E−04
    HC-S119C 1.18E−04 HC-R355C 1.21E−04
    HC-K121C 1.06E−04 HC-K360C 1.92E−04
    HC-S124C 9.78E−05 HC-S375C 1.42E−04
    HC-T139C 1.48E−04 HC-E382C 2.53E−04
    HC-E152C 7.62E−05 HC-N390C 1.58E−04
    HC-P153C 9.27E−05 HC-K392C 1.43E−04
    HC-T155C 1.33E−04 HC-L398C 1.08E−04
    HC-S157C 1.47E−04 HC-S400C 1.43E−04
    HC-T164C 1.34E−04 HC-V422C 1.72E−04
    HC-T169C 1.98E−04 LC-K107C 2.59E−05
    HC-P171C 1.33E−04 LC-R108C 2.96E−05
    HC-L174C 1.19E−04 LC-T109C 8.12E−05
    HC-P189C 1.82E−04 LC-S114C 3.37E−05
    HC-K205C 1.02E−04 LC-T129C 2.73E−05
    HC-S207C 2.16E−04 LC-R142C 2.64E−05
    HC-K246C 9.54E−05 LC-E143C 3.76E−05
    HC-E258C 9.40E−05 LC-K145C 3.87E−05
    HC-E269C 8.98E−05 LC-N152C 2.14E−05
    HC-K274C 9.99E−05 LC-L154C 3.52E−05
    HC-N286C 9.94E−05 LC-S156C 4.28E−05
    HC-K288C 7.47E−05 LC-S159C 4.34E−05
    HC-K290C 3.55E−04 LC-E161C 3.62E−05
    HC-R292C 9.69E−05 LC-E165C 4.68E−05
    HC-E293C 1.10E−04 LC-S168C 2.50E−04
    HC-K320C 9.79E−05 LC-K169C 7.74E−05
    HC-K322C 1.16E−04 LC-D170C 1.64E−04
    HC-K326C 1.73E−04 LC-S182C 9.07E−05
    HC-E333C 1.28E−04 LC-K183C 8.39E−05
    HC-K334C 1.43E−04 LC-K188C 9.71E−05
    HC-T335C 8.69E−05 LC-T197C 1.07E−04
    HC-S337C 7.79E−05 LC-Q199C 1.31E−04
    LC-S203C 1.18E−04
  • TABLE 21
    IC50 of antibody 14090 Cys-MMAF ADCs in CMK11-5 cell
    proliferation assay
    Antibody
    14090 Cys-MMAF ADC IC50 (μM)
    HC-S124C 9.26E−04
    HC-T139C 1.22E−03
    HC-E152C 4.60E−04
    HC-L174C 6.02E−04
    HC-K360C 8.56E−04
    HC-S375C 4.38E−04
    LC-A143C 7.09E−04
    LC-A147C 1.14E−03
    LC-V159C 5.41E−04
    LC-T163C 6.38E−04
    LC-S168C 1.06E−03
  • Example 9 Pharmacokinetic Study of Trastuzumab Cys-MMAF ADCs
  • It has been demonstrated that a long serum half-life is critical for high in vivo efficacy of ADCs (Hamblett, et al., “Effects of drug loading on the antitumor activity of a monoclonal antibody drug conjugate,” Clin Cancer Res., 10:7063-7070 (2004); Alley et al., Bioconjug Chem. 19:759-765 (2008)). Attaching an usually hydrophobic drug payload to an antibody could significantly affect the properties of an antibody, and this may lead to a fast clearance of the ADCs in vivo (Hamblett et al., 2004) and poor in vivo efficacy. To evaluate the effects of different conjugation site on clearance of MMAF ADCs in vivo, pharmacokinetic studies in non-tumor bearing mice were carried out with 65 trastuzumab Cys-MMAF ADCs. To detect MMAF containing ADCs in murine plasma, an anti-MMAF antibody was generated. ELISA assays for the detection of ADCs were developed using the extracellular domain of human HER2 to capture trastuzumab IgG molecules from the plasma and an anti-human IgG (anti-hIgG) antibody and the anti-MMAF antibody for signal generation in two separate assays. The two ELISA assays measure the serum concentration of the trastuzumab antibody and the “intact” ADC respectively as discussed in more detail below.
  • Three mice per group were administered with a single dose of a trastuzumab Cys-MMAF ADC at 1 mg/kg. Ten plasma samples were collected over the course of two weeks and assayed by ELISA using the extracellular domain of human HER2 to capture all trastuzumab IgG molecules including trastuzumab Cys-MMAF ADCs and trastuzumab lacking MMAF. An anti-MMAF and an anti-hIgG antibody were then used for detection in two separate assays. The anti-MMAF antibody ELISA measures the concentration of trastuzumab MMAF conjugates only and the anti-hIgG ELISA quantitates both trastuzumab Cys-MMAF conjugates and trastuzumab antibodies that lack MMAF. Standard curves were generated for each ADC separately using the same material as injected into the mice. The assays with anti-MMAF and anti-hIgG should therefore yield identical concentration readouts if no changes to the drug loading of the trastuzumab Cys-MMAF ADC occur after injection into mice. For trastuzumab Cys-MMAF ADCs that lost some of the MMAF payload, the ELISA assay with the anti-MMAF antibody will measure a lower concentration than the anti-hIgG ELISA. A comparison of the two concentration readouts therefore allows to measure drug-release from trastuzumab Cys-MMAF ADCs during in vivo incubation in the mouse.
  • As measured by anti-hIgG ELISA, 63 out of 65 ADCs displayed a pharmacokinetic profile similar to unconjugated wild-type trastuzumab antibody (FIGS. 18, 19, 20), indicating that MC-MMAF payload conjugation to these sites did not significantly affect the antibody's clearance. The two exceptions are HC-T335C and HC-S337C. Conjugation of MC-MMAF to these two sites results in rapid clearance of the ADCs as measured by the anti-MMAF and the anti-hIgG ELISA (FIG. 21). The protein thermal shift assay revealed that the Tm1 for trastuzumab HC-T335C-MMAF and trastuzumab HC-S337C-MMAF decreased from 69° C. in wild-type trastuzumab antibody to 42° C. and 45° C., respectively (FIG. 14). Conjugation of MC-MMAF to the two sites dramatically reduces the thermal stability of the ADC (by 27° C. and 24° C., respectively). For the 63 ADCs that show a pharmacokinetic profile similar to unconjugated antibody, Tm1 changes were smaller than 8° C. suggesting that fast clearance may possibly correlate with low thermal stability of the ADC.
  • To determine the chemical stability of linkage between the MMAF payload and the antibody at the various Cys sites, the concentrations of trastuzumab Cys-MMAF ADC as measured by the anti-MMAF ELISA and of all trastuzumab molecules as measured by the anti-hIgG ELISA were compared to each other for each sample. Many trastuzumab Cys-MMAF ADCs, within the error of the measurements, displayed a good overlap between the two concentrations over the course of two weeks, suggesting that the bond between MC-MMAF and the cysteine introduced at these sites was stable during circulation in mice over this period (FIGS. 18, 19). In contrast, some trastuzumab Cys-MMAF ADCs displayed a significant drug loss as indicated by the higher anti-hIgG readout than the anti-MMAF readout (FIG. 20). For some trastuzumab Cys-MMAF ADCs, the concentration of ADC was about 50% of that of hIgG. These results suggest that there are significant differences in stability of a thiol-maleimide bond of drug payloads conjugated to different sites as has been suggested previously (Shen et al. Nat. Biotechnol. 2012, 30 (2):184-9). Sites having good stability are preferred sites for use of preparing ADCs as described herein.
  • In pharmacokinetic studies, the area-under-the-plasma-concentration-versus-time-curve (AUC) is an important parameter in estimating total clearance and bioavailability of an administered drug. In our pharmacokinetic studies, for each trastuzumab Cys-MMAF ADC two AUC values, AUC-MMAF and AUC-hIgG, were calculated separately from measurements with the anti-MMAF and the anti-hIgG ELISA. The ratios of AUC-MMAF to AUC-hIgG for all trastuzumab Cys-MMAF ADCs varied from 0.4 to 1.2 (Table 20). FIGS. 18, 19 and 20 include PK curves for ADCs over the full range of observed AUC-MMAF/AUC-hIgG ratios and illustrate the variability and uncertainty of the measurements. Ratios of AUC-MMAF to AUC-hIgG >1 (Table 20) suggest uncertainties of >25% since the ratio should remain near 1 if no drug loss occurs. As shown in Table 20, out of 63 trastuzumab Cys-MMAF ADCs with measurable AUCs from both ELISAs, 40 ADCs show a ratio of AUC-MMAF/AUC-hIgG >0.7, indicating that within the accuracy of the measurement, little MMAF drug loss was observed at these after administration in mice. However, 23 ADCs displayed a ratio of AUC-MMAF/AUC-hIgG <0.7, suggesting that the amount of MMAF payload conjugate at these 23 sites decreased significant during the in vivo incubation in the mouse.
  • Differences in stability of the maleimide linkage at different conjugation sites has previously been reported for Cys engineered ADCs (see Shen et al., (2012) Nat Biotechnol. 22;30(2):184-9 for discussion and references). For the preferred sites that exhibit enhanced serum stability, the antibody environment likely catalyzes the hydrolysis of the succinimide ring formed by the reaction of maleimide with cysteine. The hydrolyzed form cannot revert back and cannot release the maleimide drug. As such, the ability of the antibody environment to catalyze the ring hydrolysis cannot be predicted and is an unexpected property of certain engineered Cys sites. Sites in Table 22 having an AUC(MMAF)/AUC(hIgG) ratio greater than 0.7 are therefore particularly suitable sites for cysteine substitution based on this criterion, and sites having a ratio of about 0.9 or above are especially preferred cysteine substitution sites for purposes of the invention when applying. These include heavy chain sites 322, 334, 121, 288, 171, 139, 360, 117, 392, 375, 292, 333, 174, 258, 337, 422, 320, 390, and 335; and light chain sites 107, 203, 108 and 114.
  • TABLE 22
    AUC-MMAF and AUC-hIgG of trastuzumab Cys-MMAF
    ADCs in mice
    trastuzumab AUC-MMAF AUC-hIgG AUC(MMAF)/
    Cys-MMAF ADC (hrs*μg/ml) (hrs*μg/ml) AUC(hIgG)
    HC-K246C-MMAF 1515 3587 0.4
    HC-K205C-MMAF 2109 4893 0.4
    LC-S168C-MMAF 1688 3619 0.5
    LC-E143C-MMAF 1589 3254 0.5
    HC-E382C-MMAF 1364 2541 0.5
    HC-T155C-MMAF 2930 5308 0.6
    HC-S119C-MMAF 2230 4045 0.6
    LC-T129C-MMAF 2375 4332 0.6
    LC-T109C-MMAF 1588 2716 0.6
    LC-K169C-MMAF 2858 4855 0.6
    HC-S400C-MMAF 2363 3922 0.6
    HC-R355C-MMAF 2344 3777 0.6
    HC-R344C-MMAF 1994 3215 0.6
    LC-Q199C-MMAF 2042 3261 0.6
    LC-S182C-MMAF 2434 3722 0.7
    HC-P153C-MMAF 2201 3402 0.7
    HC-N286C-MMAF 2286 3535 0.7
    HC-T169C-MMAF 2113 3190 0.7
    LC-K183C-MMAF 2014 3053 0.7
    LC-T197C-MMAF 2126 3177 0.7
    LC-K145C-MMAF 2339 3454 0.7
    HC-L398C-MMAF 2063 2979 0.7
    HC-P189C-MMAF 2042 2968 0.7
    HC-S157C-MMAF 2625 3640 0.7
    HC-E269C-MMAF 2373 3293 0.7
    LC-S159C-MMAF 2063 2809 0.7
    LC-E161C-MMAF 1974 2632 0.8
    LC-E165C-MMAF 2481 3244 0.8
    HC-T164C-MMAF 2514 3290 0.8
    LC-R142C-MMAF 2903 3786 0.8
    LC-S156C-MMAF 2217 2847 0.8
    HC-S207C-MMAF 2378 3001 0.8
    LC-N152C-MMAF 2303 2862 0.8
    HC-E152C-MMAF 3403 4202 0.8
    LC-L154C-MMAF 1959 2387 0.8
    LC-K188C-MMAF 2230 2680 0.8
    HC-K326C-MMAF 2621 3157 0.8
    LC-D170C-MMAF 2048 2420 0.9
    HC-K290C-MMAF 2668 3090 0.9
    HC-E293C-MMAF 2167 2523 0.9
    HC-S124C-MMAF 2107 2463 0.9
    HC-K274C-MMAF 3080 3554 0.9
    HC-K322C-MMAF 3108 3437 0.9
    HC-K334C-MMAF 4527 5048 0.9
    HC-K121C-MMAF 2647 2952 0.9
    HC-K288C-MMAF 2681 2902 0.9
    HC-P171C-MMAF 2312 2481 0.9
    LC-K107C-MMAF 2621 2817 0.9
    HC-T139C-MMAF 2951 3186 0.9
    HC-K360C-MMAF 3791 4014 0.9
    HC-S117C-MMAF 2661 2828 0.9
    LC-S203C-MMAF 2730 2919 0.9
    HC-K392C-MMAF 3148 3302 1.0
    HC-S375C-MMAF 2593 2644 1.0
    HC-R292C-MMAF 2816 2806 1.0
    HC-E333C-MMAF 3850 3796 1.0
    HC-L174C-MMAF 2604 2541 1.0
    HC-E258C-MMAF 3941 3732 1.1
    HC-S337C-MMAF 34.38 32.14 1.1
    HC-V422C-MMAF 2662 2424 1.1
    HC-K320C-MMAF 3181 2776 1.2
    HC-N390C-MMAF 3627 3105 1.2
    LC-R108C-MMAF 3711 2992 1.2
    LC-S114C-MMAF n.a. 2567 n.a.
    HC-T335C-MMAF 6.71 n.a. n.a.
    n.a: not applicable.
  • Example 10 Combination of Cys Sites to Produce Antibody Drug Conjugates with Drug-to-Antibody-Ratios Greater than 2
  • Antibody conjugates produced through conjugation to lysine residues or partially reduced native disulfide bonds often feature drug-to-antibody-ratios (DAR) of between 3 and 4. Cys engineered antibodies more typically feature a DAR of 2. For certain indications, it may be desirable to produce ADCs with higher DAR which can in principle be achieved by introducing multiple Cys mutations in the antibody. As the number of Cys mutation increases, the likelihood that such mutations interfere with the required re-oxidation process during ADC preparation and hence result in heterogeneous products also increases. In this study, a large number of single site heavy and light chain Cys mutants with good re-oxidation behavior were identified.
  • To demonstrate that several conjugation sites can be combined for the production of ADCs with DAR greater than two, several preferred single site Cys constructs of light and heavy chain of trastuzumab and antibody 14090 (Table 23) were coexpressed in 293 Freestyle™ cells as described in Example 5. Purified antibodies which all contain one Cys mutation on the heavy chain and one Cys mutation on the light chain were reduced, re-oxidized and conjugated with MC-MMAF as described in Example 6. Reverse phase high-pressure liquid chromatography demonstrated a single defined elution peak suggesting efficient re-oxidation of the native disulfide bonds. Reverse phase high-pressure liquid chromatography after MC-MMAF conjugation also showed predominantly a single elution peak for the DAR 4 ADC species. The DAR of all ADCs in Table 23 was confirmed to be 4 by mass spectrometry. Production yields varied from 16 to 24 mg/L transient cell culture. The ADCs were predominantly monomeric as determined by analytical size exclusion chromatography; only for 2 of the 8 antibodies could small amounts of aggregates be detected (Table 23). Trastuzumab and 14090 ADCs exhibited antigen-dependent cell killing in MDA-MB231 clone 16 and CMK1105 cell proliferation assays, respectively (Table 23).
  • TABLE 23
    Properties of Cys engineered MMAF ADCs with DAR of 4.
    Cys-MMAF IC50 MDA- IC50
    ADC LC SEQ HC SEQ Yield AnSEC AnSEC MB231-16 CMK11-5
    (DAR = 4) ID NO ID NO (mg/L) % Monomer % Multimer cells (μM) cells (μM)
    trastuzumab 75 29 17.3 100 Not 4.91e−4 No
    LC-S159C- detected potency
    HC-E258C
    trastuzumab 75 50 17.8 100 Not 2.44e−4 No
    LC-S159C- detected potency
    HC-S375C
    trastuzumab 77 29 16.5 100 Not 3.24e−4 No
    LC-E165C- detected potency
    HC-E258C
    trastuzumab 77 50 16.9 100 Not 2.15e−4 No
    LC-E165C- detected potency
    HC-S375C
    Antibody 92 48 16.1 94.8 5.2 No 4.92e−4
    14090 potency
    LC-A143C-
    HC-K360C
    Antibody 92 50 21.8 100 Not No 4.76e−4
    14090 detected potency
    LC-A143C-
    HC-S375C
    Antibody 96 48 24.0 100 Not No 4.55e−4
    14090 detected potency
    LC-V159C-
    HC-K360C
    Antibody 96 50 21.7 97.1 2.9 No 3.99e−4
    14090 potency
    LC-V159C-
    HC-S375C
    n.d.: not detectable,
    no potency: no sign of cell killing at highest concentration evaluated (66 nM)
    SEQ ID NOs only specify constant regions of antibody sequences.
  • Example 11 Selection of Cys Sites Based on ADC Hydrophobicity
  • To further optimize the selection Cys mutants and mutant combinations for the preparation of ADCs with DAR 2, 4, 6 and 8, the properties of MMAF ADCs prepared with single site trastuzumab Cys and Pcl mutants (Preparation of Pcl ADCs is described in patent application 55573) were analyzed, and accessibility and solvent exposure of conjugation sites was inspected in the crystal structures of IgG.
  • One of the most informative data was the observation that the hydrophobicity of trastuzumab Pcl-MMAF ADCs varied greatly when the payload was attached different sites (FIG. 23). The hydrophobicity of these ADCs was measured by hydrophobic interaction chromatography (HIC) using a TSKgel Phenyl-5PW column (Tosoh Bioscience, TSKgel Phenyl-5PW, 13 m, 21×150 mm, stainless steel, Cat#07656; running buffer A: 1.5 M ammonium sulfate in 20 mM NaPi (pH7.4); buffer B: 20% isopropanol in 20 mM NaPi (pH7.4); flow rate 5 ml/min; linear gradient from 20% to 80% buffer B over 90 mins; monitored by UV absorbance at 280 nm). Surprisingly, it was observed that retention times of the DAR 2 species varied greatly among ADCs although the only difference is the site of ABA-MMAF attachment (FIG. 23). HIC separates molecules on the basis of the hydrophobicity. All DAR 2 ADCs have a HIC retention time larger than that of unconjugated antibody (WT=45 min, FIG. 23) which is to be expected when a hydrophobic drug molecule such as ABA-MMAF is attached to an antibody. However, attaching the payload at different sites increases the hydrophobicity of the ADC to various extends.
  • The surprisingly large differences in retention times can be rationalized from the inspection of location of the attachment sites on the structure of an antibody (FIG. 24): The retention times are higher if the drug payload is attached at an exposed site on the outside of an antibody, for example at HC-K288Pcl, HC-N286Pcl, HC-V422Pcl, HC-L398Pcl and HC-S415Pcl where retention time between 87 and 94 mM were measured for the respective ADCs (FIG. 23). Conversely, if the payload is attached at an interior site such as the cavity formed between variable and CH1 domains (for examples, HC-P153Pcl, HC-E152Pcl, HC-L174Pcl, HC-P171Pcl, LC-R142Pcl, LC-E161Pcl, LC-E165Pcl, LC-S159Pcl) or the large opening between CH2 and CH3 domains of the antibody (for examples, HC-K246C, HC-S375Pcl, HC-T393Pcl, HC-K334Pcl), the HIC retention time increased to only 47 to 57 mins because the payload is partially sequestered from interacting with solvent and the HIC column. For other sites, for example, the relatively exposed sites, LC-K107Pcl and HC-K360Pcl, intermediate retention time of 70 and 83 min were measured.
  • Reducing hydrophobicity of a protein drug is generally considered beneficial because it may reduce aggregation and clearance from circulation. We propose that the HIC data presented in FIG. 23 enables selection of preferred payload attachment sites. Conjugating drug payloads at sites where they are sequestered from solvent interactions and attachment minimally increases the hydrophobicity of the antibody upon drug attachment should be beneficial independent of the conjugation chemistry and payload class. Carefully selecting attachment sites that result in minimal changes in hydrophobicity may be particularly beneficial when 4, 6 or 8 drugs are attached per antibody, or when particularly hydrophobic payloads are used.
  • Cys Sites Selected for ADCs with Low Hydrophobicity:
  • To minimize hydrophobicity of ADCs, sites were chosen that would point toward the interior of the various protein domains of the antibody. Selection was based on analysis of the antibody structure and behavior of the existing ADCs with DAR=2 where applicable (behavior=retention time on HIC and/or delayed retention time on AnSEC with conjugates that interact with SEC resins). Of the Cys sites identified in Table 1 and Table 2, sites listed in Table 24 fulfill the above criteria.
  • All ADCs were analyzed by hydrophobic interaction chromatography (HIC). Trastuzumab MMAF ADCs conjugated at the exposed sites HC-K360C, LC-K107C, HC-E258C and HC-R292C were used for comparison purposes. The results are shown in Table 25. The trastuzumab Cys-MMAF ADCs and unconjugated, wild-type antibody were analyzed on a TSKgel Butyl-NPR column as described below. For comparison, HIC data previously obtained for Pcl-MMAF ADCs on a TSKgel Phenyl-5PW (FIG. 23) are also listed. Despite different instrumentation and protocols, and although some variability is expected due to the different geometry and structures of the two linker, the ratio of retention times for the ADC conjugated at the same position but through different conjugation methods remains nearly constant. The HIC data suggests that retention times are indeed a measure of how well a payload is sequestered in the interior of the antibody independent of attachment chemistry and linker structure. As expected the relative ranking of the different attachment sites remains largely identical for Pcl-MMAF and Cys-MMAF ADCs.
  • Attachment to site selected in Table 24, HC-E333C, HC-K392C, and HC-K326C results in MMAF ADCs that have HIC retention times that are similar to the exposed site ADCs LC-K107C-MMAF, HC-E258C-MMAF, HC-R292C-MMAF and HC-K360C-MMAF (Table 28). Attachment to the HC-E152C, LC-E165C, HC-P171C, LC-R142C, LC-E161C, HC-L174C and HC-S124C sites increases the retention time of the resulting ADC by less than 15% compared to the unconjugated, wild-type antibody. These sites are all located on in the CH1 domain or on the light chain (LC) and HIC retention time data suggests them as preferred attachment sites. Of the CH3 domain sites, HC-K334C and HC-S375C exhibit to lowest increase in hydrophobicity upon conjugation making them preferred attachment sites.
  • TABLE 24
    Cys mutant sites
    Cys mutant site Site (EU No.)
    LC-R142C 142
    LC-S159C 159
    LC-E161C 161
    LC-E165C 165
    HC-S124C 124
    HC-E152C 152
    HC-P171C 171
    HC-L174C 174
    HC-K326C 326
    HC-E333C 333
    HC-K334C 334
    HC-S375C 375
    HC-K392C 392
  • TABLE 25
    Hydrophobic interaction chromatography (HIC) retention time of the
    DAR 2 species of trastuzumab MMAF ADCs.
    Comparing Cys and Pcl conjugation chemistry, the two sets agree well:
    Sites that hide the drug conjugated by one chemistry also tend to hide
    the drug when conjugated by the other chemistry. Some variability is
    expected due to the different geometry of the two linker systems.
    DAR2 DAR2
    HIC HIC
    retentiona retentionb
    Trastuzumab ADC (min) Trastuzumab ADC (min) Ratio
    WT 19.5 WT 45 0.43
    HC-E152C-MMAF 20.4 HC-E152Pcl-MMAF 50 0.41
    LC-E165C-MMAF 20.8 LC-E165Pcl-MMAF 55 0.38
    HC-P171C-MMAF 21.0 HC-P171Pcl-MMAF 51 0.41
    HC-K334C-MMAF 21.5 HC-K334Pcl-MMAF 56 0.38
    HC-S375C-MMAF 21.6 HC-S375Pcl-MMAF 52 0.42
    LC-R142C-MMAF 21.7 LC-R142Pcl-MMAF 51 0.42
    LC-E161C-MMAF 22.0 LC-E161Pcl-MMAF 55 0.40
    HC-L174C-MMAF 22.0 HC-L174Pcl-MMAF 50 0.44
    HC-S124C-MMAF 22.4 HC-S124Pcl-MMAF 59 0.38
    HC-E333C-MMAF 23.1 HC-E333Pcl-MMAF 63 0.37
    HC-K392C-MMAF 23.1 HC-K392Pcl-MMAF 60 0.38
    HC-R292C-MMAF 23.8 HC-R292Pcl-MMAF 69 0.35
    HC-K326C-MMAF 24.5 HC-K326Pcl-MMAF 72 0.34
    LC-K107C-MMAF 24.8 LC-K107Pcl-MMAF 70 0.35
    HC-E258C-MMAF 24.9 HC-E258Pcl-MMAF 69 0.36
    HC-K360C-MMAF 26.8 HC-K360Pcl-MMAF 83 0.32
    aAnalytical HIC: Tosoh Bioscience (King of Prussia, PA, USA) TSKgel Butyl-NPR column (100 mm × 4.6 mm, 2.5 μm), running buffer A: 50 mM sodium phosphate, 1.5M ammonium sulfate, pH 7.0; buffer B: 50 mM sodium phosphate, pH 7.0; gradient consisted of 5 min holding at 100% A, followed by a linear gradient of 20 to 100% B over 40 min; monitored by UV absorption at 280 nm.
    bSemi-prep HIC: Tosoh Bioscience (King of Prussia, PA, USA), TSKgel Phenyl-5PW, 13 μm, 21 × 150 mm; running buffer A: 1.5M ammonium sulfate in 20 mM NaPi (pH 7.4); buffer B: 20% isopropanol in 20 mM NaPi (pH 7.4); flow rate 5 ml/min; linear gradient from 20% to 80% buffer B over 90 mins; monitored by UV absorption at 280 nm.
  • Analytical HIC Protocol in Detail:
  • Analytical HIC data for trastuzumab Cys-MMAF ADCs were collected using a Tosoh Bioscience (King of Prussia, Pa., USA) TSKgel Butyl-NPR column (100 mm×4.6 mm, 2.5 μm) installed on a Dionex UltiMate 3000 HPLC (Sunnyvale, Calif., USA). The method consisted of a binary gradient of buffer A (50 mM sodium phosphate, 1.5 M ammonium sulfate, pH 7.0) and buffer B (50 mM sodium phosphate, pH 7.0). Samples were prepared by diluting approximately 50 μg of antibody (PBS) with an equal volume of 3 M ammonium sulfate. The gradient consisted of 5 min holding at 100% A, followed a linear gradient of 20 to 100% B over 40 min and finally re-equilibrating at initial conditions for 10 min prior to the next injection. The separation was monitored by UV absorption at 280 nm.
  • Preparation and Characterization of DAR 4, 6 and 8 Cys ADCs
  • Cys mutations can be combined for the preparation of DAR 4, 6 and 8 ADCs. In general, the preferred combination is a combination of two Cys mutations resulting in ADCs with DAR 4. Some examples that involve combining a heavy chain (HC) Cys mutant with a light chain (LC) Cys mutant for the preparation of DAR 4 ADCs are shown in Example 10 for trastuzumab and for antibody 14090. Additional data is provided in Table 26. Based on the HIC data and the inspection of attachment sites in the IgG crystal structures, additional Cys combinations were prepared using the protocols described in Examples 2, 5 and 6. Data for selected examples of MMAF ADCs are shown in Table 26. In addition, selected heavy chain sites were combined and double Cys mutations of the heavy chain were cloned following protocols listed in Example 2. Antibodies featuring two HC Cys mutations were prepared and conjugated following protocols described in Example 5 and 6.
  • For the preparation of DAR 4 ADCs, combinations include single site mutations listed in Table 24. Combinations of single sites resulted in ADCs with low hydrophobicity (Table 25). In the some combination, one Cys mutation is located in the CH1 domain or on the light chain and the second site is located in the CH3 domain. Examples of such combinations are antibodies featuring Cys mutant combinations of HC-E152C and HC-S375C, and LC-E165C and HC-S375C, and HC-E152C and HC-K334C, and LC-E165C and HC-K334C.
  • ADCs with DAR 6 and 8 can also be prepared when three or four Cys mutations are combined in one antibody. Selected heavy chain combinations were combined for the preparations of DAR 4, 6 and 8 ADCs. Double and triple Cys mutations of the heavy chain were cloned following protocols listed in Example 2. Antibodies featuring two, three and four Cys mutations were prepared and conjugated following protocols described in Example 5 and 6. The characteristics of some DAR 4, DAR 6 and DAR 8 ADC examples are summarized in Table 26. Some of these ADCs have surprisingly good PK properties as shown in FIG. 25. Antibody 14090 is mouse cross-reactive and therefore, antibody 14090 ADCs, as expected, are cleared more rapidly than trastuzumab ADCs which do not bind to any mouse antigens.
  • Combinations include those with three and four of the single site mutations listed in Table 24. Combinations include those sites that resulted in ADCs with low hydrophobicity (Table 25). Combinations include one Cys mutation is located in the CH1 domain or on the light chain (LC), and optionally an additional one to three sites are in the CH3 domain. Examples of such combinations include antibodies featuring Cys mutant combinations of HC-E152C or LC-E165C, with HC-S375C, with HC-K334C, and/or HC-K392C. Preferred combinations for the preparation of DAR 6 and DAR 8 ADCs are shown in Table 27 and Table 28 respectively.
  • With a few of exceptions, attachment of MMAF at all Cys sites studied results in ADCs with high thermal stability (Example 7, Table 19), low propensity to aggregate (Example 6, Table 18) and good pharmacokinetic properties of DAR 2 ADCs (Example 9, Table 22, FIG. 18). Differences in ADC hydrophobicity apparently do not translate into large differences in biophysical and pharmacokinetic properties when a relatively soluble payload such as MMAF is used. In fact, as is shown above, DAR 4, DAR 6 and DAR 8 MMAF ADCs with acceptable pharmacokinetic properties can be prepared even using exposed, “hydrophobic” sites such as HC-K360C in combination with more preferred attachment sites. However, when less well behaved, more hydrophobic payloads are used, carefully selecting attachment sites that result in minimal changes in hydrophobicity may be essential to allow the preparation of non-aggregating ADCs with good pharmacokinetic properties. For such hydrophobic payloads, using combination of sites that reduce hydrophobicity increases might be beneficial when 4, 6 or 8 drugs are attached per antibody.
  • TABLE 26
    Characterization of selected DAR 4, 6 and 8 MMAF ADCs prepared
    with combinations of Cys mutations.
    AUC
    % MMAF/
    Multimer AUC
    Cys-MMAF ADC name DAR AnSEC hIgG
    trastuzumab-HC-E258C-LC-S159C- 4.0 n.d. 0.9
    MMAF
    trastuzumab-HC-S375C-LC-S159C- 4.0 n.d. 0.8
    MMAF
    trastuzumab-HC-E258C-LC-E165C- 4.0 n.d. 0.9
    MMAF
    trastuzumab-HC-S375C-LC-E165C- 4.0 n.d. 0.8
    MMAF
    trastuzumab-HC-E152C-LC-R142C- 3.8 n.d. 0.9
    MMAF
    trastuzumab-HC-P171C-LC-R142C- 3.8 0.1 1.1
    MMAF
    trastuzumab-HC-E152C-LC-S159C- 3.8 n/a 0.7
    MMAF
    Antibody 14090-HC-S375C-LC- 4.0 n.d. 0.9
    A143C-MMAF
    Antibody 14090-HC-K360C-LC- 4.0 n.d. 1.0
    V159C-MMAF
    Antibody 14090-HC-S375C-LC- 4.0 2.9 1.0
    V159C-MMAF
    trastuzumab-HC-K334C-S375C-LC- 6.0 n.d. 0.8
    E165C-MMAF
    trastuzumab-HC-K334C-K392C-LC- 5.8 11 0.4
    E165C-MMAF
    trastuzumab-HC-K334C-K360C- 8.0 5 0.6
    S375C-LC-E165C-MMAF
    trastuzumab-HC-K334C-K360C- 7.8 n.d. 0.8
    K392C-LC-E165C-MMAF
    trastuzumab-HC-K334C-S375C- 8.0 n.d. 0.7
    K392C-LC-E165C-MMAF
    *AUC calculations based on mouse PK measurements with anti-MMAF and anti-IgG ELISA assays.
    n.d.; not detected, below limited of quantitation.
  • TABLE 27
    Preferred combinations of Cys sites for the preparation of DAR 6 ADCs.
    ADC
    combination Site
    1 Site 2 Site 3
    1 HC-E152C HC-S375C HC-K392C
    2 HC-E152C HC-S375C HC-K334C
    3 HC-E152C HC-K334C HC-K392C
    4 LC-E165C HC-S375C HC-K392C
    5 LC-E165C HC-S375C HC-K334C
    6 LC-E165C HC-K334C HC-K392C
  • TABLE 28
    Preferred combinations of Cys sites for the preparation of DAR 8 ADCs.
    ADC
    combination Site
    1 Site 2 Site 3 Site 4
    1 HC-E152C HC-S375C HC-K334C HC-K392C
    2 HC-E152C HC-S375C HC-E333C HC-K392C
    3 LC-E165C HC-S375C HC-K334C HC-K392C
    4 LC-E165C HC-S375C HC-E333C HC-K392C
  • Example 12 In Vivo Efficacy Studies of Trastuzumab Cys-MMAF ADCs
  • In vivo xenograft tumor models simulate biological activity observed iby grafting relevant and well characterized human primary tumors or tumor cell lines into immune-deficient nude mice. Studies on treatment of tumor xenograft mice with anti-cancer reagents have provided valuable information regarding in vivo efficacy of the tested reagents (Sausville and Burger, 2006). Since MDA-MB231 clone 16 cells were sensitive to trastuzumab Cys-MMAF ADCs in antigen dependent manner (FIG. 15), the cell line was chosen as the in vivo model to evaluate the trastuzumab Cys-MMAF ADCs. All animal studies were conducted in accordance with the Guide for the Care and Use of Laboratory Animals (NIH publication; National Academy Press, 8th edition, 2001). MDA-MB231 clone 16 cells were implanted in nu/nu mice subcutaneously (Morton and Houghton, 2007). After the tumor size reached ˜200 mm3, trastuzumab Cys-MMAF ADCs were administered into the mice by IV injection in a single dose at 3 mg/kg. The tumor growth was measured weekly after ADC injection. Each treatment group included 9 mice. An example of the in vivo efficacy study is indicated in FIG. 22 with three trastuzumab Cys-MMAF ADCs. Treatment of mice with 3 mg/kg trastuzumab Cys-MMAF ADCs caused tumor regression for all three tested Cys-MMAF ADCs (FIG. 22). No weight loss was observed associated with the ADC treatment. The results confirmed that with a single dose treatment at 3 mg/kg, trastuzumab Cys-MMAF ADCs effectively caused regression of MDA-MB231 clone 16 tumors.

Claims (21)

1-57. (canceled)
58. An immunoconjugate comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment comprises a substitution of one or more amino acids with cysteine:
a. on its constant region at a site selected from positions 121, 124, 152, 171, 174, 258, 292, 333, 334, 360, 375, and 392 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system;
b. on its constant region at a site selected from positions 107, 108, 142, 145, 159, 161, and 165 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain;
c. on its constant region at a site selected from positions 143, 147, 159, 163, and 168 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is human a lambda light chain;
d. on its constant region selected from positions 117, 119, 121, 124, 139, 152, 153, 155, 157, 164, 169, 171, 174, 189, 205, 207, 246, 258, 269, 274, 286, 288, 290, 292, 293, 320, 322, 326, 333, 334, 335, 337, 344, 355, 360, 375, 382, 390, 392, 398, 400 and 422 of the heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system;
e. on its constant region selected from positions 107, 108, 109, 114, 129, 142, 143, 145, 152, 154, 156, 159, 161, 165, 168, 169, 170, 182, 183, 197, 199, and 203 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is a human kappa light chain; or
f. selected from positions 143, 145, 147, 156, 159, 163, 168 on its constant region of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is a human lambda light chain.
59. The immunoconjugate of claim 58, wherein said antibody or antibody fragment comprises a sequence selected from:
a. the group consisting of SEQ ID NOs: 4, 5, 10, 17, 18, 29, 35, 42, 43, 48, 50, 54, 290, 291, 292, 293, 294, and 295;
b. the group consisting of SEQ ID NOs: 61, 62, 69, 71, 75, 76, and 77; or
c. the group consisting of SEQ ID NOs: 92, 94, 96, 97, and 98.
60. The immunoconjugate according to claim 58, wherein said modified antibody or antibody fragment comprises a combination of substitutions of two or more amino acids with cysteine:
a. on a constant region of a heavy chain at positions 152 and 375, wherein said positions are numbered according to the EU system;
b. on a constant region of a heavy chain at positions 327 and 375, wherein said positions are numbered according to the EU system;
c. on a constant region at position 107 of a light chain and position 360 of a heavy chain, wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system;
d. on a constant region at position 375 of a heavy chain and position 165 of a light chain, wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system; or
e. on a constant region at position 334 of a heavy chain and at position 165 of a light chain, wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
61. The immunoconjugate of claim 58 comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment thereof comprises a combination of substitution of three or more amino acids with cysteine on its constant regions wherein the combinations comprise substitutions selected from:
a. positions 375 and 392 of an antibody heavy chain and position 165 of an antibody light chain;
b. positions 334 and 375 of an antibody heavy chain and position 165 of an antibody light chain; and
c. positions 334 and 392 of an antibody heavy chain and position 165 of an antibody light chain;
d. positions 152, 375 and 392 of the an antibody heavy chain,
e. positions 152, 334 and 375 of an antibody heavy chain, and
f. positions 152, 334 and 392 of an antibody heavy chain,
wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
62. The immunoconjugate of claim 58 comprising a modified antibody or antibody fragment thereof, wherein said modified antibody or antibody fragment thereof comprises a combination of substitution of four or more amino acids with cysteine:
a. on its constant region at positions 334, 375, and 392 of a heavy chain and position 165 of a light chain,
b. on its constant region at positions 333, 375, and 392 of a heavy chain and at position 165 of a light chain;
c. on its constant region at positions 152, 334, 375, and 392 of a heavy chain; or
d. on its constant region at positions 152, 333, 375, and 392 of a heavy chain;
wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
63. The immunoconjugates of claim 58 wherein the drug antibody ratio is about 4, about 6, or about 8.
64. The immunoconjugate of claim 58 further comprising a drug moiety.
65. The immunoconjugate of claim 64, wherein the drug moiety is attached to the modified antibody or antibody fragment through the sulfur of said cysteine and an optional linker.
66. The immunoconjugate of claim 65, wherein said drug moiety is connected to said sulfur of said cysteine through a cleavable or non-cleavable linker.
67. The immunoconjugate of claim 65, wherein said immunoconjugate comprises a thiol-maleimide linkage, a —S—CH2—C(═O)— linkage or a disulfide linkage.
68. The immunoconjugate of claim 65, wherein said drug moiety is a cytotoxic agent.
69. The immunoconjugate of claim 68, wherein said drug moiety is selected from the group consisting of taxanes, DNA-alkylating agents (e.g., CC-1065 analogs), anthracyclines, tubulysin analogs, duocarmycin analogs, auristatins, and maytansinoids.
70. The immunoconjugate of claim 58, wherein said antibody is a monoclonal antibody, a chimeric antibody, a humanized antibody, a fully humanized antibody, a bispecific antibody, or a multi-specific antibody.
71. The immunoconjugate of claim 58, wherein said antibody or antibody fragment specifically binds to a cell surface marker characteristic of a tumor.
72. A pharmaceutical composition comprising the immunoconjugate of claim 1.
73. A modified antibody or antibody fragment thereof comprising a substitution of one or more amino acids with cysteine on its constant region selected from:
a. positions 117, 119, 121, 124, 139, 152, 153, 155, 157, 164, 169, 171, 174, 189, 205, 207, 246, 258, 269, 274, 286, 288, 290, 292, 293, 320, 322, 326, 333, 334, 335, 337, 344, 355, 360, 375, 382, 390, 392, 398, 400, and 422 of a heavy chain of said antibody or antibody fragment, and wherein said positions are numbered according to the EU system;
b. positions 107, 108, 109, 114, 129, 142, 143, 145, 152, 154, 156, 159, 161, 165, 168, 169, 170, 182, 183, 197, 199, and 203 of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the EU system, and wherein said light chain is human kappa light chain;
c. positions 143, 145, 147, 156, 159, 163, 168 on its constant region of a light chain of said antibody or antibody fragment, wherein said positions are numbered according to the Kabat system, and wherein said light chain is human lambda light chain.
74. The modified antibody or antibody fragment of claim 73, wherein the substitution is selected from:
a. positions 152 and 375 of a heavy chain;
b. positions 327 and 375 of a heavy chain;
c. position 107 of a light chain and position 360 of a heavy chain;
d. position 375 of a heavy chain and position 165 of a light chain;
e. at position 334 of a heavy chain and position 165 of a light chain;
f. positions 375 and 392 of a heavy chain and position 165 of a light chain;
g. positions 334 and 375 of a heavy chain and position 165 of a light chain;
h. positions 334 and 392 of a heavy chain and position 165 of a light chain;
i. positions 152, 375 and 392 of a heavy chain;
j. positions 152, 334 and 375 of a heavy chain;
k. positions 152, 334 and 392 of an antibody heavy chain;
l. positions 334, 375, and 392 of a heavy chain and position 165 of a light chain,
m. positions 333, 375, and 392 of a heavy chain and at position 165 of a light chain;
n. at positions 152, 334, 375, and 392 of a heavy chain; or
o. at positions 152, 333, 375, and 392 of a heavy chain;
wherein said light chain is a kappa chain, and wherein said positions are numbered according to the EU system.
75. A nucleic acid encoding the modified antibody or antibody fragment of claim 73.
76. A host cell comprising the nucleic acid of claim 75.
77. A method of producing a modified antibody or antibody fragment comprising incubating the host cell of claim 76 under suitable conditions for expressing the antibody or antibody fragment, and isolating said antibody or antibody fragment.
US14/764,026 2013-02-08 2014-02-07 Specific sites for modifying antibodies to make immunoconjugates Abandoned US20160067351A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/764,026 US20160067351A1 (en) 2013-02-08 2014-02-07 Specific sites for modifying antibodies to make immunoconjugates

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US201361762563P 2013-02-08 2013-02-08
PCT/US2014/015393 WO2014124316A2 (en) 2013-02-08 2014-02-07 Specific sites for modifying antibodies to make immunoconjugates
US14/764,026 US20160067351A1 (en) 2013-02-08 2014-02-07 Specific sites for modifying antibodies to make immunoconjugates

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2014/015393 A-371-Of-International WO2014124316A2 (en) 2013-02-08 2014-02-07 Specific sites for modifying antibodies to make immunoconjugates

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/701,576 Continuation US11596695B2 (en) 2013-02-08 2019-12-03 Specific sites for modifying antibodies to make immunoconjugates

Publications (1)

Publication Number Publication Date
US20160067351A1 true US20160067351A1 (en) 2016-03-10

Family

ID=50179939

Family Applications (3)

Application Number Title Priority Date Filing Date
US14/764,026 Abandoned US20160067351A1 (en) 2013-02-08 2014-02-07 Specific sites for modifying antibodies to make immunoconjugates
US16/701,576 Active 2035-02-11 US11596695B2 (en) 2013-02-08 2019-12-03 Specific sites for modifying antibodies to make immunoconjugates
US18/178,886 Pending US20230270876A1 (en) 2013-02-08 2023-03-06 Specific sites for modifying antibodies to make immunoconjugates

Family Applications After (2)

Application Number Title Priority Date Filing Date
US16/701,576 Active 2035-02-11 US11596695B2 (en) 2013-02-08 2019-12-03 Specific sites for modifying antibodies to make immunoconjugates
US18/178,886 Pending US20230270876A1 (en) 2013-02-08 2023-03-06 Specific sites for modifying antibodies to make immunoconjugates

Country Status (19)

Country Link
US (3) US20160067351A1 (en)
EP (2) EP2953976B1 (en)
JP (1) JP6609477B2 (en)
KR (3) KR102626525B1 (en)
CN (2) CN105143271A (en)
AU (2) AU2014214751B2 (en)
BR (1) BR112015018899B1 (en)
CA (1) CA2900755C (en)
DK (1) DK2953976T3 (en)
EA (1) EA201591465A1 (en)
ES (1) ES2874493T3 (en)
HU (1) HUE054443T2 (en)
IL (1) IL240406B (en)
MX (2) MX2015010146A (en)
PL (1) PL2953976T3 (en)
PT (1) PT2953976T (en)
SG (2) SG10201706468RA (en)
SI (1) SI2953976T1 (en)
WO (1) WO2014124316A2 (en)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20160015831A1 (en) * 2014-06-20 2016-01-21 Bioalliance C.V. Anti-cd22 antibody-drug conjugates and methods of using thereof
US20160015827A1 (en) * 2014-06-20 2016-01-21 Bioalliance C.V. Anti-folate receptor alpha (fra) antibody-drug conjugates and methods of using thereof
WO2017112624A1 (en) 2015-12-21 2017-06-29 Bristol-Myers Squibb Company Variant antibodies for site-specific conjugation
US9943610B2 (en) 2012-12-21 2018-04-17 Bioalliance C.V. Hydrophilic self-immolative linkers and conjugates thereof
KR20190065374A (en) * 2016-10-08 2019-06-11 쓰촨 바이리 팜 컴퍼니, 리미티드 Cysteine modified antibody-drug conjugate and method for producing the same
US10472422B2 (en) 2016-01-08 2019-11-12 Abgenomics International Inc. Tetravalent anti-PSGL-1 antibodies and uses thereof
US10675358B2 (en) 2016-07-07 2020-06-09 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
US20210292391A1 (en) * 2020-02-28 2021-09-23 Genzyme Corporation Modified binding polypeptides for optimized drug conjugation
US20220175947A1 (en) * 2017-02-28 2022-06-09 Seagen Inc. Cysteine mutated antibodies for conjugation
US11364303B2 (en) * 2017-09-29 2022-06-21 Pfizer Inc. Cysteine engineered antibody drug conjugates
WO2022152289A1 (en) * 2021-01-18 2022-07-21 Wuxi Biologics (Shanghai) Co., Ltd. An engineered antibody and antibody-drug conjugates comprisign same
US11400164B2 (en) 2019-03-15 2022-08-02 Bolt Biotherapeutics, Inc. Immunoconjugates targeting HER2
WO2023076599A1 (en) * 2021-10-29 2023-05-04 Bolt Biotherapeutics, Inc. Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof
EP4406555A3 (en) * 2018-12-21 2024-11-06 Novartis AG Antibodies to pmel17 and conjugates thereof

Families Citing this family (64)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3539982B1 (en) 2011-12-23 2025-02-19 Pfizer Inc. Engineered antibody constant regions for site-specific conjugation and methods and uses therefor
CA2900755C (en) * 2013-02-08 2021-07-20 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
PE20160674A1 (en) 2013-08-28 2016-07-21 Stemcentrx Inc METHODS OF CONJUGATION OF SITE-SPECIFIC ANTIBODIES AND COMPOSITIONS
BR112016010169A2 (en) 2013-11-06 2017-12-05 Stemcentrx Inc anticlaudin antibodies and methods of use
PE20160993A1 (en) 2013-12-12 2016-10-14 Abbvie Stemcentrx Llc NEW ANTI-DPEP3 ANTIBODIES AND METHODS OF USE
JP6636925B2 (en) 2013-12-17 2020-01-29 ノバルティス アーゲー Cytotoxic peptides and conjugates thereof
WO2015127407A1 (en) 2014-02-21 2015-08-27 Stemcentrx, Inc. Anti-dll3 antibodies and drug conjugates for use in melanoma
CN106659800A (en) * 2014-03-12 2017-05-10 诺华股份有限公司 Specific sites for modifying antibodies to make immunoconjugates
SMT201900160T1 (en) 2014-04-11 2019-05-10 Medimmune Llc Conjugated compounds comprising cysteine-engineered antibodies
SG10201913977TA (en) 2014-05-22 2020-03-30 Synthon Biopharmaceuticals Bv Site-specific conjugation of linker drugs to antibodies and resulting adcs
CN106659783A (en) * 2014-06-20 2017-05-10 艾比吉诺米克斯国际股份有限公司 Her2 antibody-drug conjugates
TW201617368A (en) 2014-09-05 2016-05-16 史坦森特瑞斯公司 Novel anti-MFI2 antibody and method of use
TW201625688A (en) * 2014-09-12 2016-07-16 建南德克公司 Cysteine engineered antibodies and conjugates
CN107406497A (en) 2014-12-19 2017-11-28 埃博灵克斯股份有限公司 The nano antibody dimer of cysteine connection
EP3878861B1 (en) * 2015-02-16 2025-05-07 Lonza Ltd. Cl and/or ch1 mutated antibodies for drug conjugation
WO2016203432A1 (en) 2015-06-17 2016-12-22 Novartis Ag Antibody drug conjugates
SG11201802769RA (en) 2015-10-29 2018-05-30 Novartis Ag Antibody conjugates comprising toll-like receptor agonist
TWI703160B (en) * 2015-11-30 2020-09-01 美商輝瑞股份有限公司 Antibodies and antibody fragments for site-specific conjugation
US10689458B2 (en) * 2015-11-30 2020-06-23 Pfizer Inc. Site specific HER2 antibody drug conjugates
US20180271998A1 (en) 2015-12-04 2018-09-27 Merrimack Pharmaceuticals, Inc. Disulfide-stabilized fabs
EP3525826B1 (en) 2016-10-11 2020-07-22 Byondis B.V Non-linear self-immolative linkers and conjugates thereof
EP3525828B1 (en) 2016-10-17 2024-12-25 Pfizer Inc. Anti-edb antibodies and antibody-drug conjugates
US11865135B2 (en) * 2016-12-07 2024-01-09 Innate Biotherapeutics, Llc ß-1,6-glucan therapeutic antibody conjugates
CN110099697B (en) 2016-12-21 2023-11-28 诺华股份有限公司 Antibody-drug conjugates for ablation of hematopoietic stem cells
JOP20190187A1 (en) 2017-02-03 2019-08-01 Novartis Ag Anti-ccr7 antibody drug conjugates
CN116785450A (en) 2017-02-28 2023-09-22 伊缪诺金公司 Maytansinoid derivatives with self-cleaving peptide linker and conjugates thereof
JOP20190245A1 (en) * 2017-04-20 2019-10-15 Novartis Ag Sustained release delivery systems comprising traceless linkers
AR113224A1 (en) * 2017-04-28 2020-02-19 Novartis Ag ANTIBODY CONJUGATES INCLUDING A STING AGONIST
AR111651A1 (en) 2017-04-28 2019-08-07 Novartis Ag CONJUGATES OF ANTIBODIES THAT INCLUDE TOLL TYPE RECEIVER AGONISTS AND COMBINATION THERAPIES
EP3638699A1 (en) * 2017-06-16 2020-04-22 Eli Lilly and Company Engineered antibody compounds and conjugates thereof
CN108743968B (en) * 2017-06-20 2022-04-19 成都百利多特生物药业有限责任公司 Cysteine engineered antibody-toxin conjugate (TDC) site-directed conjugation site screening
JP7117088B2 (en) * 2017-08-04 2022-08-12 シスメックス株式会社 Antibody, method for producing same, and method for improving thermal stability of antibody
US11623963B2 (en) 2017-10-03 2023-04-11 Merck Patent Gmbh Cysteine engineered antigen-binding molecules
AU2019277029C1 (en) 2018-06-01 2024-01-04 Novartis Ag Binding molecules against BCMA and uses thereof
UY38265A (en) 2018-06-20 2020-01-31 Novartis Ag DRUG ANTIBODY CONJUGATES FOR ABLATION OF HEMATOPOIETIC STEM CELLS
US20230053449A1 (en) 2018-10-31 2023-02-23 Novartis Ag Dc-sign antibody drug conjugates
WO2020089815A1 (en) 2018-10-31 2020-05-07 Novartis Ag Antibody conjugates comprising sting agonist
CN117843795A (en) * 2019-03-11 2024-04-09 凯惠科技发展(上海)有限公司 Cysteine-containing antibody, drug conjugate and application thereof
CA3138058A1 (en) 2019-05-20 2020-11-26 Matthew T. Burger Mcl-1 inhibitor antibody-drug conjugates and methods of use
US20230091510A1 (en) 2019-05-20 2023-03-23 Novartis Ag Antibody drug conjugates having linkers comprising hydrophilic groups
KR20220079590A (en) 2019-10-04 2022-06-13 티에이이 라이프 사이언시스 Antibody compositions comprising Fc mutations and site-specific conjugation properties
US20230181756A1 (en) 2020-04-30 2023-06-15 Novartis Ag Ccr7 antibody drug conjugates for treating cancer
WO2022115451A1 (en) 2020-11-24 2022-06-02 Novartis Ag Mcl-1 inhibitor antibody-drug conjugates and methods of use
CR20230283A (en) 2020-11-24 2023-07-27 Novartis Ag ANTI-CD48 ANTIBODIES, ANTIBODY-DRUG CONJUGATES, AND USES THEREOF
AU2021386367A1 (en) 2020-11-24 2023-06-22 Les Laboratoires Servier Bcl-xl inhibitor antibody-drug conjugates and methods of use thereof
JP2024506590A (en) 2021-02-16 2024-02-14 グリコス・フィンランド・オーワイ Linker - payload and its conjugates
WO2022221720A1 (en) 2021-04-16 2022-10-20 Novartis Ag Antibody drug conjugates and methods for making thereof
PE20251072A1 (en) 2022-05-20 2025-04-10 Novartis Ag Antibody-drug conjugates of antineoplastic compounds and methods of using them
EP4525926A1 (en) 2022-05-20 2025-03-26 Novartis AG Met bcl-xl inhibitor antibody-drug conjugates and methods of use thereof
JP2025517430A (en) 2022-05-20 2025-06-05 ノバルティス アーゲー EPHA2 BCL-XL INHIBITOR ANTIBODY-DRUG CONJUGATES AND METHODS OF USE THEREOF
CN120187743A (en) * 2022-11-08 2025-06-20 西湖大学 Polypeptide tags, compositions and methods for site-specific coupling of proteins
WO2024129756A1 (en) 2022-12-13 2024-06-20 Seagen Inc. Site-specific engineered cysteine antibody drug conjugates
CN120752058A (en) 2023-03-10 2025-10-03 诺华股份有限公司 PanRAS inhibitor antibody-drug conjugates and methods of use thereof
CN118837542A (en) * 2023-04-24 2024-10-25 菲鹏生物股份有限公司 Antibodies and antibody conjugates and uses thereof
KR20260026054A (en) 2023-06-13 2026-02-25 애드센트릭스 테라퓨틱스 잉크. Methods and compositions relating to antibodies and antibody drug conjugates (ADCs) that bind to nectin-4 protein
WO2025019790A1 (en) 2023-07-19 2025-01-23 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with trop-2 targeting adc
CN119375471A (en) * 2023-07-26 2025-01-28 菲鹏生物股份有限公司 Antibodies and antibody conjugates and their uses
TW202513593A (en) * 2023-09-08 2025-04-01 大陸商信達生物製藥(蘇州)有限公司 Cysteine engineered antibody and immunoconjugate
PY24103486A (en) 2023-11-22 2025-06-06 Servier Lab ANTI-CD74 ANTIBODY-DRUG CONJUGATES AND METHODS OF USE THEREOF
TW202540186A (en) 2023-11-22 2025-10-16 瑞士商諾華公司 Anti-cd7 antibody-drug conjugates and methods of use thereof
WO2025264533A1 (en) 2024-06-17 2025-12-26 Adcentrx Therapeutics Inc. Methods and compositions related to antibody drug conjugates (adcs) that bind steap-1 proteins
WO2026006689A2 (en) 2024-06-28 2026-01-02 Firefly Bio, Inc. Bcl-xl degrader antibody conjugates and uses thereof
EP4706675A1 (en) * 2024-09-10 2026-03-11 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Cysteine-engineered chimeric antigen receptor
EP4706676A1 (en) * 2024-09-10 2026-03-11 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Cysteine-engineered antigen-binding domains

Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060039904A1 (en) * 2004-08-16 2006-02-23 Medimmune, Inc. EPH receptor Fc variants with enhanced antibody dependent cell-mediated cytotoxicity activity
WO2006034488A2 (en) * 2004-09-23 2006-03-30 Genentech, Inc. Cysteine engineered antibodies and conjugates
US20080050310A1 (en) * 2006-05-30 2008-02-28 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
US20080311134A1 (en) * 2007-05-08 2008-12-18 Junutula Jagath R Cysteine engineered anti-muc16 antibodies and antibody drug conjugates
US20100158909A1 (en) * 2006-12-01 2010-06-24 Seattle Genetics, Inc. Variant Target Binding Agents and Uses Thereof
US20110033378A1 (en) * 2008-01-18 2011-02-10 Medlmmune, Llc. Cysteine Engineered Antibodies For Site-Specific Conjugation
US20110135667A1 (en) * 2007-07-16 2011-06-09 Genentech, Inc. Anti-cd79b antibodies and immunoconjugates and methods of use
US20110301334A1 (en) * 2010-06-08 2011-12-08 Sunil Bhakta Cysteine engineered antibodies and conjugates
US20120121615A1 (en) * 2010-11-17 2012-05-17 Flygare John A Alaninyl maytansinol antibody conjugates
US20120213705A1 (en) * 2009-06-22 2012-08-23 Medimmune, Llc ENGINEERED Fc REGIONS FOR SITE-SPECIFIC CONJUGATION
US20130017200A1 (en) * 2009-12-04 2013-01-17 Genentech, Inc. Multispecific antibodies, antibody analogs, compositions, and methods
US20130066054A1 (en) * 2009-11-17 2013-03-14 Ucb Pharma S.A. Multivalent antibodies
US20130330350A1 (en) * 2010-11-09 2013-12-12 Medimmune, Llc Antibody Scaffold For Homogenous Conjugation
US20160008485A1 (en) * 2011-12-23 2016-01-14 Pfizer Inc. Engineered Antibody Constant Regions for Site-Specific Conjugation and Methods and Uses Therefor
US9884817B2 (en) * 2014-06-13 2018-02-06 Novartis Ag Auristatin derivatives and conjugates thereof
US9938323B2 (en) * 2014-11-06 2018-04-10 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of RNA polymerase
US9988420B2 (en) * 2013-12-17 2018-06-05 Novartis Ag Cytotoxic peptides and conjugates thereof

Family Cites Families (97)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US2429008A (en) 1945-12-01 1947-10-14 Diamond Chain & Mfg Company Sprocket or gear
US2429001A (en) 1946-12-28 1947-10-14 Axel H Stone Artificial hand
DE3378250D1 (en) 1982-04-22 1988-11-24 Ici Plc Continuous release formulations
US4522811A (en) 1982-07-08 1985-06-11 Syntex (U.S.A.) Inc. Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides
US5128326A (en) 1984-12-06 1992-07-07 Biomatrix, Inc. Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same
US5374548A (en) 1986-05-02 1994-12-20 Genentech, Inc. Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor
MX9203291A (en) 1985-06-26 1992-08-01 Liposome Co Inc LIPOSOMAS COUPLING METHOD.
EP0307434B2 (en) 1987-03-18 1998-07-29 Scotgen Biopharmaceuticals, Inc. Altered antibodies
US4880078A (en) 1987-06-29 1989-11-14 Honda Giken Kogyo Kabushiki Kaisha Exhaust muffler
GB8720833D0 (en) 1987-09-04 1987-10-14 Celltech Ltd Recombinant dna product
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5108921A (en) 1989-04-03 1992-04-28 Purdue Research Foundation Method for enhanced transmembrane transport of exogenous molecules
AU6430190A (en) 1989-10-10 1991-05-16 Pitman-Moore, Inc. Sustained release composition for macromolecular proteins
WO1991006287A1 (en) 1989-11-06 1991-05-16 Enzytech, Inc. Protein microspheres and methods of using them
ATE221379T1 (en) 1991-05-01 2002-08-15 Jackson H M Found Military Med METHOD FOR TREATING INFECTIOUS RESPIRATORY DISEASES
CA2116774C (en) 1991-09-19 2003-11-11 Paul J. Carter Expression in e. coli antibody fragments having at least a cysteine present as a free thiol. use for the production of bifunctional f(ab') 2 antibodies
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US5912015A (en) 1992-03-12 1999-06-15 Alkermes Controlled Therapeutics, Inc. Modulated release from biocompatible polymers
CA2076465C (en) 1992-03-25 2002-11-26 Ravi V. J. Chari Cell binding agent conjugates of analogues and derivatives of cc-1065
CA2118508A1 (en) 1992-04-24 1993-11-11 Elizabeth S. Ward Recombinant production of immunoglobulin-like domains in prokaryotic cells
US5934272A (en) 1993-01-29 1999-08-10 Aradigm Corporation Device and method of creating aerosolized mist of respiratory drug
JPH08511420A (en) 1993-06-16 1996-12-03 セルテック・セラピューテイクス・リミテッド Body
US5837458A (en) 1994-02-17 1998-11-17 Maxygen, Inc. Methods and compositions for cellular and metabolic engineering
US5834252A (en) 1995-04-18 1998-11-10 Glaxo Group Limited End-complementary polymerase reaction
US5605793A (en) 1994-02-17 1997-02-25 Affymax Technologies N.V. Methods for in vitro recombination
US6132764A (en) 1994-08-05 2000-10-17 Targesome, Inc. Targeted polymerized liposome diagnostic and treatment agents
GB9422383D0 (en) 1994-11-05 1995-01-04 Wellcome Found Antibodies
DE4444135B4 (en) 1994-12-11 2005-06-02 Gerold Tebbe Oxygen treatment facility
ATE252894T1 (en) 1995-01-05 2003-11-15 Univ Michigan SURFACE-MODIFIED NANOPARTICLES AND METHODS FOR THEIR PRODUCTION AND USE
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6019968A (en) 1995-04-14 2000-02-01 Inhale Therapeutic Systems, Inc. Dispersible antibody compositions and methods for their preparation and use
AU710347B2 (en) 1995-08-31 1999-09-16 Alkermes Controlled Therapeutics, Inc. Composition for sustained release of an agent
AU2063197A (en) 1996-03-04 1997-09-22 Massachusetts Institute Of Technology Materials and methods for enhancing cellular internalization
US5985309A (en) 1996-05-24 1999-11-16 Massachusetts Institute Of Technology Preparation of particles for inhalation
US5874064A (en) 1996-05-24 1999-02-23 Massachusetts Institute Of Technology Aerodynamically light particles for pulmonary drug delivery
US5855913A (en) 1997-01-16 1999-01-05 Massachusetts Instite Of Technology Particles incorporating surfactants for pulmonary drug delivery
US6056973A (en) 1996-10-11 2000-05-02 Sequus Pharmaceuticals, Inc. Therapeutic liposome composition and method of preparation
ES2236832T3 (en) 1997-01-16 2005-07-16 Massachusetts Institute Of Technology PREPARATION OF PARTICLES FOR INHALATION.
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
WO1998052976A1 (en) 1997-05-21 1998-11-26 Biovation Limited Method for the production of non-immunogenic proteins
JP3614866B2 (en) 1997-06-12 2005-01-26 リサーチ コーポレイション テクノロジーズ,インコーポレイティド Artificial antibody polypeptide
RU2141483C1 (en) 1997-07-04 1999-11-20 Небольсин Владимир Евгеньевич Peptide derivatives or their pharmaceutically acceptable salts, method of their synthesis, use and pharmaceutical composition
US5989463A (en) 1997-09-24 1999-11-23 Alkermes Controlled Therapeutics, Inc. Methods for fabricating polymer-based controlled release devices
SE512663C2 (en) 1997-10-23 2000-04-17 Biogram Ab Active substance encapsulation process in a biodegradable polymer
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
AU3657899A (en) 1998-04-20 1999-11-08 James E. Bailey Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
CA2336139C (en) 1998-06-24 2008-10-14 Advanced Inhalation Research, Inc. Large porous particles emitted from an inhaler
KR100940380B1 (en) 1999-01-15 2010-02-02 제넨테크, 인크. Polypeptide Variants with Altered Effector Function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US6897044B1 (en) 1999-01-28 2005-05-24 Biogen Idec, Inc. Production of tetravalent antibodies
PT1176195E (en) 1999-04-09 2013-07-18 Kyowa Hakko Kirin Co Ltd Method for controlling the activity of immunologically functional molecule
ES2276708T3 (en) 1999-11-24 2007-07-01 Immunogen, Inc. CYTOTOXIC AGENTS UNDERSTANDING TAXANS AND THERAPEUTIC USE.
ES2274823T3 (en) 1999-12-29 2007-06-01 Immunogen, Inc. COTOTOXIC AGENTS THAT INCLUDE DOXORRUBICINAS AND DAUNORRUBICINAS AND ITS THERAPEUTIC USE.
US20050271663A1 (en) 2001-06-28 2005-12-08 Domantis Limited Compositions and methods for treating inflammatory disorders
KR100988949B1 (en) 2001-10-25 2010-10-20 제넨테크, 인크. Glycoprotein Composition
US20090068178A1 (en) 2002-05-08 2009-03-12 Genentech, Inc. Compositions and Methods for the Treatment of Tumor of Hematopoietic Origin
BRPI0411475A (en) 2003-06-18 2006-07-25 Scripps Research Inst unnatural reactive amino acid genetic code additions
AU2004273791A1 (en) 2003-09-05 2005-03-31 Genentech, Inc. Antibodies with altered effector functions
US20060166319A1 (en) 2004-08-13 2006-07-27 Chan Michael K Charging tRNA with pyrrolysine
US20060183888A1 (en) 2004-08-13 2006-08-17 Chan Michael K Pyrrolysine synthesis and modification
US20100111856A1 (en) 2004-09-23 2010-05-06 Herman Gill Zirconium-radiolabeled, cysteine engineered antibody conjugates
US7442778B2 (en) 2004-09-24 2008-10-28 Amgen Inc. Modified Fc molecules
WO2007024249A2 (en) 2004-11-10 2007-03-01 Macrogenics, Inc. Engineering fc antibody regions to confer effector function
WO2008020827A2 (en) 2005-08-01 2008-02-21 Biogen Idec Ma Inc. Altered polypeptides, immunoconjugates thereof, and methods related thereto
US8008453B2 (en) 2005-08-12 2011-08-30 Amgen Inc. Modified Fc molecules
AU2006287416A1 (en) 2005-09-07 2007-03-15 Medimmune, Llc Toxin conjugated Eph receptor antibodies
JPWO2008032833A1 (en) 2006-09-14 2010-01-28 株式会社医学生物学研究所 Antibody with enhanced ADCC activity and method for producing the same
AU2007308792B2 (en) 2006-10-27 2013-01-24 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
WO2008114011A2 (en) 2007-03-19 2008-09-25 Medimmune Limited Fc polypeptide variants obtained by ribosome display methodology
CN101803362A (en) * 2007-09-10 2010-08-11 Nxp股份有限公司 Method and apparatus for motion estimation and motion compensation in video image data
AU2008312457B2 (en) 2007-10-19 2014-04-17 Genentech, Inc. Cysteine engineered anti-TENB2 antibodies and antibody drug conjugates
WO2010009124A2 (en) * 2008-07-15 2010-01-21 Genentech, Inc. Anthracycline derivative conjugates, process for their preparation and their use as antitumor compounds
US8785151B2 (en) 2008-10-24 2014-07-22 Bernhard Geierstanger Biosynthetically generated pyrroline-carboxy-lysine and site specific protein modifications via chemical derivatization of pyrroline-carboxy-lysine and pyrrolysine residues
BRPI1012560A2 (en) * 2009-04-01 2016-07-26 Genentech Inc anti-fcrh5 and immunoconjugate antibodies and methods of use
CN101709047A (en) 2009-05-25 2010-05-19 华东理工大学 Chemical complete synthesis method for 22nd natural amino acid-pyrrolysine
PT2437785E (en) * 2009-06-04 2015-04-20 Novartis Ag Methods for identification of sites for igg conjugation
EP2451838A1 (en) 2009-07-09 2012-05-16 f-star Biotechnologische Forschungs- und Entwicklungsges.m.b.H. Stabilized immunoglobulin constant domains
GB0920324D0 (en) * 2009-11-19 2010-01-06 Ucb Pharma Sa Antibodies
WO2011118739A1 (en) * 2010-03-26 2011-09-29 協和発酵キリン株式会社 Novel antibody having modification site introduced therein, and antibody fragment
GB201014033D0 (en) 2010-08-20 2010-10-06 Ucb Pharma Sa Biological products
PT2794905T (en) * 2011-12-20 2020-06-30 Medimmune Llc Modified polypeptides for bispecific antibody scaffolds
US20140065590A1 (en) 2012-02-20 2014-03-06 Knowre Korea Inc Method, system, and computer-readable recording medium for providing education service based on knowledge units
SG11201407017WA (en) 2012-06-04 2014-12-30 Irm Llc Site-specific labeling methods and molecules produced thereby
JP6498600B2 (en) * 2012-06-08 2019-04-10 ストロ バイオファーマ インコーポレーテッド Antibodies containing site-specific unnatural amino acid residues, methods for their preparation, and methods for their use
CA2900755C (en) * 2013-02-08 2021-07-20 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014124258A2 (en) 2013-02-08 2014-08-14 Irm Llc Specific sites for modifying antibodies to make immunoconjugates
WO2014165277A2 (en) 2013-03-12 2014-10-09 Amgen Inc. POTENT AND SELECTIVE INHIBITORS OF Nav1.7
WO2014151030A1 (en) 2013-03-15 2014-09-25 Novartis Ag Cell proliferation inhibitors and conjugates thereof
CN106659800A (en) 2014-03-12 2017-05-10 诺华股份有限公司 Specific sites for modifying antibodies to make immunoconjugates
WO2016020791A1 (en) * 2014-08-05 2016-02-11 Novartis Ag Ckit antibody drug conjugates
SG11201802769RA (en) * 2015-10-29 2018-05-30 Novartis Ag Antibody conjugates comprising toll-like receptor agonist
CN110099697B (en) * 2016-12-21 2023-11-28 诺华股份有限公司 Antibody-drug conjugates for ablation of hematopoietic stem cells
JOP20190187A1 (en) * 2017-02-03 2019-08-01 Novartis Ag Anti-ccr7 antibody drug conjugates
PH12021551479A1 (en) * 2018-12-21 2022-07-18 Novartis Ag Antibodies to pmel17 and conjugates thereof
US11605302B2 (en) 2020-11-10 2023-03-14 Rockwell Collins, Inc. Time-critical obstacle avoidance path planning in uncertain environments

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060039904A1 (en) * 2004-08-16 2006-02-23 Medimmune, Inc. EPH receptor Fc variants with enhanced antibody dependent cell-mediated cytotoxicity activity
WO2006034488A2 (en) * 2004-09-23 2006-03-30 Genentech, Inc. Cysteine engineered antibodies and conjugates
US7521541B2 (en) * 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7855275B2 (en) * 2004-09-23 2010-12-21 Genentech, Inc. Cysteine engineered antibodies and conjugates
US20080050310A1 (en) * 2006-05-30 2008-02-28 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
US20100158909A1 (en) * 2006-12-01 2010-06-24 Seattle Genetics, Inc. Variant Target Binding Agents and Uses Thereof
US20080311134A1 (en) * 2007-05-08 2008-12-18 Junutula Jagath R Cysteine engineered anti-muc16 antibodies and antibody drug conjugates
US20110135667A1 (en) * 2007-07-16 2011-06-09 Genentech, Inc. Anti-cd79b antibodies and immunoconjugates and methods of use
US20110033378A1 (en) * 2008-01-18 2011-02-10 Medlmmune, Llc. Cysteine Engineered Antibodies For Site-Specific Conjugation
US20120213705A1 (en) * 2009-06-22 2012-08-23 Medimmune, Llc ENGINEERED Fc REGIONS FOR SITE-SPECIFIC CONJUGATION
US20130066054A1 (en) * 2009-11-17 2013-03-14 Ucb Pharma S.A. Multivalent antibodies
US20130017200A1 (en) * 2009-12-04 2013-01-17 Genentech, Inc. Multispecific antibodies, antibody analogs, compositions, and methods
US20110301334A1 (en) * 2010-06-08 2011-12-08 Sunil Bhakta Cysteine engineered antibodies and conjugates
US20130330350A1 (en) * 2010-11-09 2013-12-12 Medimmune, Llc Antibody Scaffold For Homogenous Conjugation
US20120121615A1 (en) * 2010-11-17 2012-05-17 Flygare John A Alaninyl maytansinol antibody conjugates
US20160008485A1 (en) * 2011-12-23 2016-01-14 Pfizer Inc. Engineered Antibody Constant Regions for Site-Specific Conjugation and Methods and Uses Therefor
US9988420B2 (en) * 2013-12-17 2018-06-05 Novartis Ag Cytotoxic peptides and conjugates thereof
US9884817B2 (en) * 2014-06-13 2018-02-06 Novartis Ag Auristatin derivatives and conjugates thereof
US9938323B2 (en) * 2014-11-06 2018-04-10 Novartis Ag Amatoxin derivatives and conjugates thereof as inhibitors of RNA polymerase

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
Lund et al., The Journal of Immunology 157:4963-4969, 1996. *
Rudikoff et al., PNAS 79: 1979-1983 (Year: 1982) *
Strop et al., Chemistry & Biology 20: 161-167, 2013. *
Teicher et al., Clin Cancer Res 17(20): 6389-97, 2011. *
Wu et al., J Mol Biol 294: 151-162 (Year: 1999) *

Cited By (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9943610B2 (en) 2012-12-21 2018-04-17 Bioalliance C.V. Hydrophilic self-immolative linkers and conjugates thereof
US20160015827A1 (en) * 2014-06-20 2016-01-21 Bioalliance C.V. Anti-folate receptor alpha (fra) antibody-drug conjugates and methods of using thereof
US9950077B2 (en) * 2014-06-20 2018-04-24 Bioalliance C.V. Anti-folate receptor alpha (FRA) antibody-drug conjugates and methods of using thereof
US20160015831A1 (en) * 2014-06-20 2016-01-21 Bioalliance C.V. Anti-cd22 antibody-drug conjugates and methods of using thereof
WO2017112624A1 (en) 2015-12-21 2017-06-29 Bristol-Myers Squibb Company Variant antibodies for site-specific conjugation
US10472422B2 (en) 2016-01-08 2019-11-12 Abgenomics International Inc. Tetravalent anti-PSGL-1 antibodies and uses thereof
US11547761B1 (en) 2016-07-07 2023-01-10 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
US11110178B2 (en) 2016-07-07 2021-09-07 The Board Of Trustees Of The Leland Standford Junior University Antibody adjuvant conjugates
US10675358B2 (en) 2016-07-07 2020-06-09 The Board Of Trustees Of The Leland Stanford Junior University Antibody adjuvant conjugates
KR102579211B1 (en) * 2016-10-08 2023-09-15 쓰촨 바이리 파마슈티칼 컴퍼니, 리미티드 Cysteine modified antibody-drug conjugate and preparation method thereof
EP3524273A4 (en) * 2016-10-08 2020-07-15 Sichuan Baili Pharm Co., Ltd. CYSTEIN-MODIFIED ANTIBODY-ACTIVE SUBSTANCE CONJUGATE AND PRODUCTION METHOD THEREFOR
RU2762594C2 (en) * 2016-10-08 2021-12-21 Сычуань Байли Фарм Ко., Лтд. “cysteine-modified antibody-drug” conjugate and its production method
KR102480873B1 (en) * 2016-10-08 2022-12-26 쓰촨 바이리 파마슈티칼 컴퍼니, 리미티드 Cysteine modified antibody-drug conjugate and its preparation method
KR20230003663A (en) * 2016-10-08 2023-01-06 쓰촨 바이리 파마슈티칼 컴퍼니, 리미티드 Cysteine modified antibody-drug conjugate and preparation method thereof
KR20190065374A (en) * 2016-10-08 2019-06-11 쓰촨 바이리 팜 컴퍼니, 리미티드 Cysteine modified antibody-drug conjugate and method for producing the same
US20220175947A1 (en) * 2017-02-28 2022-06-09 Seagen Inc. Cysteine mutated antibodies for conjugation
US11938194B2 (en) * 2017-02-28 2024-03-26 Seagen Inc. Cysteine mutated antibodies for conjugation
US11364303B2 (en) * 2017-09-29 2022-06-21 Pfizer Inc. Cysteine engineered antibody drug conjugates
EP4406555A3 (en) * 2018-12-21 2024-11-06 Novartis AG Antibodies to pmel17 and conjugates thereof
US11400164B2 (en) 2019-03-15 2022-08-02 Bolt Biotherapeutics, Inc. Immunoconjugates targeting HER2
US11879004B2 (en) * 2020-02-28 2024-01-23 Genzyme Corporation Modified binding polypeptides for optimized drug conjugation
US20240218051A1 (en) * 2020-02-28 2024-07-04 Genzyme Corporation Modified binding polypeptides for optimized drug conjugation
US20210292391A1 (en) * 2020-02-28 2021-09-23 Genzyme Corporation Modified binding polypeptides for optimized drug conjugation
WO2022152289A1 (en) * 2021-01-18 2022-07-21 Wuxi Biologics (Shanghai) Co., Ltd. An engineered antibody and antibody-drug conjugates comprisign same
WO2023076599A1 (en) * 2021-10-29 2023-05-04 Bolt Biotherapeutics, Inc. Tlr agonist immunoconjugates with cysteine-mutant antibodies, and uses thereof

Also Published As

Publication number Publication date
MX2022010324A (en) 2022-09-19
US11596695B2 (en) 2023-03-07
BR112015018899A2 (en) 2015-08-06
MX2015010146A (en) 2016-05-31
DK2953976T3 (en) 2021-06-21
EP2953976A2 (en) 2015-12-16
CA2900755A1 (en) 2014-08-14
JP6609477B2 (en) 2019-11-20
KR20150115000A (en) 2015-10-13
BR112015018899B1 (en) 2023-09-26
HK1213580A1 (en) 2016-07-08
AU2017219059A1 (en) 2017-09-14
PL2953976T3 (en) 2021-11-02
CN115925957A (en) 2023-04-07
JP2016511637A (en) 2016-04-21
HUE054443T2 (en) 2021-09-28
WO2014124316A3 (en) 2014-11-27
KR102626525B1 (en) 2024-01-19
SI2953976T1 (en) 2021-08-31
US20230270876A1 (en) 2023-08-31
IL240406A0 (en) 2015-09-24
CN105143271A (en) 2015-12-09
EP3929217A3 (en) 2022-03-02
ES2874493T3 (en) 2021-11-05
IL240406B (en) 2020-02-27
PT2953976T (en) 2021-06-23
KR102447350B1 (en) 2022-09-23
KR20210125593A (en) 2021-10-18
EA201591465A1 (en) 2015-12-30
US20200338207A1 (en) 2020-10-29
EP2953976B1 (en) 2021-03-24
AU2014214751B2 (en) 2017-06-01
KR20220133313A (en) 2022-10-04
WO2014124316A2 (en) 2014-08-14
SG10201706468RA (en) 2017-09-28
CA2900755C (en) 2021-07-20
AU2014214751A1 (en) 2015-08-20
EP3929217A2 (en) 2021-12-29
SG11201506025RA (en) 2015-08-28

Similar Documents

Publication Publication Date Title
US20230270876A1 (en) Specific sites for modifying antibodies to make immunoconjugates
US20170021033A1 (en) Specific sites for modifying antibodies to make immunoconjugates
JP7759130B2 (en) Anti-Axl antibodies, antibody fragments and immunoconjugates thereof and uses thereof
WO2014124258A2 (en) Specific sites for modifying antibodies to make immunoconjugates
CN105567717A (en) Antibody drug conjugates (ADC) that bind to 191P4D12 proteins
ES2930255T3 (en) Anti-Ror2 antibodies, antibody fragments, their immunoconjugates and uses thereof
US11779649B2 (en) Antibodies to PMEL17 and conjugates thereof
HK40066365A (en) Specific sites for modifying antibodies to make immunoconjugates
HK1213580B (en) Specific sites for modifying antibodies to make immunoconjugates
EA043810B1 (en) SPECIFIC AREAS FOR MODIFYING ANTIBODIES TO PRODUCE IMMUNOCONJUGATES
KR20240040786A (en) Biopharmaceutical compositions and stable isotope labeled peptide mapping methods
HK1207987B (en) Anti-pmel17 antibodies and immunoconjugates
HK1207987A1 (en) Anti-pmel17 antibodies and immunoconjugates

Legal Events

Date Code Title Description
AS Assignment

Owner name: NOVARTIS INTERNATIONAL PHARMACEUTICAL LTD., BERMUD

Free format text: MERGER;ASSIGNOR:IRM LLC;REEL/FRAME:035444/0397

Effective date: 20150105

Owner name: NOVARTIS AG, SWITZERLAND

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NOVARTIS INTERNATIONAL PHARMACEUTICAL LTD.;REEL/FRAME:035453/0224

Effective date: 20150330

AS Assignment

Owner name: IRM LLC, BERMUDA

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NOVARTIS INSTITUTE FOR FUNCTIONAL GENOMICS, INC., DBA THE GENOMICS INSTITUTE OF THE NOVARTIS RESEARCH FOUNDATION (GNF);REEL/FRAME:038636/0500

Effective date: 20140303

Owner name: NOVARTIS INSTITUTE FOR FUNCTIONAL GENOMICS, INC.,

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:GEIERSTANGER, BERNHARD HUBERT;OU, WEIJIA;UNO, TETSUO;SIGNING DATES FROM 20140205 TO 20140220;REEL/FRAME:038635/0905

STPP Information on status: patent application and granting procedure in general

Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER

STPP Information on status: patent application and granting procedure in general

Free format text: FINAL REJECTION MAILED

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION