US20150368302A1 - Designed ankyrin repeat proteins binding to platelet-derived growth factor - Google Patents
Designed ankyrin repeat proteins binding to platelet-derived growth factor Download PDFInfo
- Publication number
- US20150368302A1 US20150368302A1 US14/847,403 US201514847403A US2015368302A1 US 20150368302 A1 US20150368302 A1 US 20150368302A1 US 201514847403 A US201514847403 A US 201514847403A US 2015368302 A1 US2015368302 A1 US 2015368302A1
- Authority
- US
- United States
- Prior art keywords
- repeat
- seq
- pdgf
- binding
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 title abstract description 108
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 title description 17
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 title description 16
- 108010081589 Becaplermin Proteins 0.000 claims abstract description 115
- 108091008324 binding proteins Proteins 0.000 claims abstract description 96
- 102000008102 Ankyrins Human genes 0.000 claims description 158
- 108010049777 Ankyrins Proteins 0.000 claims description 158
- 102000023732 binding proteins Human genes 0.000 claims description 95
- 238000000034 method Methods 0.000 claims description 36
- 208000005590 Choroidal Neovascularization Diseases 0.000 claims description 14
- 206010060823 Choroidal neovascularisation Diseases 0.000 claims description 14
- 230000000694 effects Effects 0.000 claims description 6
- 206010064930 age-related macular degeneration Diseases 0.000 claims description 3
- 208000001309 degenerative myopia Diseases 0.000 claims description 3
- 230000004340 degenerative myopia Effects 0.000 claims description 3
- 208000002780 macular degeneration Diseases 0.000 claims description 3
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 claims 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims 1
- 108090000623 proteins and genes Proteins 0.000 abstract description 83
- 102000004169 proteins and genes Human genes 0.000 abstract description 76
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 15
- 201000010099 disease Diseases 0.000 abstract description 14
- 108020004707 nucleic acids Proteins 0.000 abstract description 10
- 102000039446 nucleic acids Human genes 0.000 abstract description 10
- 150000007523 nucleic acids Chemical class 0.000 abstract description 10
- 239000008194 pharmaceutical composition Substances 0.000 abstract description 9
- 102000014914 Carrier Proteins Human genes 0.000 abstract 1
- 235000001014 amino acid Nutrition 0.000 description 136
- 150000001413 amino acids Chemical class 0.000 description 128
- 108090000765 processed proteins & peptides Proteins 0.000 description 72
- 102000004196 processed proteins & peptides Human genes 0.000 description 68
- 235000018102 proteins Nutrition 0.000 description 68
- 229920001184 polypeptide Polymers 0.000 description 67
- 210000004899 c-terminal region Anatomy 0.000 description 44
- 125000003275 alpha amino acid group Chemical group 0.000 description 36
- 125000000539 amino acid group Chemical group 0.000 description 32
- 230000003993 interaction Effects 0.000 description 23
- 210000004027 cell Anatomy 0.000 description 22
- 241000282414 Homo sapiens Species 0.000 description 19
- 150000001875 compounds Chemical class 0.000 description 14
- 230000005764 inhibitory process Effects 0.000 description 13
- 229920000642 polymer Polymers 0.000 description 13
- 101000677856 Stenotrophomonas maltophilia (strain K279a) Actin-binding protein Smlt3054 Proteins 0.000 description 12
- 108020001580 protein domains Proteins 0.000 description 12
- 238000002965 ELISA Methods 0.000 description 11
- 241000588724 Escherichia coli Species 0.000 description 10
- 230000000975 bioactive effect Effects 0.000 description 10
- 238000005259 measurement Methods 0.000 description 9
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 9
- 238000003556 assay Methods 0.000 description 8
- 108020003175 receptors Proteins 0.000 description 8
- 102000005962 receptors Human genes 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 239000002202 Polyethylene glycol Substances 0.000 description 7
- 238000010494 dissociation reaction Methods 0.000 description 7
- 230000005593 dissociations Effects 0.000 description 7
- 210000002950 fibroblast Anatomy 0.000 description 7
- 230000001575 pathological effect Effects 0.000 description 7
- 229920001223 polyethylene glycol Polymers 0.000 description 7
- 238000002702 ribosome display Methods 0.000 description 7
- 108091035707 Consensus sequence Proteins 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- 238000004458 analytical method Methods 0.000 description 6
- 238000004925 denaturation Methods 0.000 description 6
- 230000036425 denaturation Effects 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 230000018109 developmental process Effects 0.000 description 6
- 239000003102 growth factor Substances 0.000 description 6
- 230000002209 hydrophobic effect Effects 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 238000012216 screening Methods 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 5
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 238000005516 engineering process Methods 0.000 description 5
- 230000002401 inhibitory effect Effects 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 230000035755 proliferation Effects 0.000 description 5
- 238000000746 purification Methods 0.000 description 5
- 230000011664 signaling Effects 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical group N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 4
- 229920001612 Hydroxyethyl starch Polymers 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 235000018417 cysteine Nutrition 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 239000013613 expression plasmid Substances 0.000 description 4
- 229940050526 hydroxyethylstarch Drugs 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 108010017843 platelet-derived growth factor A Proteins 0.000 description 4
- 230000004850 protein–protein interaction Effects 0.000 description 4
- 210000001525 retina Anatomy 0.000 description 4
- 239000012146 running buffer Substances 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 238000000954 titration curve Methods 0.000 description 4
- 239000003981 vehicle Substances 0.000 description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 108060003951 Immunoglobulin Proteins 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 208000017442 Retinal disease Diseases 0.000 description 3
- 102000007562 Serum Albumin Human genes 0.000 description 3
- 108010071390 Serum Albumin Proteins 0.000 description 3
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 3
- 229960000723 ampicillin Drugs 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000010367 cloning Methods 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 239000012636 effector Substances 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 230000003176 fibrotic effect Effects 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 230000006870 function Effects 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 102000018358 immunoglobulin Human genes 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 108010087904 neutravidin Proteins 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 3
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 3
- 238000010839 reverse transcription Methods 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- 238000002424 x-ray crystallography Methods 0.000 description 3
- DJQYYYCQOZMCRC-UHFFFAOYSA-N 2-aminopropane-1,3-dithiol Chemical compound SCC(N)CS DJQYYYCQOZMCRC-UHFFFAOYSA-N 0.000 description 2
- 102000016904 Armadillo Domain Proteins Human genes 0.000 description 2
- 108010014223 Armadillo Domain Proteins Proteins 0.000 description 2
- 201000001320 Atherosclerosis Diseases 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 241000289632 Dasypodidae Species 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 2
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 108091008606 PDGF receptors Proteins 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 2
- 102100037596 Platelet-derived growth factor subunit A Human genes 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 210000001775 bruch membrane Anatomy 0.000 description 2
- 230000009787 cardiac fibrosis Effects 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000002983 circular dichroism Methods 0.000 description 2
- 238000000978 circular dichroism spectroscopy Methods 0.000 description 2
- 208000019425 cirrhosis of liver Diseases 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 239000000287 crude extract Substances 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 206010061989 glomerulosclerosis Diseases 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 235000003642 hunger Nutrition 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 238000000111 isothermal titration calorimetry Methods 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000000649 photocoagulation Effects 0.000 description 2
- 108010017992 platelet-derived growth factor C Proteins 0.000 description 2
- 239000000047 product Substances 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 208000005069 pulmonary fibrosis Diseases 0.000 description 2
- 208000002815 pulmonary hypertension Diseases 0.000 description 2
- 208000037803 restenosis Diseases 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000002864 sequence alignment Methods 0.000 description 2
- JUJBNYBVVQSIOU-UHFFFAOYSA-M sodium;4-[2-(4-iodophenyl)-3-(4-nitrophenyl)tetrazol-2-ium-5-yl]benzene-1,3-disulfonate Chemical compound [Na+].C1=CC([N+](=O)[O-])=CC=C1N1[N+](C=2C=CC(I)=CC=2)=NC(C=2C(=CC(=CC=2)S([O-])(=O)=O)S([O-])(=O)=O)=N1 JUJBNYBVVQSIOU-UHFFFAOYSA-M 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000013076 target substance Substances 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 208000019553 vascular disease Diseases 0.000 description 2
- 108010000834 2-5A-dependent ribonuclease Proteins 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- UPXRTVAIJMUAQR-UHFFFAOYSA-N 4-(9h-fluoren-9-ylmethoxycarbonylamino)-1-[(2-methylpropan-2-yl)oxycarbonyl]pyrrolidine-2-carboxylic acid Chemical compound C1C(C(O)=O)N(C(=O)OC(C)(C)C)CC1NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 UPXRTVAIJMUAQR-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 108010011170 Ala-Trp-Arg-His-Pro-Gln-Phe-Gly-Gly Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 240000003291 Armoracia rusticana Species 0.000 description 1
- 235000011330 Armoracia rusticana Nutrition 0.000 description 1
- 101710189812 Bilin-binding protein Proteins 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 239000012624 DNA alkylating agent Substances 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 101710198884 GATA-type zinc finger protein 1 Proteins 0.000 description 1
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 1
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 101001027128 Homo sapiens Fibronectin Proteins 0.000 description 1
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 description 1
- 102000019298 Lipocalin Human genes 0.000 description 1
- 108050006654 Lipocalin Proteins 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101001026869 Mus musculus F-box/LRR-repeat protein 3 Proteins 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010029113 Neovascularisation Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 208000022873 Ocular disease Diseases 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 241000255969 Pieris brassicae Species 0.000 description 1
- 102100040681 Platelet-derived growth factor C Human genes 0.000 description 1
- 102100040682 Platelet-derived growth factor D Human genes 0.000 description 1
- 101710170209 Platelet-derived growth factor D Proteins 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 101900161471 Pseudomonas aeruginosa Exotoxin A Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- BGDKAVGWHJFAGW-UHFFFAOYSA-N Tropicamide Chemical compound C=1C=CC=CC=1C(CO)C(=O)N(CC)CC1=CC=NC=C1 BGDKAVGWHJFAGW-UHFFFAOYSA-N 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000004931 aggregating effect Effects 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000012911 assay medium Substances 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 230000006287 biotinylation Effects 0.000 description 1
- 238000007413 biotinylation Methods 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000000747 cardiac effect Effects 0.000 description 1
- 108010079058 casein hydrolysate Proteins 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000007398 colorimetric assay Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000002296 dynamic light scattering Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 230000007705 epithelial mesenchymal transition Effects 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000007045 gastrulation Effects 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 210000002149 gonad Anatomy 0.000 description 1
- 238000003505 heat denaturation Methods 0.000 description 1
- 230000011132 hemopoiesis Effects 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 238000010191 image analysis Methods 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000012804 iterative process Methods 0.000 description 1
- 229960004184 ketamine hydrochloride Drugs 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 210000004901 leucine-rich repeat Anatomy 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000030248 negative regulation of fibroblast proliferation Effects 0.000 description 1
- 210000000933 neural crest Anatomy 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000011197 physicochemical method Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 108010000685 platelet-derived growth factor AB Proteins 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920001451 polypropylene glycol Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 238000011533 pre-incubation Methods 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 150000003141 primary amines Chemical class 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 238000003157 protein complementation Methods 0.000 description 1
- 239000013636 protein dimer Substances 0.000 description 1
- 210000001747 pupil Anatomy 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 238000007670 refining Methods 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 210000002356 skeleton Anatomy 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000007858 starting material Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 231100000167 toxic agent Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 229960004791 tropicamide Drugs 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 230000007998 vessel formation Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/10—Ophthalmic agents for accommodation disorders, e.g. myopia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/14—Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/49—Platelet-derived growth factor [PDGF]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
Definitions
- the present invention relates to designed ankyrin repeat proteins with binding specificity for platelet-derived growth factor (PDGF), as well as nucleic acids encoding such PDGF binding proteins, pharmaceutical compositions comprising such proteins and the use of such proteins in the treatment of diseases.
- PDGF platelet-derived growth factor
- Platelet-derived growth factor was identified more than three decades ago as a serum growth factor for fibroblasts, smooth muscle cells and glia cells. Its role in physiology and medicine is extensively described in a recent review (Andrae, J., Gallini, R. and Betsholtz, C., Genes Dev., 22, 1276-1312, 2008).
- Human PDGF was originally identified as a disulfide-linked dimer of two different polypeptide chains, A (PDGF-A; human PDGF-A has the UniProtKB/Swiss-Prot number P04085) and B (PDGF-B; human PDGF-B has the UniProtKB/Swiss-Prot number P01127).
- PDGF-AA PDGF-AA
- PDGF-AB PDGF-AB
- PDGF-BB PDGF-BB
- PDGF-C PDGF-D
- VEGFs vascular endothelial growth factors
- PDGFs act via two receptor tyrosine kinases (RTKs), PDGF receptor (PDGFR) alpha (PDGFRalpha) and beta (PDGFRbeta), with common domain structures, including five extracellular immunoglobulin (Ig) loops and a split intracellular tyrosine kinase domain.
- RTKs receptor tyrosine kinases
- PDGFRalpha PDGF receptor alpha
- beta PDGFRbeta
- the VEGFs act through a distinct but structurally related subfamily of RTKs.
- Ligand binding promotes receptor dimerization, which initiates signaling. Depending on ligand configuration and the pattern of receptor expression, different receptor dimers may form. However, only a few interactions seem to be relevant in vivo; i.e., those of PDGF-AA and PDGF-CC via PDGFRalpha, and PDGF-BB via PDGFRbeta.
- the PDGFs have crucial roles during development, but there is limited evidence for normal physiological functions in the adult.
- Studies of PDGFs and PDGFRs in animal development have revealed roles for PDGFRalpha signaling in gastrulation and in the development of the cranial and cardiac neural crest, gonads, lung, intestine, skin, CNS, and skeleton.
- roles for PDGFRbeta signaling have been established in blood vessel formation and early hematopoiesis.
- PDGF signaling is implicated in a range of diseases. Autocrine activation of PDGF signaling pathways is involved in certain gliomas, sarcomas, and leukemias.
- Paracrine PDGF signaling is commonly observed in epithelial cancers, where it triggers stromal recruitment and may be involved in epithelial—mesenchymal transition, thereby affecting tumor growth, angiogenesis, invasion, and metastasis.
- PDGFs drive pathological mesenchymal responses in vascular disorders such as atherosclerosis, restenosis, pulmonary hypertension, and retinal diseases, as well as in fibrotic diseases, including pulmonary fibrosis, liver cirrhosis, scleroderma, glomerulosclerosis, and cardiac fibrosis.
- PDGF activity has been linked with several diseases and pathological conditions.
- Causal pathogenic roles of the PDGFs have been established for some diseases, providing prospects for therapy using PDGF antagonists, such as PDGF specific antibodies.
- PDGF antagonists such as PDGF specific antibodies.
- anti-VEGF and anti-PDGF agents affords synergistic therapeutic benefits for treating certain ocular neovascular diseases (WO 2005/020972; Jo, N., Mailhos, C., Ju, M., Cheung, E., Bradley, J., Nishijima, K., Robinson, G. S., Adamis, A. P. and Shima, D. T., Am. J. Pathol., 168(6), 2036-2053, 2006).
- novel binding proteins or binding domains that can be used to specifically bind a target molecule (e.g. Binz, H. K., Amstutz, P. and Plückthun, A., Nat. Biotechnol. 23, 1257-1268, 2005) and thereby act as an antagonist.
- One such novel class of binding proteins or binding domains not possessing an Fc are based on designed repeat proteins or designed repeat domains (WO 2002/020565; Binz, H. K., Amstutz, P., Kohl, A., Stumpp, M. T., Briand, C., Forrer, P., Grütter, M. G., and Plückthun, A., Nat. Biotechnol.
- WO 2002/020565 describes how large libraries of repeat proteins can be constructed and their general application. Nevertheless, WO 2002/020565 does neither disclose the selection of repeat domains with binding specificity for PDGF-BB nor concrete repeat modules or repeat sequence motifs of repeat domains that specifically bind to PDGF-BB. Furthermore, WO 2002/020565 does not suggest that repeat domains with binding specificity for PDGF-BB could be used to regulate the PDGF-BB mediated signaling pathways to successfully treat diseases.
- These designed repeat domains harness the modular nature of repeat proteins and may possess N-terminal and C-terminal capping modules to prevent the designed repeat domains from aggregation by shielding the hydrophobic core of the domain (Forrer, P., Stumpp, M. T., Binz, H. K. and Plückthun, A., FEBS letters 539, 2-6, 2003).
- the technical problem underlying the present invention is identifying novel binding proteins, such as ankyrin repeat proteins or domains, with binding specificity to PDGF-BB to regulate PDGF-BB mediated signaling pathways for an improved treatment of certain cancers, vascular disorders such as retinal diseases, fibrotic diseases and other pathological conditions.
- novel binding proteins such as ankyrin repeat proteins or domains
- the present invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain, wherein said ankyrin repeat domain binds PDGF-BB in PBS with a Kd below 10 ⁇ 7 M.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain, wherein said ankyrin repeat domain competes for binding to PDGF-BB with an ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60, or wherein said ankyrin repeat domain is selected from the group consisting of SEQ ID NOs:23 to 60 wherein G at position 1 and/or S at position 2 of said ankyrin repeat domain are optionally missing; and L at the second last position and/or N at the last position of said ankyrin repeat domain are optionally exchanged by A.
- the invention relates to a recombinant PDGF-BB binding protein comprising at least one ankyrin repeat domain, which comprises an ankyrin repeat module having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 14, 15, 17, 18 and 19 and sequences, wherein up to 9 amino acids in SEQ ID NO: 12, 14, 15, 17, 18 and 19 are exchanged by any amino acid.
- the invention relates to a recombinant PDGF-BB binding protein comprising a peptide of any one of the sequences SEQ ID NO: 12 to 19 and 23 to 61.
- the invention further relates to nucleic acid molecules encoding the binding proteins of the present invention, and to a pharmaceutical composition comprising one or more of the above mentioned binding proteins or nucleic acid molecules.
- the invention further relates to a method of treatment of a pathological condition using the binding proteins of the invention.
- FIG. 1 Inhibition of NHI-3T3 Fibroblast Proliferation
- OD optical density at 450 nm
- C concentration of DARPin #49 in nM
- D DARPin #49.
- the X axis is shown in logarithmic scale. See below for the definition of DARPin #49.
- FIG. 2 PDGFRbeta Competition Assay.
- IC 50 values were then calculated to be about 20 and 18 pM for the DARPins #50 (D1) and #28 (D2), respectively.
- OD optical density at 450 nm;
- C concentration of DARPins in pM.
- the X axis is shown in logarithmic scale. See below for the definitions of DARPin #50 and 28.
- FIG. 3 Effects of an Anti-PDGF-BB DARPin vs Vehicle on the Development of Choroidal Neovascularization.
- mice were daily injected intraperitoneal with vehicle or DARPin #61-PEG20 (i.e. DARPin #61 conjugated to PEG20 over its C-terminal Cys residues by standards means (e.g. as described in WO 2011/135067)) from day 0 until day 14.
- DARPin #61-PEG20 i.e. DARPin #61 conjugated to PEG20 over its C-terminal Cys residues by standards means (e.g. as described in WO 2011/135067)
- CNV choroidal neovascularization
- Symbols represent individual eyes and represent mean values of three induced CNV spots each. Bars represent median values of the individual groups.
- A Area of CNV in mm 2 ;
- V vehicle (i.e. PBS); D1, DARPin #61-PEG20 in PBS at a 10 mg/kg per dose injected; D2, DARPin #61-PEG20 in PBS at a 1 mg/kg per dose injected
- the recombinant binding protein or domain according to the invention is specific for a mammalian PDGF-BB.
- the recombinant binding domain according to the invention is specific for a PDGF-BB of mice, rat, dog, rabbit, monkey or human origin. More preferably, the recombinant binding domain according to the invention is specific for a PDGF-BB of human origin.
- protein refers to a polypeptide, wherein at least part of the polypeptide has, or is able to acquire a defined three-dimensional arrangement by forming secondary, tertiary, or quaternary structures within and/or between its polypeptide chain(s). If a protein comprises two or more polypeptides, the individual polypeptide chains may be linked non-covalently or covalently, e.g. by a disulfide bond between two polypeptides. A part of a protein, which individually has, or is able to acquire, a defined three-dimensional arrangement by forming secondary or tertiary structures, is termed “protein domain”. Such protein domains are well known to the practitioner skilled in the art.
- recombinant as used in recombinant protein, recombinant protein domain, recombinant binding protein and the like, means that said polypeptides are produced by the use of recombinant DNA technologies well known by the practitioner skilled in the relevant art.
- a recombinant DNA molecule e.g. produced by gene synthesis
- a bacterial expression plasmid e.g. pQE30, Qiagen
- yeast expression plasmid e.g. pQE30, Qiagen
- mammalian expression plasmid e.g. pQE30, Qiagen
- yeast expression plasmid e.g. pQE30, Qiagen
- mammalian expression plasmid e.g. pQE30, Qiagen
- yeast expression plasmid e.g. pQE30, Qiagen
- mammalian expression plasmid e.g. pQE
- polypeptide relates to a molecule consisting of one or more chains of multiple, i.e. two or more, amino acids linked via peptide bonds.
- a polypeptide consists of more than eight amino acids linked via peptide bonds.
- polypeptide tag refers to an amino acid sequence attached to a polypeptide/protein, wherein said amino acid sequence is useful for the purification, detection, or targeting of said polypeptide/protein, or wherein said amino acid sequence improves the physicochemical behavior of the polypeptide/protein, or wherein said amino acid sequence possesses an effector function.
- the individual polypeptide tags, moieties and/or domains of a binding protein may be connected to each other directly or via polypeptide linkers. These polypeptide tags are all well known in the art and are fully available to the person skilled in the art. Examples of polypeptide tags are small polypeptide sequences, for example, His (e.g.
- His-tag of SEQ ID NO:9 myc, FLAG, or Strep-tags or moieties such as enzymes (for example enzymes like alkaline phosphatase), which allow the detection of said polypeptide/protein, or moieties which can be used for targeting (such as immunoglobulins or fragments thereof) and/or as effector molecules.
- enzymes for example enzymes like alkaline phosphatase
- moieties which can be used for targeting such as immunoglobulins or fragments thereof
- polypeptide linker refers to an amino acid sequence, which is able to link, for example, two protein domains, a polypeptide tag and a protein domain, a protein domain and a non-polypeptide moiety such as polyethylene glycol or two sequence tags.
- additional domains, tags, non-polypeptide moieties and linkers are known to the person skilled in the relevant art.
- linkers are glycine-serine-linkers and proline-threonine-linkers of variable lengths; preferably, said linkers have a length between 2 and 24 amino acids; more preferably, said linkers have a length between 2 and 16 amino acids.
- SEQ ID NO:10 An example of a glycine-serine-linker is provided in SEQ ID NO:10 and an example of a proline-threonine-linker is provided in SEQ ID NO:11.
- the proline-threonine-linker of SEQ ID NO:11 is preceded by GS and/or followed by GS.
- polymer moiety refers to either a proteinaceous polymer moiety or a non-proteinaceous polymer moiety.
- a “proteinaceous polymer moiety” preferably is a polypeptide that does not form a stable tertiary structure.
- proteinaceous polymer moieties are XTEN® (a registered trademark of Amunix; WO 2007/103515) polypeptides, or polypeptides comprising proline, alanine and serine residues as described in WO 2008/155134.
- Such proteinaceous polymer moieties can be covalently attached to, for example, a binding domain of the invention by the generation of genetic fusion polypeptides using standard DNA cloning technologies, followed by their standard expression and purification.
- non-proteinaceous polymer moiety is a polymer moiety not built from polypeptides.
- non-proteinaceous polymer moieties are hydroxyethyl starch (HES), polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylene.
- HES hydroxyethyl starch
- PEG polyethylene glycol
- Ppropylene glycol polypropylene glycol
- polyoxyalkylene polyoxyalkylene.
- PEGylated means that a PEG moiety is covalently attached to, for example, a polypeptide of the invention.
- a polymer moiety of the invention may vary widely in molecular weight. Preferably, said polymer moiety is connected by a polypeptide linker to a binding domain.
- a PEG moiety or any other non-proteinaceous polymer can, e.g., be coupled to a cysteine thiol via a maleimide linker with the cysteine being coupled via a peptide linker to the N- or C-terminus of a binding domain as described herein.
- binding protein refers to a protein comprising one or more binding domains, one or more bioactive compounds and one or more polymer moieties as further explained below.
- said binding protein comprises up to four binding domains. More preferably, said binding protein comprises up to two binding domains. Most preferably, said binding protein comprises only one binding domain.
- any such binding protein may comprise additional protein domains that are not binding domains, multimerization moieties, polypeptide tags, polypeptide linkers and/or a single Cys residue.
- multimerization moieties are immunoglobulin heavy chain constant regions which pair to provide functional immunoglobulin Fc domains, and leucine zippers or polypeptides comprising a free thiol which forms an intermolecular disulfide bond between two such polypeptides.
- the single Cys residue may be used for conjugating other moieties to the polypeptide, for example, by using the maleimide chemistry well known to the person skilled in the art.
- said binding protein is a recombinant binding protein.
- the binding domains of binding protein possess different target specificities.
- bioactive compound refers to a compound that is disease modifying when applied to a mammal having said disease.
- a bioactive compound may have antagonistic or agonistic properties and can be a proteinaceous bioactive compound or a non-proteinaceous bioactive compound.
- Such proteinaceous bioactive compounds can be covalently attached to, for example, a binding domain of the invention by the generation of genetic fusion polypeptides using standard DNA cloning technologies, followed by their standard expression and purification.
- non-proteinaceous bioactive compounds can be covalently attached to, for example, a binding domain of the invention by chemical means, e.g., by coupling to a cysteine thiol via a maleimide linker with a cysteine being coupled via a peptide linker to the N- or C-terminus of a binding domain as described herein.
- proteinaceous bioactive compounds are binding domains having a distinct target specificity (e.g. neutralizing a growth factor by binding to it), cytokines (e.g. interleukins), growth factors (e.g. human growth hormone), antibodies and fragments thereof, hormones (e.g. GLP-1) and any possible proteinaceous drug.
- non-proteinaceous bioactive compounds are, toxins (e.g. DM1 from ImmunoGen), small molecules targeting GPCRs, antibiotics and any possible non-proteinaceous drug.
- binding domain means a protein domain exhibiting the same “fold” (three-dimensional arrangement) as a protein scaffold and having a predetermined property, as defined below.
- a binding domain may be obtained by rational, or most commonly, combinatorial protein engineering techniques, skills which are known in the art (Binz et al., 2005, loc. cit.).
- a binding domain having a predetermined property can be obtained by a method comprising the steps of (a) providing a diverse collection of protein domains exhibiting the same fold as a protein scaffold as defined further below; and (b) screening said diverse collection and/or selecting from said diverse collection to obtain at least one protein domain having said predetermined property.
- the diverse collection of protein domains may be provided by several methods in accordance with the screening and/or selection system being used, and may comprise the use of methods well known to the person skilled in the art, such as phage display or ribosome display.
- said binding domain is a recombinant binding domain.
- target refers to an individual molecule such as a nucleic acid molecule, a polypeptide or protein, a carbohydrate, or any other naturally occurring molecule, including any part of such individual molecule, or complexes of two or more of such molecules.
- the target may be a whole cell or a tissue sample, or it may be any non-natural molecule or moiety.
- the target is a naturally occurring or non-natural polypeptide or a polypeptide containing chemical modifications, for example modified by natural or non-natural phosphorylation, acetylation, or methylation.
- the target is PDGF-BB.
- predetermined property refers to a property such as binding to a target, blocking of a target, activation of a target-mediated reaction, enzymatic activity, and related further properties.
- a target e.g., binding to a target, blocking of a target, activation of a target-mediated reaction, enzymatic activity, and related further properties.
- said predetermined property is binding to a target.
- repeat proteins are based on those in patent application WO 2002/020565.
- Patent application WO 2002/020565 further contains a general description of repeat protein features, techniques and applications.
- repeat proteins refers to a protein comprising one or more repeat domains.
- each of said repeat proteins comprises up to four repeat domains. More preferably, each of said repeat proteins comprises up to two repeat domains. Most preferably, each of the repeat proteins comprises only one repeat domain.
- said repeat protein may comprise additional non-repeat protein domains, polypeptide tags and/or polypeptide linkers.
- repeat domain refers to a protein domain comprising two or more consecutive repeat units (modules) as structural units, wherein said structural units have the same fold, and stack tightly to create a superhelical structure having a joint hydrophobic core.
- a repeat domain further comprises an N-terminal and/or a C-terminal capping unit (or module). Even more preferably, said N-terminal and/or C-terminal capping units (or modules) are capping repeats.
- designed repeat protein and “designed repeat domain” refer to a repeat protein or repeat domain, respectively, obtained as the result of the inventive procedure explained in patent application WO 2002/020565.
- Designed repeat proteins and designed repeat domains are synthetic and not from nature. They are man-made proteins or domains, respectively, obtained by expression of correspondingly designed nucleic acids. Preferably, the expression is done in eukaryotic or prokaryotic cells, such as bacterial cells, or by using a cell-free in vitro expression system.
- a designed ankyrin repeat protein i.e. a DARPin
- structural unit refers to a locally ordered part of a polypeptide, formed by three-dimensional interactions between two or more segments of secondary structure that are near one another along the polypeptide chain. Such a structural unit exhibits a structural motif.
- structural motif refers to a three-dimensional arrangement of secondary structure elements present in at least one structural unit. Structural motifs are well known to the person skilled in the art. Structural units alone are not able to acquire a defined three-dimensional arrangement; however, their consecutive arrangement, for example as repeat modules in a repeat domain, leads to a mutual stabilization of neighboring units resulting in a superhelical structure.
- repeat unit refers to amino acid sequences comprising repeat sequence motifs of one or more naturally occurring repeat proteins, wherein said “repeat units” are found in multiple copies, and which exhibit a defined folding topology common to all said motifs determining the fold of the protein.
- Such repeat units correspond to the “repeating structural units (repeats)” of repeat proteins as described by Forrer et al., 2003, loc. cit. or the “consecutive homologous structural units (repeats)” of repeat proteins as described by Binz et al, 2004, loc. cit.
- Such repeat units comprise framework residues and interaction residues.
- repeat units examples include armadillo repeat units, leucine-rich repeat units, ankyrin repeat units, tetratricopeptide repeat units, HEAT repeat units, and leucine-rich variant repeat units.
- Naturally occurring proteins containing two or more such repeat units are referred to as “naturally occurring repeat proteins”.
- the amino acid sequences of the individual repeat units of a repeat protein may have a significant number of mutations, substitutions, additions and/or deletions when compared to each other, while still substantially retaining the general pattern, or motif, of the repeat units.
- ankyrin repeat unit shall mean a repeat unit, which is an ankyrin repeat as described, for example, by Forrer et al., 2003, loc. cit. Ankyrin repeats are well known to the person skilled in the art.
- the term “ankyrin repeat domain” refers to a repeat domain comprising two or more consecutive ankyrin repeat units (modules) as structural units, and, preferably, an N-terminal and/or a C-terminal capping unit (or module).
- frame residues relates to amino acid residues of the repeat units, or the corresponding amino acid residues of the repeat modules, which contribute to the folding topology, i.e. which contribute to the fold of said repeat unit (or module) or which contribute to the interaction with a neighboring unit (or module). Such contribution might be the interaction with other residues in the repeat unit (or module), or the influence on the polypeptide backbone conformation as found in ⁇ -helices or ⁇ -sheets, or amino acid stretches forming linear polypeptides or loops.
- target interaction residues refers to amino acid residues of the repeat units, or the corresponding amino acid residues of the repeat modules, which contribute to the interaction with target substances. Such contribution might be the direct interaction with the target substances, or the influence on other directly interacting residues, e.g. by stabilizing the conformation of the polypeptide of a repeat unit (or module) to allow or enhance the interaction of directly interacting residues with said target.
- framework and target interaction residues may be identified by analysis of the structural data obtained by physicochemical methods, such as X-ray crystallography, NMR and/or CD spectroscopy, or by comparison with known and related structural information well known to practitioners in structural biology and/or bioinformatics.
- the repeat units used for the deduction of a repeat sequence motif are homologous repeat units, wherein the repeat units comprise the same structural motif and wherein more than 70% of the framework residues of said repeat units are homologous to each other.
- more than 80% of the framework residues of said repeat units are homologous.
- more than 90% of the framework residues of said repeat units are homologous.
- Computer programs to determine the percentage of homology between polypeptides, such as Fasta, Blast or Gap are known to the person skilled in the art.
- the repeat units used for the deduction of a repeat sequence motif are homologous repeat units obtained from repeat domains selected on a defined target.
- randomized position refers to an amino acid position in a repeat sequence motif, wherein two or more amino acids are allowed at said amino acid position, for example, wherein any of the usual twenty naturally occurring amino acids are allowed, or wherein most of the twenty naturally occurring amino acids are allowed, such as amino acids other than cysteine, or amino acids other than glycine, cysteine and proline. Most often, such randomized positions correspond to the positions of target interaction residues. However, some positions of framework residues may also be randomized.
- folding topology refers to the tertiary structure of said repeat units or repeat modules.
- the folding topology will be determined by stretches of amino acids forming at least parts of ⁇ -helices or ⁇ -sheets, or amino acid stretches forming linear polypeptides or loops, or any combination of ⁇ -helices, ⁇ -sheets and/or linear polypeptides/loops.
- an ankyrin repeat unit/module consists of a ⁇ -turn, followed by two antiparallel ⁇ -helices and a loop that reaches the turn of the next repeat unit/module.
- repeat units refers to an arrangement, wherein the repeat units or repeat modules are arranged in tandem.
- repeat proteins there are at least 2, usually about 2 to 6, in particular at least about 6, frequently 20 or more repeat units (or modules).
- repeat units (or modules) of a repeat domain will exhibit a high degree of sequence identity (same amino acid residues at corresponding positions) or sequence similarity (amino acid residues being different, but having similar physicochemical properties), and some of the amino acid residues might be key residues being strongly conserved.
- a high degree of sequence variability by amino acid insertions and/or deletions, and/or substitutions between the different repeat units (or modules) of a repeat domain may be possible as long as the common folding topology of the repeat units (or modules) is maintained.
- Methods for directly determining the folding topology of repeat proteins by physico-chemical means such as X-ray crystallography, NMR or CD spectroscopy, are well known to the practitioner skilled in the art.
- Methods for identifying and determining repeat units or repeat sequence motifs or for identifying families of related proteins comprising such repeat units or motifs, such as homology searches (BLAST etc.) are well established in the field of bioinformatics, and are well known to the practitioner in the art.
- the step of refining an initial repeat sequence motif may comprise an iterative process.
- repeat modules refers to the repeated amino acid sequences of the designed repeat domains, which are originally derived from the repeat units of naturally occurring repeat proteins.
- Each repeat module comprised in a repeat domain is derived from one or more repeat units of the family or subfamily of naturally occurring repeat proteins, e.g. the family of armadillo repeat proteins or ankyrin repeat proteins.
- each repeat module comprised in a repeat domain comprises a repeat sequence motif deduced from homologous repeat units obtained from repeat domains selected on a target, for example as described in Example 1 and having the same target specificity.
- ankyrin repeat module shall mean a repeat module, which is originally derived from the repeat units of naturally occurring ankyrin repeat proteins.
- Ankyrin repeat proteins are well known to the person skilled in the art.
- “Repeat modules” may comprise positions with amino acid residues present in all copies of corresponding repeat modules (“fixed positions”) and positions with differing or “randomized” amino acid residues (“randomized positions”).
- capping module refers to a polypeptide fused to the N- or C-terminal repeat module of a repeat domain, wherein said capping module forms tight tertiary interactions (i.e. tertiary structure interactions) with said repeat module thereby providing a cap that shields the hydrophobic core of said repeat module at the side not in contact with the consecutive repeat module from the solvent.
- Said N- and/or C-terminal capping module may be, or may be derived from, a capping unit or other structural unit found in a naturally occurring repeat protein adjacent to a repeat unit.
- capping unit refers to a naturally occurring folded polypeptide, wherein said polypeptide defines a particular structural unit which is N- or C-terminally fused to a repeat unit, wherein said polypeptide forms tight tertiary structure interactions with said repeat unit thereby providing a cap that shields the hydrophobic core of said repeat unit at one side from the solvent.
- capping modules or capping units are capping repeats.
- capping repeat refers to capping module or capping unit having a similar or the same fold as said adjacent repeat unit (or module) and/or sequence similarities to said adjacent repeat unit (or module). Capping modules and capping repeats are described in WO 2002/020565 and by Interlandi et al., 2008 (loc.
- N-terminal ankyrin capping modules i.e. N-terminal capping repeats
- examples of ankyrin C-terminal capping modules i.e. C-terminal capping repeats
- N-terminal ankyrin capping module of SEQ ID NO:49 is encoded by the amino acids from position 1 to 32 and the C-terminal capping module of SEQ ID NO:49 is encoded by the amino acids form position 132 to 159.
- the term “has binding specificity for a target”, “specifically binding to a target” or “target specificity” and the like means that a binding protein or binding domain binds in PBS to a target with a lower dissociation constant than to an unrelated protein such as the E. coli maltose binding protein (MBP).
- the dissociation constant in PBS for the target is at least 10, more preferably at least 10 2 , even more preferably at least 10 3 , or most preferably at least 10 4 times lower than the corresponding dissociation constant for MBP.
- Recombinant binding proteins comprising an ankyrin repeat domain with binding specificity for PDGF-BB are shown in the Examples.
- the invention relates to a recombinant binding protein as defined herein comprising an ankyrin repeat domain with binding specificity for PDGF-BB, which binds PDGF-BB in PBS with a dissociation constant (Kd) below 10 ⁇ 6 M.
- said ankyrin repeat domain binds PDGF-BB with a Kd in PBS below 10 ⁇ 7 M, more preferably below 10 ⁇ 8 M, 10 ⁇ 9 M, 10 ⁇ 10 M, or most preferably below 10 ⁇ 11 M.
- Kd values of a particular protein-protein interaction can vary if measured under different conditions (e.g., salt concentration, pH).
- measurements of Kd values are preferably made with standardized solutions of protein and a standardized buffer, such as PBS.
- Recombinant binding proteins comprising an ankyrin repeat domain binding PDGF-BB with a Kd in PBS below 10 ⁇ 6 M are shown in Example 2.
- Preferred is a recombinant binding protein comprising an ankyrin repeat domain with binding specificity for human PDGF-BB.
- a recombinant binding protein comprising an ankyrin repeat domain comprising between 70 and 300 amino acids, in particular between 90 and 200 amino acids.
- a binding domain of the invention is an ankyrin repeat domain or a designed ankyrin repeat domain, preferably as described in WO 2002/020565. Examples of designed ankyrin repeat domains with binding specificity for PDGF-BB are shown in the Examples.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein the ankyrin repeat domain inhibits the binding of PDGF-BB to PDGFRbeta in PBS with an IC 50 value below 10 ⁇ 7 M.
- said ankyrin repeat domain inhibits the binding of PDGF-BB to PDGFRbeta in PBS with an IC 50 value below 10 ⁇ 7 M, more preferably below 10 ⁇ 8 M, 10 ⁇ 9 M, 10 ⁇ 10 M, or most preferably below 10 ⁇ 11 M.
- the half maximal inhibitory concentration (IC 50 ) is a measure of the effectiveness of a compound, such as a binding domain of the invention, in inhibiting a biological, biochemical or biophysical function.
- Methods to determine IC 50 values of inhibition of protein-protein interactions, such as competition ELISAs are well known to the person skilled in the art.
- the measured IC 50 values of a particular inhibitor of a protein-protein interaction can vary if measured under different conditions (e.g., salt concentration, pH).
- measurements of IC 50 values are preferably made with standardized solutions of protein and a standardized buffer, such as PBS.
- Recombinant binding proteins comprising an ankyrin repeat domain inhibiting the binding of PDGF-BB to PDGFRbeta in PBS with an IC 50 value below 10 ⁇ 7 M are shown in Example 4.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for PDGF-BB, which inhibits the PDGF-BB stimulated proliferation of NIH-3T3 fibroblasts (ATCC, cat number: CRL-1658) with an IC 50 value below 10 ⁇ 6 M.
- said repeat domain inhibits the PDGF-BB stimulated proliferation of NIH-3T3 fibroblasts with an IC 50 value below 10 ⁇ 7 M, more preferably below 10 ⁇ 8 M, 10 ⁇ 9 M, 10 ⁇ 10 M, or most preferably 10 ⁇ 11 M.
- NIH-3T3 cells are responsive to PDGF-BB for growth and as such can be used to measure the functional inhibitory capability of the compounds of the invention.
- NIH-3T3 cells are grown in culture medium and then starved of nutrients for 7 hours prior to addition of PDGF-BB and a titration of the anti-PDGF-BB DARPin.
- Assessment of the ability of the compounds of the invention to inhibit PDGF-BB is determined by the proliferative capacity of the NIH-3T3 cells as measured by standard measurements well known to the person skilled in the art.
- Recombinant binding proteins comprising an ankyrin repeat domain inhibiting the PDGF-BB stimulated proliferation of NIH-3T3 fibroblasts with an IC 50 value below 10 ⁇ 6 M are shown in Example 3.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for PDGF-BB, wherein said binding protein and/or ankyrin repeat domain has a midpoint denaturation temperature (Tm) above 40° C. upon thermal unfolding in PBS and forms less than 5% (w/w) insoluble aggregates at concentrations up to 10 g/L when incubated at 37° C. for 1 day in PBS.
- Tm midpoint denaturation temperature
- PBS means a phosphate buffered water solution containing 137 mM NaCl, 10 mM phosphate and 2.7 mM KCl and having a pH of 7.4.
- the recombinant binding protein and/or binding domain has a midpoint denaturation temperature (Tm) above 45° C., more preferably above 50° C., more preferably above 55° C., and most preferably above 60° C. upon thermal unfolding in PBS at pH 7.4.
- Tm midpoint denaturation temperature
- a binding protein or a binding domain of the invention possesses a defined secondary and tertiary structure under physiological conditions. Thermal unfolding of such a polypeptide results in a loss of its tertiary and secondary structure, which can be followed, for example, by circular dichroism (CD) measurements.
- CD circular dichroism
- the midpoint denaturation temperature of a binding protein or binding domain upon thermal unfolding corresponds to the temperature at the midpoint of the cooperative transition in physiological buffer upon heat denaturation of said protein or domain by slowly increasing the temperature from 10° C. to about 100° C.
- the determination of a midpoint denaturation temperature upon thermal unfolding is well known to the person skilled in the art. This midpoint denaturation temperature of a binding protein or binding domain upon thermal unfolding is indicative of the thermal stability of said polypeptide.
- a recombinant binding protein and/or ankyrin repeat domain forming less than 5% (w/w) insoluble aggregates at concentrations up to 20 g/L, preferably up 40 g/L, more preferably up to 60 g/L, even more preferably up to 80 g/L, and most preferably up to 100 g/L when incubated for over 5 days, preferably over 10 days, more preferably over 20 days, more preferably over 40 days, and most preferably over 100 days at 37° C. in PBS.
- the formation of insoluble aggregates can be detected by the appearance of visual precipitations, gel filtration or dynamic light scattering, which strongly increases upon formation of insoluble aggregates.
- a recombinant binding protein and/or ankyrin repeat domain that does not lose its native three-dimensional structure upon incubation in PBS containing 100 mM dithiothreitol (DTT) for 1 or 10 hours at 37° C.
- DTT dithiothreitol
- the invention relates to a recombinant binding protein comprising an ankyrin repeat domain, specifically binding to PDGF-BB and having the indicated or preferred midpoint denaturation temperature and non-aggregating properties as defined above.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein the ankyrin repeat domain competes for binding to a mammalian PDGF-BB with an ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60; preferably SEQ ID NOs: 24, 45 and 50, in particular SEQ ID NO:24 and 50.
- said ankyrin repeat domain competes for binding to a mammalian PDGF-BB with a binding protein selected from the group of DARPins #23 to 60.
- said repeat domain competes for binding to a mammalian PDGF-BB with a binding protein from the group of DARPins #24, 45 and 50. More preferably, said ankyrin repeat domain competes for binding to a mammalian PDGF-BB with binding protein DARPin #24 or 50.
- Compet for binding means the inability of two different binding domains of the invention to bind simultaneously to the same target, while both are able to bind the same target individually.
- said two binding domains compete for binding to said target.
- said two competing binding domains bind to an overlapping or the same binding epitope on said target.
- Methods such as competition Enzyme-Linked Immuno Sorbent Assay (ELISA) or competition SPR measurements (e.g. by using the Proteon instrument from BioRad), to determine if two binding domains compete for binding to a target, are well known to the practitioner in the art.
- ELISA competition Enzyme-Linked Immuno Sorbent Assay
- competition SPR measurements e.g. by using the Proteon instrument from BioRad
- epitope means the specific site on the surface of a target protein, such as PDGF-BB, to which a binding domain of the invention, such as an ankyrin repeat domain, attaches itself. This term is defined in analogy to epitopes of antibodies, which are well known to the person skilled in the art. If two binding domains of the invention bind to the same epitope, they will compete for binding for PDGF-BB.
- the exact molecular arrangement of an epitope can be elucidated, for example, by protein X-ray crystallography (a method well known to the person skilled in the art) of the binding domain of the invention in complex with PDGF-BB.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain comprises an amino acid sequence that has at least 70% amino acid sequence identity with one ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60,
- G at position 1 and/or S at position 2 of said ankyrin repeat domain are optionally missing;
- L at the second last position and/or N at the last position of said ankyrin repeat domain are optionally exchanged by A.
- such an ankyrin repeat domain in a recombinant binding protein of the invention comprises an amino acid sequence that has at least 70% amino acid sequence identity with one ankyrin repeat domain selected from the group consisting of SEQ ID NO: 24, 45 and 50; more preferably, 24 and 50.
- such an ankyrin repeat domain in a recombinant binding protein of the invention comprises an amino acid sequence with at least 70% amino acid sequence identity, for example 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity with one, two or three ankyrin repeat modules present between the N-terminal and C-terminal capping modules of an ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60.
- such an ankyrin repeat domain or such one, two or three repeat modules present between the N-terminal and C-terminal capping modules in an ankyrin repeat domain in a recombinant binding protein of the invention comprises an amino acid sequence with at least 75%, more preferably at least 76%, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, or most preferred at least 95% amino acid sequence identity.
- the mentioned percentages of amino acid sequence identity is in the framework positions.
- up to 30 amino acids for example 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or no amino acid(s) in the repeat domains SEQ ID NO:23 to 60 are exchanged by another amino acid.
- up to 25 amino acids more preferably up to 20 amino acids, more preferably up to 15 amino acids, even more preferably up to 11 amino acids, more preferably up to 8 amino acids, more preferably up to 5 amino acids, more preferably up to 2 amino acid, and most preferably no amino acid in SEQ ID NO: 23 to 60 is exchanged.
- amino acids when amino acids are exchanged in the capping modules of SEQ ID NO:13 or 16, the repeat modules of SEQ ID NO:12, 14, 15, 17, 18 and 19 or the repeat domains of SEQ ID NO:23 to 60, these amino acids are selected from the group consisting of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y; more preferably from the group consisting of A, D, E, H, I, K, L, Q, R, S, T, V, and Y.
- an amino acid is exchanged by a homologous amino acid; i.e. an amino acid is exchanged by an amino acid having a side chain with similar biophysical properties.
- the negative charged amino acid D may be replaced by the negative charged amino acid E, or a hydrophobic amino acid such as L may be replaced by A, I or V.
- a hydrophobic amino acid such as L may be replaced by A, I or V.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain is selected from the group consisting of SEQ ID NOs: 23 to 60,
- G at position 1 and/or S at position 2 of said ankyrin repeat domain are optionally missing;
- L at the second last position and/or N at the last position of said ankyrin repeat domain are optionally exchanged by A.
- such an ankyrin repeat domain is selected from the group consisting of SEQ ID NO: 24, 45 and 50; more preferably, 24 and 50.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain attaches to the same epitope as an ankyrin repeat domain selected from the group consisting of SEQ ID NOs:23 to 60.
- an ankyrin repeat domain is selected from the group consisting of SEQ ID NO: 24, 45 and 50; more preferably, 24 and 50.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain comprises an ankyrin repeat module having an amino acid sequence selected from the group consisting of SEQ ID NO:12, 14, 15, 17, 18 and 19 and sequences, wherein up to 9 amino acids in SEQ ID NO:12, 14, 15, 17, 18 and 19 are exchanged by any amino acid.
- such an ankyrin repeat module of said ankyrin repeat domain is selected from the group consisting of SEQ ID NO: 12, 14 and 17; more preferably, 12 and 17.
- up to 8 amino acids in the repeat modules of SEQ ID NO:12, 14, 15, 17, 18 and 19 are exchanged by another amino acid, more preferably up to 7 amino acids, more preferably up to 6 amino acids, more preferably up to 5 amino acids, even more preferably up to 4 amino acids, more preferably up to 3 amino acids, more preferably up to 2 amino acids, and most preferably 1 amino acid.
- the mentioned exchanges of amino acid are in the framework positions. Accordingly, up to 8 amino acids in framework positions of SEQ ID NO:12, 14, 15, 17, 18 and 19 are exchanged by any amino acid, preferably up to 7, 6, 5, 4, 3 or 2 amino acids, and most preferably 1 amino acid.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDEEGTTPLHYAAVWGHLEIVEVLLKAGADVNA (SEQ ID NO:12) and sequences, wherein up to 9 amino acids in SEQ ID NO:11 are exchanged by any amino acid and wherein
- E at position 3 is optionally exchanged by an amino acid selected from the group consisting of D, W, Q, I and Y, preferably of D and W;
- E at position 4 is optionally exchanged by an amino acid selected from the group consisting of T, D, Y, and S, preferably of T and D;
- T at position 6 is optionally exchanged by an amino acid selected from the group consisting of S and F, preferably by S;
- Y at position 11 is optionally exchanged by F;
- V at position 14 is optionally exchanged by an amino acid selected from the group consisting of A, Y and T, preferably by A; and
- W at position 15 is optionally exchanged by an amino acid selected from the group consisting of F, K, V, and Y, preferably of F and Y.
- the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain comprises a capping module having an amino acid sequence selected from the group consisting of SEQ ID NO:13 and 16 and sequences, wherein up to 9 amino acids in SEQ ID NO:13 and 16 are exchanged by any amino acid.
- up to 8 amino acids in the capping modules of SEQ ID NO:13 and 16 comprised in said ankyrin repeat domain are exchanged by an other amino acid, more preferably up to 7 amino acids, more preferably up to 6 amino acids, more preferably up to 5 amino acids, even more preferably up to 4 amino acids, more preferably up to 3 amino acids, more preferably up to 2 amino acids, more preferably up to 1 amino acid, and most preferably no amino acid in SEQ ID NO:13 and 16 is exchanged.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a C-terminal capping module with the sequence QDIYGATPADLAALVGHEDIAEVLQKLN (SEQ ID NO:13) and sequences, wherein up to 9 amino acids in SEQ ID NO:13 are exchanged by any amino acid wherein
- I at position 3 is optionally exchanged by an amino acid selected from the group consisting of K, L, A and V, preferably L, A and V;
- Y at position 4 is optionally exchanged by an amino acid selected from the group consisting of W. F and S, preferably, of W and F;
- a at position 6 is optionally exchanged by K;
- L at position 14 is optionally exchanged by an amino acid selected from the group consisting of F, Y and D, preferably of F and Y;
- V at position 15 is optionally exchanged by an amino acid selected from the group consisting of L, I, A and N, preferably, L and I; and
- V at position 23 is exchanged by an amino acid selected from the group consisting of I and L.
- ankyrin repeat domain comprises the ankyrin repeat module of SEQ ID NO:12 and the C-terminal capping module SEQ ID NO:13.
- said C-terminal capping module directly follows said ankyrin repeat module in said ankyrin repeat domain.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDQEGTTPLHFAASVGHLEIVEVLLKAGADVNA (SEQ ID NO:15) and sequences, wherein up to 9 amino acids in SEQ ID NO:15 are exchanged by any amino acid and wherein
- E at position 4 is optionally exchanged by D;
- T at position 6 is optionally exchanged by E;
- F at position 11 is optionally exchanged by Y;
- V at position 15 is optionally exchanged by W.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a C-terminal capping module with the sequence QDHYGATPADLAALIGHEDIAEVLQKLN (SEQ ID NO:16) and sequences, wherein up to 9 amino acids in SEQ ID NO:15 are exchanged by any amino acid and wherein
- H at position 3 is optionally exchanged by I;
- Y at position 4 is optionally exchanged by W.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDLNGQTPLHLAADIGHLEIVEVLLKAGADVNA (SEQ ID NO:17) and sequences, wherein up to 9 amino acids in SEQ ID NO:17 are exchanged by any amino acid and wherein
- K at position 1 is optionally exchanged by Q or I;
- L at position 3 is optionally exchanged by N;
- a at position 27 is optionally exchanged by H.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDYAGSTPLRLAAWAGHLEIVEVLLKAGADVNA (SEQ ID NO:18) and sequences, wherein up to 9 amino acids in SEQ ID NO:18 are exchanged by any amino acid and wherein
- W at position 14 is optionally exchanged by H;
- a at position 15 is optionally exchanged by V;
- a at position 27 is optionally exchanged by N or Y.
- the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDYFGYTPLHLAAYFGHLEIVEVLLKAGADVNA (SEQ ID NO:19) and sequences, wherein up to 9 amino acids in SEQ ID NO:19 are exchanged by any amino acid and wherein
- a at position 12 is optionally exchanged by T;
- a at position 13 is optionally exchanged by T;
- E at position 22 is optionally exchanged by D;
- a at position 27 is optionally exchanged by H or Y.
- N-terminal or C-terminal ankyrin capping module comprising an N-terminal or C-terminal ankyrin capping repeat, respectively, wherein one or more of the amino acids residues in said capping repeat are replaced by an amino acid residue found at the corresponding position on alignment of a corresponding ankyrin capping unit or ankyrin repeat unit.
- the replacement of amino acids can be by any of the 20 most often naturally occurring amino acids, preferably by amino acids selected from the group consisting of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y; and more preferably from the group consisting of A, D, E, H, I, K, L, Q, R, S, T, V, and Y.
- the replacement of amino acids is by a homologous amino acid; i.e. an amino acid is replaced by an amino acid having a side chain with similar biophysical properties.
- the negative charged amino acid D may be replaced by the negative charged amino acid E, or a hydrophobic amino acid such as L may be replaced by A, I or V.
- the replacement of an amino acid by a homologous amino acid is well known to the person skilled in the art.
- C-terminal ankyrin capping module comprising the amino acid A at position 27 and 28 of any of the above C-terminal capping modules based on SEQ ID NO:4 to 8, 13 and 16.
- C-terminal capping module comprising the amino acids from position 1 to 26 or from position 1 to 27 of any of the above C-terminal capping modules based on SEQ ID NO:4 to 8, 13 and 16.
- Amino acids G at position 1 and/or S at position 2 of SEQ ID NO:1 to 3 can be removed from N-terminal ankyrin capping modules without any apparent influence on the properties. These two amino acids serve as linkers to connect the ankyrin repeat domain to further amino acids and proteins.
- the invention also comprises such ankyrin repeat domains comprising N-terminal ankyrin capping modules wherein G at position 1 and/or S at position 2 are removed. It is understood that the amino acid positions (e.g. “position 33”) in an ankyrin repeat domain as defined herein are adapted accordingly, resulting in a number shift, e.g. “position 33” will become “position 32”, if one amino acid is missing, or “position 33” will become “position 31”, if two amino acid are missing.
- An ankyrin capping module of an ankyrin repeat domain of the invention can be exchanged by an ankyrin capping module by combining techniques, such as alignment of amino acid sequences, mutagenesis and gene synthesis, known to the person skilled in the art.
- the C-terminal capping repeat of SEQ ID NO:49 can be replaced by the C-terminal capping repeat of SEQ ID NO:8 by (i) determination of the C-terminal capping repeat of SEQ ID NO:49 (i.e.
- N-terminal capping repeat of SEQ ID NO:49 can be replaced by the N-terminal capping repeat of SEQ ID NO:2 by (i) determination of the N-terminal capping repeat of SEQ ID NO:49 (i.e.
- an ankyrin repeat domain of the invention can be constructed genetically by assembling a N-terminal ankyrin capping module (e.g. the N-terminal capping repeat of SEQ ID NO:2) followed by one or more repeat modules (e.g. the three ankyrin repeat modules comprising the amino acid residues from position 33 to 131 of SEQ ID NO:49) and a C-terminal capping module (e.g. the C-terminal capping repeat of SEQ ID NO:8) by means of gene synthesis.
- the genetically assembled repeat domain gene can then be expressed in E. coli as described above.
- a recombinant binding protein, repeat domain, repeat module, N-terminal capping module or C-terminal capping module having an amino acid sequence devoid of amino acids C, M or N.
- a recombinant binding protein, repeat domain, repeat module, N-terminal capping module or C-terminal capping module having an amino acid sequence devoid of amino acid N followed by G.
- a recombinant binding protein or repeat domain comprising any such N-terminal or C-terminal capping module.
- one or more of the amino acid residues of the N-terminal capping module of said repeat domain is exchanged by an amino acid residue found at the corresponding position on alignment of an N-terminal capping unit.
- an amino acid residue found at the corresponding position on alignment of an N-terminal capping unit.
- up to 30% of the amino acid residues are exchanged, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged.
- such an N-terminal capping unit is a naturally occurring N-terminal capping unit.
- one or more of the amino acid residues of the C-terminal capping module of said repeat domain is exchanged by an amino acid residue found at the corresponding position on alignment of a C-terminal capping unit.
- an amino acid residue found at the corresponding position on alignment of a C-terminal capping unit Preferably, up to 30% of the amino acid residues are exchanged, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged.
- a C-terminal capping unit is a naturally occurring C-terminal capping unit.
- up to 30% of the amino acid residues are exchanged with amino acids which are not found in the corresponding positions of repeat units, N-terminal capping units or C-terminal capping units.
- consensus sequence refers to an amino acid sequence, wherein said consensus sequence is obtained by structural and/or sequence aligning of multiple repeat units. Using two or more structural and/or sequence aligned repeat units, and allowing for gaps in the alignment, it is possible to determine the most frequent amino acid residue at each position.
- the consensus sequence is that sequence which comprises the amino acids which are most frequently represented at each position. In the event that two or more amino acids are represented above-average at a single position, the consensus sequence may include a subset of those amino acids. Said two or more repeat units may be taken from the repeat units comprised in a single repeat protein, or from two or more different repeat proteins.
- a “consensus amino acid residue” is the amino acid found at a certain position in a consensus sequence. If two or more, e.g. three, four or five, amino acid residues are found with a similar probability in said two or more repeat units, the consensus amino acid may be one of the most frequently found amino acids or a combination of said two or more amino acid residues.
- non-naturally occurring capping modules are non-naturally occurring capping modules, repeat modules, binding proteins or binding domains.
- non-naturally occurring means synthetic or not from nature, more specifically, the term means made from the hand of man.
- non-naturally occurring binding protein or “non-naturally occurring binding domain” means that said binding protein or said binding domain is synthetic (i.e. produced by chemical synthesis from amino acids) or recombinant and not from nature.
- “Non-naturally occurring binding protein” or “non-naturally occurring binding domain” is a man-made protein or domain, respectively, obtained by expression of correspondingly designed nucleic acids. Preferably, the expression is done in eukaryotic or bacterial cells, or by using a cell-free in vitro expression system.
- sequence of said binding protein or said binding domain is not present as a non-artificial sequence entry in a sequence database, for example in GenBank, EMBL-Bank or Swiss-Prot. These databases and other similar sequence databases are well known to the person skilled in the art.
- the invention relates to a recombinant binding protein comprising an ankyrin repeat domain specifically binding to PDGF-BB and further comprising an ankyrin repeat domain specifically binding to vascular endothelial growth factors A (VEGF-A).
- VEGF-A vascular endothelial growth factors A
- Examples of ankyrin repeat domains with specificity for PDGF-BB are given herein and examples of ankyrin repeat domains with specificity to VEGF-A are described in WO 2010/060748 (US 2011/0207668) and WO 2011/135067 (US 2013/0116197), the entire disclosures of which are incorporated by reference herein.
- Such two repeat domains can be linked by a polypeptide linker by genetic means by methods known to the person skilled in the art.
- a recombinant binding protein comprising an ankyrin repeat domain specifically binding PDGF-BB and an ankyrin repeat domain specifically binding VEGF-A may be used to treat diseases of the retina and choroidal neovascular diseases, such as exudative age-related macular degeneration, polypoidal choroidal neovascularization, and pathological myopia.
- Another preferred embodiment is a recombinant binding protein comprising an ankyrin repeat domain with binding specificity for PDGF-BB comprising one, two, three or more internal repeat modules that will participate in binding to PDGF-BB.
- an ankyrin repeat domain comprises an N-terminal capping module, two to four internal repeat modules, and a C-terminal capping module.
- said capping modules are capping repeats.
- said capping modules will participate in binding to PDGF-BB.
- a recombinant binding protein comprising two or more of said ankyrin repeat domains with binding specificity for PDGF-BB.
- said binding protein comprises 2 or 3 of said repeat domains.
- Said two or more repeat domains have the same or different amino acid sequence.
- a recombinant binding protein comprising an ankyrin repeat domain according to the present invention
- one or more of the amino acid residues of the repeat modules of said ankyrin repeat domain are exchanged by an amino acid residue found at the corresponding position on alignment of a repeat unit.
- up to 30% of the amino acid residues are exchanged, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged.
- such a repeat unit is a naturally occurring repeat unit.
- up to 30% of the amino acid residues for example 29%, 28%, 27%, 26%, 25%, 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0% of the amino acid residues are exchanged with amino acids which are not found in the corresponding positions of repeat units. More preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged with amino acids which are not found in the corresponding positions of repeat units.
- any of the recombinant PDGF-BB binding proteins or domains described herein may be covalently bound to one or more additional moieties, including, for example, a moiety that binds to a different target to create a dual-specificity binding agent, a bioactive compound, a labeling moiety (e.g. a fluorescent label such as fluorescein, or a radioactive tracer), a moiety that facilitates protein purification (e.g. a small peptide tag, such as a His- or strep-tag), a moiety that provides effector functions for improved therapeutic efficacy (e.g.
- a labeling moiety e.g. a fluorescent label such as fluorescein, or a radioactive tracer
- a moiety that facilitates protein purification e.g. a small peptide tag, such as a His- or strep-tag
- a moiety that provides effector functions for improved therapeutic efficacy e.g.
- a toxic protein moiety such as Pseudomonas aeruginosa exotoxin A (ETA) or a small molecular toxic agent such as maytansinoids or DNA alkylating agents) or a moiety that provides improved pharmacokinetics.
- ETA Pseudomonas aeruginosa exotoxin A
- a small molecular toxic agent such as maytansinoids or DNA alkylating agents
- Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing.
- Moieties that tend to slow clearance of a protein from the blood include hydroxyethyl starch (HES), polyethylene glycol (PEG), sugars (e.g. sialic acid), well-tolerated protein moieties (e.g. Fc fragments or serum albumin), and binding domains or peptides with specificity and affinity for abundant serum proteins, such as antibody Fc fragments or serum albumin. Examples of such binding domains with affinity for serum albumin are provided in WO 2012/069654.
- the recombinant binding protein of the invention may be attached to a moiety that reduces the clearance rate of polypeptides in a mammal (e.g. in mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptides.
- the invention relates to nucleic acid molecules encoding the particular recombinant binding proteins, the particular ankyrin repeat domains, the particular ankyrin repeat modules and the particular capping modules. Further, a vector comprising said nucleic acid molecule is considered.
- a pharmaceutical composition comprising one or more of the above mentioned recombinant binding proteins, in particular binding proteins comprising repeat domains, or nucleic acid molecules encoding the particular binding proteins, and optionally a pharmaceutical acceptable carrier and/or diluent is considered.
- Pharmaceutical acceptable carriers and/or diluents are known to the person skilled in the art and are explained in more detail below.
- a diagnostic composition comprising one or more of the above mentioned recombinant binding proteins, in particular binding proteins comprising repeat domains, is considered.
- a pharmaceutical composition comprises recombinant binding proteins as described above and a pharmaceutically acceptable carrier, excipient or stabilizer, for example as described in Remington's Pharmaceutical Sciences 16 th edition, Osol, A. Ed. [1980].
- Suitable carriers, excipients or stabilizers known to the skilled man are saline, Ringer's solution, dextrose solution, Hank's solution, fixed oils, ethyl oleate, 5% dextrose in saline, substances that enhance isotonicity and chemical stability, buffers and preservatives.
- suitable carriers include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids and amino acid copolymers.
- a pharmaceutical composition may also be a combination formulation, comprising an additional active agent, such as an anti-cancer agent or an anti-angiogenic agent.
- the formulations to be used for in vivo administration must be aseptic or sterile. This is readily accomplished by filtration through sterile filtration membranes.
- the pharmaceutical composition may be administered by any suitable method within the knowledge of the person skilled in the art.
- any of the above mentioned pharmaceutical composition is considered for the treatment of a disorder.
- the invention further provides methods of treatment.
- the method comprises administering, to a patient in need thereof, a therapeutically effective amount of a recombinant binding protein of the invention, that is, an amount that is sufficient to produce a desired effect on a patient.
- a method of treating a pathological condition in a mammal including man comprising administering to a patient in need thereof an effective amount of the above mentioned pharmaceutical composition is considered.
- pathological conditions examples include atherosclerosis, restenosis, pulmonary hypertension, ocular and retinal diseases and fibrotic diseases, including pulmonary fibrosis, liver cirrhosis, scleroderma, glomerulosclerosis and cardiac fibrosis.
- anti-PDGF-BB therapy is useful for oncology pathological conditions, such as gliomas, sarcomas, leukemias, lymphomas and epithelial cancers.
- the recombinant binding protein or ankyrin repeat domain according to the invention may be obtained and/or further evolved by several methods such as display on the surface of bacteriophages (WO 1990/002809, WO 2007/006665) or bacterial cells (WO 1993/010214), ribosomal display (WO 1998/048008), display on plasmids (WO 1993/008278) or by using covalent RNA-repeat protein hybrid constructs (WO 2000/032823), or intracellular expression and selection/screening such as by protein complementation assay (WO 1998/341120).
- display on the surface of bacteriophages WO 1990/002809, WO 2007/006665
- bacterial cells WO 1993/010214
- ribosomal display WO 1998/048008
- display on plasmids WO 1993/008278
- covalent RNA-repeat protein hybrid constructs WO 2000/032823
- intracellular expression and selection/screening such as by protein complementation assay (
- a library of ankyrin repeat proteins used for the selection/screening of a recombinant binding protein or ankyrin repeat domain according to the invention may be obtained according to protocols known to the person skilled in the art (WO 2002/020565, Binz, H. K., et al., J. Mol. Biol., 332, 489-503, 2003, and Binz et al., 2004, loc. cit).
- the use of such libraries for the selection of ankyrin repeat domains with specificity for PDGF-BB is exemplified in Example 1.
- ankyrin repeat domains of the present invention may be modularly assembled from ankyrin repeat modules according to the current invention and appropriate capping modules or capping repeats (Forrer, P., et al., FEBS letters 539, 2-6, 2003) using standard recombinant DNA technologies (e.g. WO 2002/020565, Binz et al., 2003, loc. cit. and Binz et al., 2004, loc. cit).
- the C-terminal capping module of SEQ ID NO: 8) or a randomized C-terminal capping module according to SEQ ID NO: 65 are assembled to not have the amino acids C, G, M, N (in front of a G residue) or P at randomized positions of repeat or capping modules.
- randomized repeat modules according to the sequence motif of SEQ ID NO: 20, 62 or 63 could be further randomized at position 10 and/or position 17;
- the randomized N-terminal capping module according to the sequence motif of SEQ ID NO: 64 could be further randomized at position 7 and/or position 9;
- the randomized C-terminal capping modules according to the sequence motif of SEQ ID NO: 65 could be further randomized at positions 10, 11 and/or 17.
- Such randomized modules in such libraries may comprise additional polypeptide loop insertions with randomized amino acid positions.
- polypeptide loop insertions are complement determining region (CDR) loop libraries of antibodies or de novo generated peptide libraries.
- CDR complement determining region
- such a loop insertion could be designed using the structure of the N-terminal ankyrin repeat domain of human ribonuclease L (Tanaka, N., Nakanishi, M, Kusakabe, Y, Goto, Y., Kitade, Y, Nakamura, K. T., EMBO J. 23(30), 3929-3938, 2004) as guidance.
- ankyrin repeat proteins libraries may contain randomized loops (with fixed and randomized positions) of variable length (e.g. 1 to 20 amino acids) inserted in one or more beta-turns of an ankyrin repeat domain.
- any such N-terminal capping module of an ankyrin repeat protein library preferably possesses the RELLKA or RILKAA motif instead of the RILLAA motif (e.g. present from position 21 to 26 in SEQ ID NO:64) and any such C-terminal capping module of an ankyrin repeat protein library preferably possesses the KAA or KLA motif instead of the KLN motif (e.g. the last three amino acids in SEQ ID NO:65).
- ankyrin repeat protein library may be guided by known structures of an ankyrin repeat domain interacting with a target.
- Examples of such structures identified by their Protein Data Bank (PDB) unique accession or identification codes (PDB-IDs), are 1WDY, 3V31, 3V30, 3V2X, 3V20, 3UXG, 3TWQ-3TWX, 1N11, 1S70 and 2ZGD.
- PDB Protein Data Bank
- N2C and N3C designed ankyrin repeat protein libraries are described (WO 2002/020565; Binz et al. 2003, loc. cit.; Binz et al. 2004, loc. cit.).
- the digit in N2C and N3C describes the number of randomized repeat modules present between the N-terminal and C-terminal capping modules.
- position 1 of an ankyrin repeat module of Binz et al. 2004 corresponds to position 2 of a ankyrin repeat module of the current disclosure and consequently position 33 of a ankyrin repeat module of Binz et al. 2004, loc. cit. corresponds to position 1 of a following ankyrin repeat module of the current disclosure.
- Binding Proteins Comprising an Ankyrin Repeat Domain with Binding Specificity for PDGF-BB
- ankyrin repeat proteins with binding specificity for PDGF-BB were selected from DARPin libraries as described by Binz et al. 2004 (loc. cit.).
- the ankyrin repeat domains of SEQ ID NO: 23 to 61 constitute amino acid sequences of selected binding proteins comprising an ankyrin repeat domain with binding specificity for PDGF-BB.
- Individual ankyrin repeat modules from such ankyrin repeat domains with binding specificity to PDGF-BB are provided in SEQ ID NO: 12, 14, 15, 17, 18 and 19.
- Individual capping modules of such ankyrin repeat domains with binding specificity to PDGF-BB are provided in SEQ ID NO: 13 and 16.
- PDGF-BB specific ankyrin repeat proteins was performed by ribosome display (Hanes and Plückthun, loc. cit.) using human and mouse PDGF-BB as target proteins, libraries of designed ankyrin repeat proteins as described above and established protocols (Zahnd, C., Amstutz, P. and Plückthun, A., Nat. Methods 4, 69-79, 2007).
- the number of reverse transcription (RT)-PCR cycles after each selection round was constantly reduced from 40 to 30, adjusting to the yield due to enrichment of binders.
- the first four rounds of selection employed standard ribosome display selection, using decreasing target concentration and increasing washing stringency to increase selection pressure from round 1 to round 4 (Binz et al. 2004, loc. cit.).
- the output from the fourth round of standard ribosome display selection was subjected to an off-rate selection round with increased selection stringency (Zahnd, 2007, loc. cit.).
- a final standard selection round was performed to amplify and recover the off-rate selected binding proteins.
- DARPins specifically binding PDGF-BB were identified by an enzyme-linked immunosorbent assay (ELISA) using crude Escherichia coli extracts of DARPin expression cells using standard protocols.
- DARPins selected by ribosome display were cloned into the pQE30 (Qiagen) expression vector, transformed into E. coli XL1-Blue (Stratagene) and then grown overnight at 37° C. in a 96-deep-well plate (each clone in a single well) containing 1 ml growth medium (2YT containing 1% glucose and 100 ⁇ g/ml ampicillin).
- DARPin #21 (SEQ ID NO:21 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #22 (SEQ ID NO:22 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #23 (SEQ ID NO:23 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #24 (SEQ ID NO:24 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #25 (SEQ ID NO:25 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #26 (SEQ ID NO:26 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #27 (SEQ ID NO:27 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #28 (SEQ ID NO:28 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #29 (SEQ ID NO:29 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #30 (SEQ ID NO:30 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #31 (SEQ ID NO:31 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #32 (SEQ ID NO:32 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #33 (SEQ ID NO:33 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #34 (SEQ ID NO:34 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #35 (SEQ ID NO:35 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #36 (SEQ ID NO:36 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #37 (SEQ ID NO:37 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #38 (SEQ ID NO:38 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #39 (SEQ ID NO:39 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #40 (SEQ ID NO:40 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #41 (SEQ ID NO:41 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #42 (SEQ ID NO:42 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #43 (SEQ ID NO:43 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #44 (SEQ ID NO:44 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #45 (SEQ ID NO:45 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #46 (SEQ ID NO:46 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #47 (SEQ ID NO:47 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #48 (SEQ ID NO:48 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #49 (SEQ ID NO:49 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #50 (SEQ ID NO:50 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #51 (SEQ ID NO:51 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #52 (SEQ ID NO:52 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #53 (SEQ ID NO:53 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #54 (SEQ ID NO:54 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #55 (SEQ ID NO:55 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #56 (SEQ ID NO:56 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #57 (SEQ ID NO:57 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #58 (SEQ ID NO:58 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #59 (SEQ ID NO:59 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #60 (SEQ ID NO:60 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #61 (SEQ ID NO:61 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- the selected clones showing specific PDGF-BB binding in the crude cell extract ELISA as described above were expressed in E. coli BL21 or XL1-Blue cells and purified using their His-tag using standard protocols. 50 ml of stationary overnight cultures (TB, 1% glucose, 100 mg/l of ampicillin; 37° C.) were used to inoculate 1 l cultures (same medium without glucose). At an absorbance of 0.7 (1 for BL21) at 600 nm, the cultures were induced with 0.5 mM IPTG and incubated at 37° C. for 4-5 h.
- the cultures were centrifuged and the resulting pellets were resuspended in 40 ml of TBS500 (50 mM Tris-HCl, 500 mM NaCl, pH 8) and sonicated.
- the lysate was recentrifuged, and glycerol (10% (v/v) final concentration) and imidazole (20 mM final concentration) were added to the resulting supernatant. Proteins were purified over a Ni-nitrilotriacetic acid column (2.5 ml column volume) according to the manufacturer's instructions (QIAgen, Germany).
- DARPins or selected repeat domains devoid of a 6 ⁇ His-tag were purified by anion exchange chromatography followed by size exclusion chromatography according to standard resins and protocols known to the person skilled in the art.
- Up to 200 mg of highly soluble DARPins with binding specificity to PDGF-BB can be purified from one liter of E. coli culture with a purity >95% as estimated from SDS-15% PAGE.
- Such purified DARPins are used for further characterizations.
- Biotinylated PDGF-BB molecules from human and mouse were immobilized in a flow cell through binding to coated Streptavidin and the interaction with various selected DARPins was analyzed.
- SPR was measured using a ProteOn instrument (BioRad) and measurement was performed according standard procedures known to the person skilled in the art.
- the running buffer was PBS, pH 7.4, containing 0.005% Tween 20®.
- Neutravidin was covalently immobilized on a GLC chip (BioRad) to a level of about 8000 resonance units (RU). Immobilization of PDGF-BB on the neutravidin coated chip was then performed.
- DARPin PDGF-BB The interaction of DARPin PDGF-BB was then measured by injecting 100 ⁇ l running buffer (PBS containing 0.005% Tween®) containing serial dilutions of DARPins of concentration of 12.5, 6.26, 3.13 and 1.67 nM (on-rate measurement), followed by a running buffer flow for between 10 minutes and up to to 3 hours at a constant flow rate of 30 ⁇ l/min (off-rate measurement).
- the signals i.e. resonance unit (RU) values
- RU resonance unit
- Dissociation constants (Kd) were calculated from the estimated on- and off-rates using standard procedures known to the person skilled in the art.
- NIH-3T3 fibroblast cells are a standard cell line used for assays involving PDGF-BB.
- the cells were harvested and seeded in a 96-well culture plate with density of 5000 cells/well in a growth medium, followed by starving of cells around 7-8 hours later by changing of medium to assay medium and incubated for 24 hours. All incubation condition was 37° C. with 5% CO 2 flow.
- the media was changed into a fresh assay media containing the dilution series of growth factor human PDGF-BB (for the proliferation assay) or a inhibition mixture of 20 ng/mL human PDGF-BB with a 2.5-fold dilution series of DARPins (200 nM to 0.05 nM) for the inhibition assay.
- the cells were incubated for another 48 h in this condition upon the addition of 20 ⁇ L of WST-1 reagent (Roche product no. 11644807001). This reagent enables a colorimetric assay that analyzes the number of viable cells. Readout of the signals was done at A 450 nm with a correction background at A 600 nm at several time points of 2, 4 and 6 hours after the addition of WST-1.
- Example results are summarized in Table 2. IC 50 values were calculated from the titration curves obtained as described above using GraphPad Prism software and standard procedures known to the person skilled in the art. An example titration curve is given for DARPin #49 in FIG. 1 .
- the potency of PEGylated anti-PDGF-BB DARPins to inhibit the binding of human PDGF-BB to its receptor PDGFRbeta was determined in a in a receptor competition ELISA (based on PDGF-BB Quantikine, R&D Systems). PDGFRbeta/Fc chimera has been pre-coated on a microplate. The DARPins were preincubated in assay diluent from the PDGF-BB Quantikine kit (R&D Systems) with a defined amount of PDGF-BB and incubated at room temperature for 2 hours with shaking at 750 rpm.
- CNV Choroidal neovascularization
- DARPin #61-PEG20 was administered daily with a concentration of 10 or 1 mg/kg, respectively, as indicated in FIG. 3 .
- mice were heart perfused with fluorescein-labeled dextran, retinal flat-mounts were prepared as described (Takahashi et al., loc cit) and the area of neovascularization was quantified by image analysis.
- Statistical analysis was performed using 1-way ANOVA and Dunnett post-test to compare all DARPin groups to the vehicle group. These techniques are all known to persons skilled in the art. The results are presented in FIG. 3 .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Cell Biology (AREA)
- Immunology (AREA)
- Ophthalmology & Optometry (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
New designed ankyrin repeat proteins with binding specificity for PDGF-BB are described, as well as nucleic acids encoding such PDGF binding proteins, pharmaceutical compositions comprising such proteins and the use of such proteins in the treatment of diseases.
Description
- The present invention relates to designed ankyrin repeat proteins with binding specificity for platelet-derived growth factor (PDGF), as well as nucleic acids encoding such PDGF binding proteins, pharmaceutical compositions comprising such proteins and the use of such proteins in the treatment of diseases.
- Platelet-derived growth factor (PDGF) was identified more than three decades ago as a serum growth factor for fibroblasts, smooth muscle cells and glia cells. Its role in physiology and medicine is extensively described in a recent review (Andrae, J., Gallini, R. and Betsholtz, C., Genes Dev., 22, 1276-1312, 2008). Human PDGF was originally identified as a disulfide-linked dimer of two different polypeptide chains, A (PDGF-A; human PDGF-A has the UniProtKB/Swiss-Prot number P04085) and B (PDGF-B; human PDGF-B has the UniProtKB/Swiss-Prot number P01127). Thereby, three protein dimers can be formed: PDGF-AA, PDGF-AB and PDGF-BB. Recently, two additional PDGF polypeptide chains, PDGF-C and PDGF-D, were identified. The currently known PDGF genes and polypeptides belong to a family of structurally and functionally related growth factors including also the vascular endothelial growth factors (VEGFs). PDGF/VEGF growth factors are conserved throughout the animal kingdom.
- PDGFs act via two receptor tyrosine kinases (RTKs), PDGF receptor (PDGFR) alpha (PDGFRalpha) and beta (PDGFRbeta), with common domain structures, including five extracellular immunoglobulin (Ig) loops and a split intracellular tyrosine kinase domain. The VEGFs act through a distinct but structurally related subfamily of RTKs. Ligand binding promotes receptor dimerization, which initiates signaling. Depending on ligand configuration and the pattern of receptor expression, different receptor dimers may form. However, only a few interactions seem to be relevant in vivo; i.e., those of PDGF-AA and PDGF-CC via PDGFRalpha, and PDGF-BB via PDGFRbeta.
- The PDGFs have crucial roles during development, but there is limited evidence for normal physiological functions in the adult. Studies of PDGFs and PDGFRs in animal development have revealed roles for PDGFRalpha signaling in gastrulation and in the development of the cranial and cardiac neural crest, gonads, lung, intestine, skin, CNS, and skeleton. Similarly, roles for PDGFRbeta signaling have been established in blood vessel formation and early hematopoiesis. PDGF signaling is implicated in a range of diseases. Autocrine activation of PDGF signaling pathways is involved in certain gliomas, sarcomas, and leukemias. Paracrine PDGF signaling is commonly observed in epithelial cancers, where it triggers stromal recruitment and may be involved in epithelial—mesenchymal transition, thereby affecting tumor growth, angiogenesis, invasion, and metastasis. PDGFs drive pathological mesenchymal responses in vascular disorders such as atherosclerosis, restenosis, pulmonary hypertension, and retinal diseases, as well as in fibrotic diseases, including pulmonary fibrosis, liver cirrhosis, scleroderma, glomerulosclerosis, and cardiac fibrosis.
- Thus, increased PDGF activity has been linked with several diseases and pathological conditions. Causal pathogenic roles of the PDGFs have been established for some diseases, providing prospects for therapy using PDGF antagonists, such as PDGF specific antibodies. In addition, it has been suggested that the combination of anti-VEGF and anti-PDGF agents affords synergistic therapeutic benefits for treating certain ocular neovascular diseases (WO 2005/020972; Jo, N., Mailhos, C., Ju, M., Cheung, E., Bradley, J., Nishijima, K., Robinson, G. S., Adamis, A. P. and Shima, D. T., Am. J. Pathol., 168(6), 2036-2053, 2006).
- There are, beside antibodies, novel binding proteins or binding domains that can be used to specifically bind a target molecule (e.g. Binz, H. K., Amstutz, P. and Plückthun, A., Nat. Biotechnol. 23, 1257-1268, 2005) and thereby act as an antagonist. One such novel class of binding proteins or binding domains not possessing an Fc are based on designed repeat proteins or designed repeat domains (WO 2002/020565; Binz, H. K., Amstutz, P., Kohl, A., Stumpp, M. T., Briand, C., Forrer, P., Grütter, M. G., and Plückthun, A., Nat. Biotechnol. 22, 575-582, 2004; Stumpp, M. T., Binz, H. K and Amstutz, P., Drug Discov. Today 13, 695-701, 2008). WO 2002/020565 describes how large libraries of repeat proteins can be constructed and their general application. Nevertheless, WO 2002/020565 does neither disclose the selection of repeat domains with binding specificity for PDGF-BB nor concrete repeat modules or repeat sequence motifs of repeat domains that specifically bind to PDGF-BB. Furthermore, WO 2002/020565 does not suggest that repeat domains with binding specificity for PDGF-BB could be used to regulate the PDGF-BB mediated signaling pathways to successfully treat diseases. These designed repeat domains harness the modular nature of repeat proteins and may possess N-terminal and C-terminal capping modules to prevent the designed repeat domains from aggregation by shielding the hydrophobic core of the domain (Forrer, P., Stumpp, M. T., Binz, H. K. and Plückthun, A., FEBS letters 539, 2-6, 2003).
- The technical problem underlying the present invention is identifying novel binding proteins, such as ankyrin repeat proteins or domains, with binding specificity to PDGF-BB to regulate PDGF-BB mediated signaling pathways for an improved treatment of certain cancers, vascular disorders such as retinal diseases, fibrotic diseases and other pathological conditions. The solution to this technical problem is achieved by providing the embodiments characterized in the claims.
- The present invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain, wherein said ankyrin repeat domain binds PDGF-BB in PBS with a Kd below 10−7M.
- More particularly, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain, wherein said ankyrin repeat domain competes for binding to PDGF-BB with an ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60, or wherein said ankyrin repeat domain is selected from the group consisting of SEQ ID NOs:23 to 60 wherein G at
position 1 and/or S at position 2 of said ankyrin repeat domain are optionally missing; and L at the second last position and/or N at the last position of said ankyrin repeat domain are optionally exchanged by A. - In a further embodiment, the invention relates to a recombinant PDGF-BB binding protein comprising at least one ankyrin repeat domain, which comprises an ankyrin repeat module having an amino acid sequence selected from the group consisting of SEQ ID NO: 12, 14, 15, 17, 18 and 19 and sequences, wherein up to 9 amino acids in SEQ ID NO: 12, 14, 15, 17, 18 and 19 are exchanged by any amino acid.
- In particular the invention relates to a recombinant PDGF-BB binding protein comprising a peptide of any one of the sequences SEQ ID NO: 12 to 19 and 23 to 61.
- The invention further relates to nucleic acid molecules encoding the binding proteins of the present invention, and to a pharmaceutical composition comprising one or more of the above mentioned binding proteins or nucleic acid molecules.
- The invention further relates to a method of treatment of a pathological condition using the binding proteins of the invention.
-
FIG. 1 . Inhibition of NHI-3T3 Fibroblast Proliferation - Inhibition of proliferation of NIH-3T3 fibroblasts by various concentrations of a DARPin with specificity for PDGF-BB (exemplified by DARPin #49) and a corresponding fitted inhibition curve are shown. The IC50 value was then calculated from the fitted inhibition curve to be 1.9 nM for DARPin #49.
- OD, optical density at 450 nm; C, concentration of DARPin #49 in nM; D1, DARPin #49. The X axis is shown in logarithmic scale. See below for the definition of DARPin #49.
-
FIG. 2 . PDGFRbeta Competition Assay. - The inhibition of the binding of PDGF-BB to PDGFRbeta by various concentrations of DARPins with specificity for PDGF-BB and the corresponding fitted inhibition curves are shown for a distinct single experiment. The IC50 values were then calculated to be about 20 and 18 pM for the DARPins #50 (D1) and #28 (D2), respectively. OD, optical density at 450 nm; C, concentration of DARPins in pM. The X axis is shown in logarithmic scale. See below for the definitions of DARPin #50 and 28.
-
FIG. 3 . Effects of an Anti-PDGF-BB DARPin vs Vehicle on the Development of Choroidal Neovascularization. - Mice were daily injected intraperitoneal with vehicle or DARPin #61-PEG20 (i.e. DARPin #61 conjugated to PEG20 over its C-terminal Cys residues by standards means (e.g. as described in WO 2011/135067)) from day 0 until day 14. At day 2 the laser burns were applied to the eye to induce choroidal neovascularization (CNV) and at day 14 the extent of CNV was measured. Symbols represent individual eyes and represent mean values of three induced CNV spots each. Bars represent median values of the individual groups. A, Area of CNV in mm2; V, vehicle (i.e. PBS); D1, DARPin #61-PEG20 in PBS at a 10 mg/kg per dose injected; D2, DARPin #61-PEG20 in PBS at a 1 mg/kg per dose injected.
- The recombinant binding protein or domain according to the invention is specific for a mammalian PDGF-BB. Preferably, the recombinant binding domain according to the invention is specific for a PDGF-BB of mice, rat, dog, rabbit, monkey or human origin. More preferably, the recombinant binding domain according to the invention is specific for a PDGF-BB of human origin.
- The term “protein” refers to a polypeptide, wherein at least part of the polypeptide has, or is able to acquire a defined three-dimensional arrangement by forming secondary, tertiary, or quaternary structures within and/or between its polypeptide chain(s). If a protein comprises two or more polypeptides, the individual polypeptide chains may be linked non-covalently or covalently, e.g. by a disulfide bond between two polypeptides. A part of a protein, which individually has, or is able to acquire, a defined three-dimensional arrangement by forming secondary or tertiary structures, is termed “protein domain”. Such protein domains are well known to the practitioner skilled in the art.
- The term “recombinant” as used in recombinant protein, recombinant protein domain, recombinant binding protein and the like, means that said polypeptides are produced by the use of recombinant DNA technologies well known by the practitioner skilled in the relevant art. For example, a recombinant DNA molecule (e.g. produced by gene synthesis) encoding a polypeptide can be cloned into a bacterial expression plasmid (e.g. pQE30, Qiagen), yeast expression plasmid or mammalian expression plasmid. When, for example, such a constructed recombinant bacterial expression plasmid is inserted into an appropriate bacteria (e.g. Escherichia coli), this bacteria can produce the polypeptide encoded by this recombinant DNA. The correspondingly produced polypeptide is called a recombinant polypeptide.
- In the context of the present invention, the term “polypeptide” relates to a molecule consisting of one or more chains of multiple, i.e. two or more, amino acids linked via peptide bonds. Preferably, a polypeptide consists of more than eight amino acids linked via peptide bonds.
- The term “polypeptide tag” refers to an amino acid sequence attached to a polypeptide/protein, wherein said amino acid sequence is useful for the purification, detection, or targeting of said polypeptide/protein, or wherein said amino acid sequence improves the physicochemical behavior of the polypeptide/protein, or wherein said amino acid sequence possesses an effector function. The individual polypeptide tags, moieties and/or domains of a binding protein may be connected to each other directly or via polypeptide linkers. These polypeptide tags are all well known in the art and are fully available to the person skilled in the art. Examples of polypeptide tags are small polypeptide sequences, for example, His (e.g. the His-tag of SEQ ID NO:9), myc, FLAG, or Strep-tags or moieties such as enzymes (for example enzymes like alkaline phosphatase), which allow the detection of said polypeptide/protein, or moieties which can be used for targeting (such as immunoglobulins or fragments thereof) and/or as effector molecules.
- The term “polypeptide linker” refers to an amino acid sequence, which is able to link, for example, two protein domains, a polypeptide tag and a protein domain, a protein domain and a non-polypeptide moiety such as polyethylene glycol or two sequence tags. Such additional domains, tags, non-polypeptide moieties and linkers are known to the person skilled in the relevant art. A list of example is provided in the description of the patent application WO 2002/020565. Particular examples of such linkers are glycine-serine-linkers and proline-threonine-linkers of variable lengths; preferably, said linkers have a length between 2 and 24 amino acids; more preferably, said linkers have a length between 2 and 16 amino acids. An example of a glycine-serine-linker is provided in SEQ ID NO:10 and an example of a proline-threonine-linker is provided in SEQ ID NO:11. Preferably, the proline-threonine-linker of SEQ ID NO:11 is preceded by GS and/or followed by GS.
- The term “polymer moiety” refers to either a proteinaceous polymer moiety or a non-proteinaceous polymer moiety. A “proteinaceous polymer moiety” preferably is a polypeptide that does not form a stable tertiary structure. Examples of proteinaceous polymer moieties are XTEN® (a registered trademark of Amunix; WO 2007/103515) polypeptides, or polypeptides comprising proline, alanine and serine residues as described in WO 2008/155134. Such proteinaceous polymer moieties can be covalently attached to, for example, a binding domain of the invention by the generation of genetic fusion polypeptides using standard DNA cloning technologies, followed by their standard expression and purification. A “non-proteinaceous polymer moiety” is a polymer moiety not built from polypeptides. Examples of non-proteinaceous polymer moieties are hydroxyethyl starch (HES), polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylene. The term “PEGylated” means that a PEG moiety is covalently attached to, for example, a polypeptide of the invention. A polymer moiety of the invention may vary widely in molecular weight. Preferably, said polymer moiety is connected by a polypeptide linker to a binding domain.
- In a specific embodiment, a PEG moiety or any other non-proteinaceous polymer can, e.g., be coupled to a cysteine thiol via a maleimide linker with the cysteine being coupled via a peptide linker to the N- or C-terminus of a binding domain as described herein.
- The term “binding protein” refers to a protein comprising one or more binding domains, one or more bioactive compounds and one or more polymer moieties as further explained below. Preferably, said binding protein comprises up to four binding domains. More preferably, said binding protein comprises up to two binding domains. Most preferably, said binding protein comprises only one binding domain. Furthermore, any such binding protein may comprise additional protein domains that are not binding domains, multimerization moieties, polypeptide tags, polypeptide linkers and/or a single Cys residue. Examples of multimerization moieties are immunoglobulin heavy chain constant regions which pair to provide functional immunoglobulin Fc domains, and leucine zippers or polypeptides comprising a free thiol which forms an intermolecular disulfide bond between two such polypeptides. The single Cys residue may be used for conjugating other moieties to the polypeptide, for example, by using the maleimide chemistry well known to the person skilled in the art. Preferably, said binding protein is a recombinant binding protein. Also preferably, the binding domains of binding protein possess different target specificities.
- The term “bioactive compound” refers to a compound that is disease modifying when applied to a mammal having said disease. A bioactive compound may have antagonistic or agonistic properties and can be a proteinaceous bioactive compound or a non-proteinaceous bioactive compound. Such proteinaceous bioactive compounds can be covalently attached to, for example, a binding domain of the invention by the generation of genetic fusion polypeptides using standard DNA cloning technologies, followed by their standard expression and purification. Such non-proteinaceous bioactive compounds can be covalently attached to, for example, a binding domain of the invention by chemical means, e.g., by coupling to a cysteine thiol via a maleimide linker with a cysteine being coupled via a peptide linker to the N- or C-terminus of a binding domain as described herein. Examples of proteinaceous bioactive compounds are binding domains having a distinct target specificity (e.g. neutralizing a growth factor by binding to it), cytokines (e.g. interleukins), growth factors (e.g. human growth hormone), antibodies and fragments thereof, hormones (e.g. GLP-1) and any possible proteinaceous drug. Examples of non-proteinaceous bioactive compounds are, toxins (e.g. DM1 from ImmunoGen), small molecules targeting GPCRs, antibiotics and any possible non-proteinaceous drug.
- The term “binding domain” means a protein domain exhibiting the same “fold” (three-dimensional arrangement) as a protein scaffold and having a predetermined property, as defined below. Such a binding domain may be obtained by rational, or most commonly, combinatorial protein engineering techniques, skills which are known in the art (Binz et al., 2005, loc. cit.). For example, a binding domain having a predetermined property can be obtained by a method comprising the steps of (a) providing a diverse collection of protein domains exhibiting the same fold as a protein scaffold as defined further below; and (b) screening said diverse collection and/or selecting from said diverse collection to obtain at least one protein domain having said predetermined property. The diverse collection of protein domains may be provided by several methods in accordance with the screening and/or selection system being used, and may comprise the use of methods well known to the person skilled in the art, such as phage display or ribosome display. Preferably, said binding domain is a recombinant binding domain.
- The term “protein scaffold” means a protein with exposed surface areas in which amino acid insertions, substitutions or deletions are highly tolerable. Examples of protein scaffolds that can be used to generate binding domains of the present invention are antibodies or fragments thereof such as single-chain Fv or Fab fragments, protein A from Staphylococcus aureus, the bilin binding protein from Pieris brassicae or other lipocalins, ankyrin repeat proteins or other repeat proteins, and human fibronectin. Protein scaffolds are known to the person skilled in the art (Binz et al., 2005, loc. cit.; Binz et al., 2004, loc. cit.).
- The term “target” refers to an individual molecule such as a nucleic acid molecule, a polypeptide or protein, a carbohydrate, or any other naturally occurring molecule, including any part of such individual molecule, or complexes of two or more of such molecules. The target may be a whole cell or a tissue sample, or it may be any non-natural molecule or moiety. Preferably, the target is a naturally occurring or non-natural polypeptide or a polypeptide containing chemical modifications, for example modified by natural or non-natural phosphorylation, acetylation, or methylation. In the particular application of the present invention, the target is PDGF-BB.
- The term “predetermined property” refers to a property such as binding to a target, blocking of a target, activation of a target-mediated reaction, enzymatic activity, and related further properties. Depending on the type of desired property, one of ordinary skill will be able to identify format and necessary steps for performing screening and/or selection of a binding domain with the desired property. Preferably, said predetermined property is binding to a target.
- The definitions hereinafter for repeat proteins are based on those in patent application WO 2002/020565. Patent application WO 2002/020565 further contains a general description of repeat protein features, techniques and applications.
- The term “repeat proteins” refers to a protein comprising one or more repeat domains. Preferably, each of said repeat proteins comprises up to four repeat domains. More preferably, each of said repeat proteins comprises up to two repeat domains. Most preferably, each of the repeat proteins comprises only one repeat domain. Furthermore, said repeat protein may comprise additional non-repeat protein domains, polypeptide tags and/or polypeptide linkers.
- The term “repeat domain” refers to a protein domain comprising two or more consecutive repeat units (modules) as structural units, wherein said structural units have the same fold, and stack tightly to create a superhelical structure having a joint hydrophobic core. Preferably, a repeat domain further comprises an N-terminal and/or a C-terminal capping unit (or module). Even more preferably, said N-terminal and/or C-terminal capping units (or modules) are capping repeats.
- The term “designed repeat protein” and “designed repeat domain” refer to a repeat protein or repeat domain, respectively, obtained as the result of the inventive procedure explained in patent application WO 2002/020565. Designed repeat proteins and designed repeat domains are synthetic and not from nature. They are man-made proteins or domains, respectively, obtained by expression of correspondingly designed nucleic acids. Preferably, the expression is done in eukaryotic or prokaryotic cells, such as bacterial cells, or by using a cell-free in vitro expression system. Accordingly, a designed ankyrin repeat protein (i.e. a DARPin) corresponds to a recombinant binding protein of the invention comprising at least one ankyrin repeat domain.
- The term “structural unit” refers to a locally ordered part of a polypeptide, formed by three-dimensional interactions between two or more segments of secondary structure that are near one another along the polypeptide chain. Such a structural unit exhibits a structural motif. The term “structural motif” refers to a three-dimensional arrangement of secondary structure elements present in at least one structural unit. Structural motifs are well known to the person skilled in the art. Structural units alone are not able to acquire a defined three-dimensional arrangement; however, their consecutive arrangement, for example as repeat modules in a repeat domain, leads to a mutual stabilization of neighboring units resulting in a superhelical structure.
- The term “repeat unit” refers to amino acid sequences comprising repeat sequence motifs of one or more naturally occurring repeat proteins, wherein said “repeat units” are found in multiple copies, and which exhibit a defined folding topology common to all said motifs determining the fold of the protein. Such repeat units correspond to the “repeating structural units (repeats)” of repeat proteins as described by Forrer et al., 2003, loc. cit. or the “consecutive homologous structural units (repeats)” of repeat proteins as described by Binz et al, 2004, loc. cit. Such repeat units comprise framework residues and interaction residues. Examples of such repeat units are armadillo repeat units, leucine-rich repeat units, ankyrin repeat units, tetratricopeptide repeat units, HEAT repeat units, and leucine-rich variant repeat units. Naturally occurring proteins containing two or more such repeat units are referred to as “naturally occurring repeat proteins”. The amino acid sequences of the individual repeat units of a repeat protein may have a significant number of mutations, substitutions, additions and/or deletions when compared to each other, while still substantially retaining the general pattern, or motif, of the repeat units.
- Accordingly, the term “ankyrin repeat unit” shall mean a repeat unit, which is an ankyrin repeat as described, for example, by Forrer et al., 2003, loc. cit. Ankyrin repeats are well known to the person skilled in the art. The term “ankyrin repeat domain” refers to a repeat domain comprising two or more consecutive ankyrin repeat units (modules) as structural units, and, preferably, an N-terminal and/or a C-terminal capping unit (or module).
- The term “framework residues” relates to amino acid residues of the repeat units, or the corresponding amino acid residues of the repeat modules, which contribute to the folding topology, i.e. which contribute to the fold of said repeat unit (or module) or which contribute to the interaction with a neighboring unit (or module). Such contribution might be the interaction with other residues in the repeat unit (or module), or the influence on the polypeptide backbone conformation as found in α-helices or β-sheets, or amino acid stretches forming linear polypeptides or loops.
- The term “target interaction residues” refers to amino acid residues of the repeat units, or the corresponding amino acid residues of the repeat modules, which contribute to the interaction with target substances. Such contribution might be the direct interaction with the target substances, or the influence on other directly interacting residues, e.g. by stabilizing the conformation of the polypeptide of a repeat unit (or module) to allow or enhance the interaction of directly interacting residues with said target. Such framework and target interaction residues may be identified by analysis of the structural data obtained by physicochemical methods, such as X-ray crystallography, NMR and/or CD spectroscopy, or by comparison with known and related structural information well known to practitioners in structural biology and/or bioinformatics.
- Preferably, the repeat units used for the deduction of a repeat sequence motif are homologous repeat units, wherein the repeat units comprise the same structural motif and wherein more than 70% of the framework residues of said repeat units are homologous to each other. Preferably, more than 80% of the framework residues of said repeat units are homologous. Most preferably, more than 90% of the framework residues of said repeat units are homologous. Computer programs to determine the percentage of homology between polypeptides, such as Fasta, Blast or Gap, are known to the person skilled in the art. Further preferably, the repeat units used for the deduction of a repeat sequence motif are homologous repeat units obtained from repeat domains selected on a defined target.
- The term “repeat sequence motif” refers to an amino acid sequence, which is deduced from one or more repeat units or repeat modules. Preferably, said repeat units or repeat modules are from repeat domains having binding specificity for the same target. Such repeat sequence motifs comprise framework residue positions and target interaction residue positions. Said framework residue positions correspond to the positions of framework residues of the repeat units (or modules). Likewise, said target interaction residue positions correspond to the positions of target interaction residues of the repeat units (or modules). Repeat sequence motifs comprise fixed positions and randomized positions. The term “fixed position” refers to an amino acid position in a repeat sequence motif, wherein said position is set to a particular amino acid. Most often, such fixed positions correspond to the positions of framework residues and/or the positions of target interaction residues that are specific for a certain target. The term “randomized position” refers to an amino acid position in a repeat sequence motif, wherein two or more amino acids are allowed at said amino acid position, for example, wherein any of the usual twenty naturally occurring amino acids are allowed, or wherein most of the twenty naturally occurring amino acids are allowed, such as amino acids other than cysteine, or amino acids other than glycine, cysteine and proline. Most often, such randomized positions correspond to the positions of target interaction residues. However, some positions of framework residues may also be randomized.
- The term “folding topology” refers to the tertiary structure of said repeat units or repeat modules. The folding topology will be determined by stretches of amino acids forming at least parts of α-helices or β-sheets, or amino acid stretches forming linear polypeptides or loops, or any combination of α-helices, β-sheets and/or linear polypeptides/loops. For example, an ankyrin repeat unit/module consists of a β-turn, followed by two antiparallel α-helices and a loop that reaches the turn of the next repeat unit/module.
- The term “consecutive” refers to an arrangement, wherein the repeat units or repeat modules are arranged in tandem. In designed repeat proteins, there are at least 2, usually about 2 to 6, in particular at least about 6, frequently 20 or more repeat units (or modules). In most cases, repeat units (or modules) of a repeat domain will exhibit a high degree of sequence identity (same amino acid residues at corresponding positions) or sequence similarity (amino acid residues being different, but having similar physicochemical properties), and some of the amino acid residues might be key residues being strongly conserved. However, a high degree of sequence variability by amino acid insertions and/or deletions, and/or substitutions between the different repeat units (or modules) of a repeat domain may be possible as long as the common folding topology of the repeat units (or modules) is maintained.
- Methods for directly determining the folding topology of repeat proteins by physico-chemical means such as X-ray crystallography, NMR or CD spectroscopy, are well known to the practitioner skilled in the art. Methods for identifying and determining repeat units or repeat sequence motifs or for identifying families of related proteins comprising such repeat units or motifs, such as homology searches (BLAST etc.), are well established in the field of bioinformatics, and are well known to the practitioner in the art. The step of refining an initial repeat sequence motif may comprise an iterative process.
- The term “repeat modules” refers to the repeated amino acid sequences of the designed repeat domains, which are originally derived from the repeat units of naturally occurring repeat proteins. Each repeat module comprised in a repeat domain is derived from one or more repeat units of the family or subfamily of naturally occurring repeat proteins, e.g. the family of armadillo repeat proteins or ankyrin repeat proteins. Further preferably, each repeat module comprised in a repeat domain comprises a repeat sequence motif deduced from homologous repeat units obtained from repeat domains selected on a target, for example as described in Example 1 and having the same target specificity.
- Accordingly, the term “ankyrin repeat module” shall mean a repeat module, which is originally derived from the repeat units of naturally occurring ankyrin repeat proteins. Ankyrin repeat proteins are well known to the person skilled in the art.
- “Repeat modules” may comprise positions with amino acid residues present in all copies of corresponding repeat modules (“fixed positions”) and positions with differing or “randomized” amino acid residues (“randomized positions”).
- The term “capping module” refers to a polypeptide fused to the N- or C-terminal repeat module of a repeat domain, wherein said capping module forms tight tertiary interactions (i.e. tertiary structure interactions) with said repeat module thereby providing a cap that shields the hydrophobic core of said repeat module at the side not in contact with the consecutive repeat module from the solvent. Said N- and/or C-terminal capping module may be, or may be derived from, a capping unit or other structural unit found in a naturally occurring repeat protein adjacent to a repeat unit. The term “capping unit” refers to a naturally occurring folded polypeptide, wherein said polypeptide defines a particular structural unit which is N- or C-terminally fused to a repeat unit, wherein said polypeptide forms tight tertiary structure interactions with said repeat unit thereby providing a cap that shields the hydrophobic core of said repeat unit at one side from the solvent. Preferably, capping modules or capping units are capping repeats. The term “capping repeat” refers to capping module or capping unit having a similar or the same fold as said adjacent repeat unit (or module) and/or sequence similarities to said adjacent repeat unit (or module). Capping modules and capping repeats are described in WO 2002/020565 and by Interlandi et al., 2008 (loc. cit.). Examples of N-terminal ankyrin capping modules (i.e. N-terminal capping repeats) are SEQ ID NO:1 to 3 and examples of ankyrin C-terminal capping modules (i.e. C-terminal capping repeats) are SEQ ID NO:4 to 8, 13 and 16.
- For example, the N-terminal ankyrin capping module of SEQ ID NO:49 is encoded by the amino acids from
position 1 to 32 and the C-terminal capping module of SEQ ID NO:49 is encoded by the amino acids form position 132 to 159. - A recombinant binding protein according to the invention comprises at least one ankyrin repeat domain, wherein said ankyrin repeat domain has binding specificity for mammalian PDGF-BB.
- The term “has binding specificity for a target”, “specifically binding to a target” or “target specificity” and the like means that a binding protein or binding domain binds in PBS to a target with a lower dissociation constant than to an unrelated protein such as the E. coli maltose binding protein (MBP). Preferably, the dissociation constant in PBS for the target is at least 10, more preferably at least 102, even more preferably at least 103, or most preferably at least 104 times lower than the corresponding dissociation constant for MBP.
- Recombinant binding proteins comprising an ankyrin repeat domain with binding specificity for PDGF-BB are shown in the Examples.
- In particular, the invention relates to a recombinant binding protein as defined herein comprising an ankyrin repeat domain with binding specificity for PDGF-BB, which binds PDGF-BB in PBS with a dissociation constant (Kd) below 10−6M. Preferably, said ankyrin repeat domain binds PDGF-BB with a Kd in PBS below 10−7M, more preferably below 10−8M, 10−9M, 10−10M, or most preferably below 10−11M.
- Methods to determine dissociation constants of protein-protein interactions, such as surface plasmon resonance (SPR) based technologies (e.g. SPR equilibrium analysis) or isothermal titration calorimetry (ITC) are well known to the person skilled in the art. The measured Kd values of a particular protein-protein interaction can vary if measured under different conditions (e.g., salt concentration, pH). Thus, measurements of Kd values are preferably made with standardized solutions of protein and a standardized buffer, such as PBS.
- Recombinant binding proteins comprising an ankyrin repeat domain binding PDGF-BB with a Kd in PBS below 10−6M are shown in Example 2.
- Preferred is a recombinant binding protein comprising an ankyrin repeat domain with binding specificity for human PDGF-BB.
- Further preferred is a recombinant binding protein comprising an ankyrin repeat domain comprising between 70 and 300 amino acids, in particular between 90 and 200 amino acids.
- A binding domain of the invention is an ankyrin repeat domain or a designed ankyrin repeat domain, preferably as described in WO 2002/020565. Examples of designed ankyrin repeat domains with binding specificity for PDGF-BB are shown in the Examples.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein the ankyrin repeat domain inhibits the binding of PDGF-BB to PDGFRbeta in PBS with an IC50 value below 10−7M. Preferably, said ankyrin repeat domain inhibits the binding of PDGF-BB to PDGFRbeta in PBS with an IC50 value below 10−7M, more preferably below 10−8M, 10−9M, 10−10M, or most preferably below 10−11M.
- The half maximal inhibitory concentration (IC50) is a measure of the effectiveness of a compound, such as a binding domain of the invention, in inhibiting a biological, biochemical or biophysical function. Methods to determine IC50 values of inhibition of protein-protein interactions, such as competition ELISAs are well known to the person skilled in the art. The measured IC50 values of a particular inhibitor of a protein-protein interaction can vary if measured under different conditions (e.g., salt concentration, pH). Thus, measurements of IC50 values are preferably made with standardized solutions of protein and a standardized buffer, such as PBS.
- Recombinant binding proteins comprising an ankyrin repeat domain inhibiting the binding of PDGF-BB to PDGFRbeta in PBS with an IC50 value below 10−7M are shown in Example 4.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for PDGF-BB, which inhibits the PDGF-BB stimulated proliferation of NIH-3T3 fibroblasts (ATCC, cat number: CRL-1658) with an IC50 value below 10−6M. Preferably, said repeat domain inhibits the PDGF-BB stimulated proliferation of NIH-3T3 fibroblasts with an IC50 value below 10−7M, more preferably below 10−8M, 10−9M, 10−10M, or most preferably 10−11M.
- NIH-3T3 cells are responsive to PDGF-BB for growth and as such can be used to measure the functional inhibitory capability of the compounds of the invention. NIH-3T3 cells are grown in culture medium and then starved of nutrients for 7 hours prior to addition of PDGF-BB and a titration of the anti-PDGF-BB DARPin. Assessment of the ability of the compounds of the invention to inhibit PDGF-BB is determined by the proliferative capacity of the NIH-3T3 cells as measured by standard measurements well known to the person skilled in the art. Recombinant binding proteins comprising an ankyrin repeat domain inhibiting the PDGF-BB stimulated proliferation of NIH-3T3 fibroblasts with an IC50 value below 10−6M are shown in Example 3.
- The invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for PDGF-BB, wherein said binding protein and/or ankyrin repeat domain has a midpoint denaturation temperature (Tm) above 40° C. upon thermal unfolding in PBS and forms less than 5% (w/w) insoluble aggregates at concentrations up to 10 g/L when incubated at 37° C. for 1 day in PBS.
- The term “PBS” means a phosphate buffered water solution containing 137 mM NaCl, 10 mM phosphate and 2.7 mM KCl and having a pH of 7.4.
- Preferably, the recombinant binding protein and/or binding domain has a midpoint denaturation temperature (Tm) above 45° C., more preferably above 50° C., more preferably above 55° C., and most preferably above 60° C. upon thermal unfolding in PBS at pH 7.4. A binding protein or a binding domain of the invention possesses a defined secondary and tertiary structure under physiological conditions. Thermal unfolding of such a polypeptide results in a loss of its tertiary and secondary structure, which can be followed, for example, by circular dichroism (CD) measurements. The midpoint denaturation temperature of a binding protein or binding domain upon thermal unfolding corresponds to the temperature at the midpoint of the cooperative transition in physiological buffer upon heat denaturation of said protein or domain by slowly increasing the temperature from 10° C. to about 100° C. The determination of a midpoint denaturation temperature upon thermal unfolding is well known to the person skilled in the art. This midpoint denaturation temperature of a binding protein or binding domain upon thermal unfolding is indicative of the thermal stability of said polypeptide.
- Also preferred is a recombinant binding protein and/or ankyrin repeat domain forming less than 5% (w/w) insoluble aggregates at concentrations up to 20 g/L, preferably up 40 g/L, more preferably up to 60 g/L, even more preferably up to 80 g/L, and most preferably up to 100 g/L when incubated for over 5 days, preferably over 10 days, more preferably over 20 days, more preferably over 40 days, and most preferably over 100 days at 37° C. in PBS. The formation of insoluble aggregates can be detected by the appearance of visual precipitations, gel filtration or dynamic light scattering, which strongly increases upon formation of insoluble aggregates. Insoluble aggregates can be removed from a protein sample by centrifugation at 10,000×g for 10 minutes. Preferably, a recombinant binding protein and/or ankyrin repeat domain forms less than 2%, more preferably less than 1%, 0.5%, 0.2%, 0.1%, or most preferably less than 0.05% (w/w) insoluble aggregates under the mentioned incubation conditions at 37° C. in PBS. Percentages of insoluble aggregates can be determined by separation of the insoluble aggregates from soluble protein, followed by determination of the protein amounts in the soluble and insoluble fraction by standard quantification methods.
- Also preferred is a recombinant binding protein and/or ankyrin repeat domain that does not lose its native three-dimensional structure upon incubation in PBS containing 100 mM dithiothreitol (DTT) for 1 or 10 hours at 37° C.
- In one particular embodiment the invention relates to a recombinant binding protein comprising an ankyrin repeat domain, specifically binding to PDGF-BB and having the indicated or preferred midpoint denaturation temperature and non-aggregating properties as defined above.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein the ankyrin repeat domain competes for binding to a mammalian PDGF-BB with an ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60; preferably SEQ ID NOs: 24, 45 and 50, in particular SEQ ID NO:24 and 50.
- Also preferably said ankyrin repeat domain competes for binding to a mammalian PDGF-BB with a binding protein selected from the group of DARPins #23 to 60. Preferably, said repeat domain competes for binding to a mammalian PDGF-BB with a binding protein from the group of DARPins #24, 45 and 50. More preferably, said ankyrin repeat domain competes for binding to a mammalian PDGF-BB with binding protein DARPin #24 or 50.
- The term “compete for binding” means the inability of two different binding domains of the invention to bind simultaneously to the same target, while both are able to bind the same target individually. Thus, such two binding domains compete for binding to said target. Preferably, said two competing binding domains bind to an overlapping or the same binding epitope on said target. Methods, such as competition Enzyme-Linked Immuno Sorbent Assay (ELISA) or competition SPR measurements (e.g. by using the Proteon instrument from BioRad), to determine if two binding domains compete for binding to a target, are well known to the practitioner in the art. For example, the ankyrin repeat domain of SEQ ID No: #49 or SEQ ID No: #58 competes for binding to human PDGF with the ankyrin repeat domain of SEQ ID No: #50.
- The term “epitope” means the specific site on the surface of a target protein, such as PDGF-BB, to which a binding domain of the invention, such as an ankyrin repeat domain, attaches itself. This term is defined in analogy to epitopes of antibodies, which are well known to the person skilled in the art. If two binding domains of the invention bind to the same epitope, they will compete for binding for PDGF-BB. The exact molecular arrangement of an epitope can be elucidated, for example, by protein X-ray crystallography (a method well known to the person skilled in the art) of the binding domain of the invention in complex with PDGF-BB.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain comprises an amino acid sequence that has at least 70% amino acid sequence identity with one ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60,
- wherein G at
position 1 and/or S at position 2 of said ankyrin repeat domain are optionally missing; and - L at the second last position and/or N at the last position of said ankyrin repeat domain are optionally exchanged by A.
- Preferably, such an ankyrin repeat domain in a recombinant binding protein of the invention comprises an amino acid sequence that has at least 70% amino acid sequence identity with one ankyrin repeat domain selected from the group consisting of SEQ ID NO: 24, 45 and 50; more preferably, 24 and 50.
- Preferably, such an ankyrin repeat domain in a recombinant binding protein of the invention comprises an amino acid sequence with at least 70% amino acid sequence identity, for example 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity with one, two or three ankyrin repeat modules present between the N-terminal and C-terminal capping modules of an ankyrin repeat domain selected from the group consisting of SEQ ID NOs: 23 to 60.
- Preferably, instead of 70% amino acid sequence identity, such an ankyrin repeat domain or such one, two or three repeat modules present between the N-terminal and C-terminal capping modules in an ankyrin repeat domain in a recombinant binding protein of the invention comprises an amino acid sequence with at least 75%, more preferably at least 76%, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, or most preferred at least 95% amino acid sequence identity. Preferably, the mentioned percentages of amino acid sequence identity is in the framework positions.
- Preferably, up to 30 amino acids, for example 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or no amino acid(s) in the repeat domains SEQ ID NO:23 to 60 are exchanged by another amino acid. In particular, up to 25 amino acids, more preferably up to 20 amino acids, more preferably up to 15 amino acids, even more preferably up to 11 amino acids, more preferably up to 8 amino acids, more preferably up to 5 amino acids, more preferably up to 2 amino acid, and most preferably no amino acid in SEQ ID NO: 23 to 60 is exchanged.
- Preferably, when amino acids are exchanged in the capping modules of SEQ ID NO:13 or 16, the repeat modules of SEQ ID NO:12, 14, 15, 17, 18 and 19 or the repeat domains of SEQ ID NO:23 to 60, these amino acids are selected from the group consisting of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y; more preferably from the group consisting of A, D, E, H, I, K, L, Q, R, S, T, V, and Y. Also preferably, an amino acid is exchanged by a homologous amino acid; i.e. an amino acid is exchanged by an amino acid having a side chain with similar biophysical properties. For example, the negative charged amino acid D may be replaced by the negative charged amino acid E, or a hydrophobic amino acid such as L may be replaced by A, I or V. The techniques of exchanging an amino acid by another amino acid in a polypeptide are well known to the person skilled in the art.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain is selected from the group consisting of SEQ ID NOs: 23 to 60,
- wherein G at
position 1 and/or S at position 2 of said ankyrin repeat domain are optionally missing; and - L at the second last position and/or N at the last position of said ankyrin repeat domain are optionally exchanged by A.
- Preferably, such an ankyrin repeat domain is selected from the group consisting of SEQ ID NO: 24, 45 and 50; more preferably, 24 and 50.
- In a further embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain attaches to the same epitope as an ankyrin repeat domain selected from the group consisting of SEQ ID NOs:23 to 60. Preferably, such an ankyrin repeat domain is selected from the group consisting of SEQ ID NO: 24, 45 and 50; more preferably, 24 and 50.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain comprises an ankyrin repeat module having an amino acid sequence selected from the group consisting of SEQ ID NO:12, 14, 15, 17, 18 and 19 and sequences, wherein up to 9 amino acids in SEQ ID NO:12, 14, 15, 17, 18 and 19 are exchanged by any amino acid.
- Preferably, such an ankyrin repeat module of said ankyrin repeat domain is selected from the group consisting of SEQ ID NO: 12, 14 and 17; more preferably, 12 and 17.
- Preferably, up to 8 amino acids in the repeat modules of SEQ ID NO:12, 14, 15, 17, 18 and 19 are exchanged by another amino acid, more preferably up to 7 amino acids, more preferably up to 6 amino acids, more preferably up to 5 amino acids, even more preferably up to 4 amino acids, more preferably up to 3 amino acids, more preferably up to 2 amino acids, and most preferably 1 amino acid. Preferably, the mentioned exchanges of amino acid are in the framework positions. Accordingly, up to 8 amino acids in framework positions of SEQ ID NO:12, 14, 15, 17, 18 and 19 are exchanged by any amino acid, preferably up to 7, 6, 5, 4, 3 or 2 amino acids, and most preferably 1 amino acid.
- In a further embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDEEGTTPLHYAAVWGHLEIVEVLLKAGADVNA (SEQ ID NO:12) and sequences, wherein up to 9 amino acids in SEQ ID NO:11 are exchanged by any amino acid and wherein
- E at position 3 is optionally exchanged by an amino acid selected from the group consisting of D, W, Q, I and Y, preferably of D and W;
- E at position 4 is optionally exchanged by an amino acid selected from the group consisting of T, D, Y, and S, preferably of T and D;
- T at position 6 is optionally exchanged by an amino acid selected from the group consisting of S and F, preferably by S;
- Y at position 11 is optionally exchanged by F;
- V at position 14 is optionally exchanged by an amino acid selected from the group consisting of A, Y and T, preferably by A; and
- W at position 15 is optionally exchanged by an amino acid selected from the group consisting of F, K, V, and Y, preferably of F and Y.
- In a further embodiment, the invention relates to a recombinant binding protein comprising at least one ankyrin repeat domain with binding specificity for a mammalian PDGF-BB, wherein said ankyrin repeat domain comprises a capping module having an amino acid sequence selected from the group consisting of SEQ ID NO:13 and 16 and sequences, wherein up to 9 amino acids in SEQ ID NO:13 and 16 are exchanged by any amino acid.
- Preferably, up to 8 amino acids in the capping modules of SEQ ID NO:13 and 16 comprised in said ankyrin repeat domain are exchanged by an other amino acid, more preferably up to 7 amino acids, more preferably up to 6 amino acids, more preferably up to 5 amino acids, even more preferably up to 4 amino acids, more preferably up to 3 amino acids, more preferably up to 2 amino acids, more preferably up to 1 amino acid, and most preferably no amino acid in SEQ ID NO:13 and 16 is exchanged.
- In yet another embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a C-terminal capping module with the sequence QDIYGATPADLAALVGHEDIAEVLQKLN (SEQ ID NO:13) and sequences, wherein up to 9 amino acids in SEQ ID NO:13 are exchanged by any amino acid wherein
- I at position 3 is optionally exchanged by an amino acid selected from the group consisting of K, L, A and V, preferably L, A and V;
- Y at position 4 is optionally exchanged by an amino acid selected from the group consisting of W. F and S, preferably, of W and F;
- A at position 6 is optionally exchanged by K;
- L at position 14 is optionally exchanged by an amino acid selected from the group consisting of F, Y and D, preferably of F and Y;
- V at position 15 is optionally exchanged by an amino acid selected from the group consisting of L, I, A and N, preferably, L and I; and
- V at position 23 is exchanged by an amino acid selected from the group consisting of I and L.
- Preferred is a recombinant binding protein, wherein the ankyrin repeat domain comprises the ankyrin repeat module of SEQ ID NO:12 and the C-terminal capping module SEQ ID NO:13. Preferably, said C-terminal capping module directly follows said ankyrin repeat module in said ankyrin repeat domain.
- In yet another embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDQEGTTPLHFAASVGHLEIVEVLLKAGADVNA (SEQ ID NO:15) and sequences, wherein up to 9 amino acids in SEQ ID NO:15 are exchanged by any amino acid and wherein
- Q at position 3 is optionally exchanged by A;
- E at position 4 is optionally exchanged by D;
- T at position 6 is optionally exchanged by E;
- F at position 11 is optionally exchanged by Y;
- S at position 14 is optionally exchanged by V; and
- V at position 15 is optionally exchanged by W.
- In yet another embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a C-terminal capping module with the sequence QDHYGATPADLAALIGHEDIAEVLQKLN (SEQ ID NO:16) and sequences, wherein up to 9 amino acids in SEQ ID NO:15 are exchanged by any amino acid and wherein
- H at position 3 is optionally exchanged by I; and
- Y at position 4 is optionally exchanged by W.
- In yet another embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDLNGQTPLHLAADIGHLEIVEVLLKAGADVNA (SEQ ID NO:17) and sequences, wherein up to 9 amino acids in SEQ ID NO:17 are exchanged by any amino acid and wherein
- K at
position 1 is optionally exchanged by Q or I; - L at position 3 is optionally exchanged by N; and
- A at position 27 is optionally exchanged by H.
- In yet another embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDYAGSTPLRLAAWAGHLEIVEVLLKAGADVNA (SEQ ID NO:18) and sequences, wherein up to 9 amino acids in SEQ ID NO:18 are exchanged by any amino acid and wherein
- K at
position 1 is optionally exchanged by Q; - W at position 14 is optionally exchanged by H;
- A at position 15 is optionally exchanged by V; and
- A at position 27 is optionally exchanged by N or Y.
- In yet another embodiment, the invention relates to a recombinant binding protein, wherein the ankyrin repeat domain with binding specificity to PDGF-BB comprises a repeat module with the ankyrin repeat sequence KDYFGYTPLHLAAYFGHLEIVEVLLKAGADVNA (SEQ ID NO:19) and sequences, wherein up to 9 amino acids in SEQ ID NO:19 are exchanged by any amino acid and wherein
- K at
position 1 is optionally exchanged by N; - A at position 12 is optionally exchanged by T;
- A at position 13 is optionally exchanged by T;
- E at position 22 is optionally exchanged by D;
- A at position 27 is optionally exchanged by H or Y.
- Further preferred is a N-terminal or C-terminal ankyrin capping module comprising an N-terminal or C-terminal ankyrin capping repeat, respectively, wherein one or more of the amino acids residues in said capping repeat are replaced by an amino acid residue found at the corresponding position on alignment of a corresponding ankyrin capping unit or ankyrin repeat unit.
- The replacement of amino acids can be by any of the 20 most often naturally occurring amino acids, preferably by amino acids selected from the group consisting of A, D, E, F, H, I, K, L, M, N, Q, R, S, T, V, W and Y; and more preferably from the group consisting of A, D, E, H, I, K, L, Q, R, S, T, V, and Y. Also preferably, the replacement of amino acids is by a homologous amino acid; i.e. an amino acid is replaced by an amino acid having a side chain with similar biophysical properties. For example, the negative charged amino acid D may be replaced by the negative charged amino acid E, or a hydrophobic amino acid such as L may be replaced by A, I or V. The replacement of an amino acid by a homologous amino acid is well known to the person skilled in the art.
- Also preferred is a C-terminal ankyrin capping module comprising the amino acid A at position 27 and 28 of any of the above C-terminal capping modules based on SEQ ID NO:4 to 8, 13 and 16.
- Also preferred is a C-terminal capping module comprising the amino acids from
position 1 to 26 or fromposition 1 to 27 of any of the above C-terminal capping modules based on SEQ ID NO:4 to 8, 13 and 16. - Amino acids G at
position 1 and/or S at position 2 of SEQ ID NO:1 to 3 can be removed from N-terminal ankyrin capping modules without any apparent influence on the properties. These two amino acids serve as linkers to connect the ankyrin repeat domain to further amino acids and proteins. The invention also comprises such ankyrin repeat domains comprising N-terminal ankyrin capping modules wherein G atposition 1 and/or S at position 2 are removed. It is understood that the amino acid positions (e.g. “position 33”) in an ankyrin repeat domain as defined herein are adapted accordingly, resulting in a number shift, e.g. “position 33” will become “position 32”, if one amino acid is missing, or “position 33” will become “position 31”, if two amino acid are missing. - An ankyrin capping module of an ankyrin repeat domain of the invention can be exchanged by an ankyrin capping module by combining techniques, such as alignment of amino acid sequences, mutagenesis and gene synthesis, known to the person skilled in the art. For example, the C-terminal capping repeat of SEQ ID NO:49 can be replaced by the C-terminal capping repeat of SEQ ID NO:8 by (i) determination of the C-terminal capping repeat of SEQ ID NO:49 (i.e. sequence position 132 to 159) by sequence alignment with SEQ ID NO:8, (ii) replacing the sequence of the determined C-terminal capping repeat of SEQ ID NO:49 with the sequence of SEQ ID NO:8, (iii) generation of a gene encoding the repeat domain encoding the exchanged C-terminal capping module, (iv) expressing of the modified repeat domain in the cytoplasm of E. coli and (v) purification of the modified repeat domain by standard means. As a further example, the N-terminal capping repeat of SEQ ID NO:49 can be replaced by the N-terminal capping repeat of SEQ ID NO:2 by (i) determination of the N-terminal capping repeat of SEQ ID NO:49 (i.e.
sequence position 1 to 32) by sequence alignment with SEQ ID NO:2, (ii) replacing the sequence of the determined N-terminal capping repeat of SEQ ID NO:49 with the sequence of SEQ ID NO:2, (iii) generation of a gene encoding the repeat domain encoding the exchanged N-terminal capping module, (iv) expressing of the modified repeat domain in the cytoplasm of E. coli and (v) purification of the modified repeat domain by standard means. - Furthermore, an ankyrin repeat domain of the invention can be constructed genetically by assembling a N-terminal ankyrin capping module (e.g. the N-terminal capping repeat of SEQ ID NO:2) followed by one or more repeat modules (e.g. the three ankyrin repeat modules comprising the amino acid residues from position 33 to 131 of SEQ ID NO:49) and a C-terminal capping module (e.g. the C-terminal capping repeat of SEQ ID NO:8) by means of gene synthesis. The genetically assembled repeat domain gene can then be expressed in E. coli as described above.
- Further preferred is a recombinant binding protein, repeat domain, repeat module, N-terminal capping module or C-terminal capping module having an amino acid sequence devoid of amino acids C, M or N.
- Further preferred is a recombinant binding protein, repeat domain, repeat module, N-terminal capping module or C-terminal capping module having an amino acid sequence devoid of amino acid N followed by G.
- Further preferred is a recombinant binding protein or repeat domain comprising any such N-terminal or C-terminal capping module.
- In a further preferred embodiment of a recombinant binding protein comprising an ankyrin repeat domain according to the present invention, one or more of the amino acid residues of the N-terminal capping module of said repeat domain is exchanged by an amino acid residue found at the corresponding position on alignment of an N-terminal capping unit. Preferably, up to 30% of the amino acid residues are exchanged, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged. Most preferably, such an N-terminal capping unit is a naturally occurring N-terminal capping unit.
- In a further preferred embodiment of a recombinant binding protein comprising an ankyrin repeat domain according to the present invention, one or more of the amino acid residues of the C-terminal capping module of said repeat domain is exchanged by an amino acid residue found at the corresponding position on alignment of a C-terminal capping unit. Preferably, up to 30% of the amino acid residues are exchanged, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged. Most preferably, such a C-terminal capping unit is a naturally occurring C-terminal capping unit.
- In still another particular embodiment, up to 30% of the amino acid residues, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged with amino acids which are not found in the corresponding positions of repeat units, N-terminal capping units or C-terminal capping units.
- The term “consensus sequence” refers to an amino acid sequence, wherein said consensus sequence is obtained by structural and/or sequence aligning of multiple repeat units. Using two or more structural and/or sequence aligned repeat units, and allowing for gaps in the alignment, it is possible to determine the most frequent amino acid residue at each position. The consensus sequence is that sequence which comprises the amino acids which are most frequently represented at each position. In the event that two or more amino acids are represented above-average at a single position, the consensus sequence may include a subset of those amino acids. Said two or more repeat units may be taken from the repeat units comprised in a single repeat protein, or from two or more different repeat proteins.
- Consensus sequences and methods to determine them are well known to the person skilled in the art.
- A “consensus amino acid residue” is the amino acid found at a certain position in a consensus sequence. If two or more, e.g. three, four or five, amino acid residues are found with a similar probability in said two or more repeat units, the consensus amino acid may be one of the most frequently found amino acids or a combination of said two or more amino acid residues.
- Further preferred are non-naturally occurring capping modules, repeat modules, binding proteins or binding domains.
- The term “non-naturally occurring” means synthetic or not from nature, more specifically, the term means made from the hand of man. The term “non-naturally occurring binding protein” or “non-naturally occurring binding domain” means that said binding protein or said binding domain is synthetic (i.e. produced by chemical synthesis from amino acids) or recombinant and not from nature. “Non-naturally occurring binding protein” or “non-naturally occurring binding domain” is a man-made protein or domain, respectively, obtained by expression of correspondingly designed nucleic acids. Preferably, the expression is done in eukaryotic or bacterial cells, or by using a cell-free in vitro expression system. Further, the term means that the sequence of said binding protein or said binding domain is not present as a non-artificial sequence entry in a sequence database, for example in GenBank, EMBL-Bank or Swiss-Prot. These databases and other similar sequence databases are well known to the person skilled in the art.
- In one particular embodiment the invention relates to a recombinant binding protein comprising an ankyrin repeat domain specifically binding to PDGF-BB and further comprising an ankyrin repeat domain specifically binding to vascular endothelial growth factors A (VEGF-A). Examples of ankyrin repeat domains with specificity for PDGF-BB are given herein and examples of ankyrin repeat domains with specificity to VEGF-A are described in WO 2010/060748 (US 2011/0207668) and WO 2011/135067 (US 2013/0116197), the entire disclosures of which are incorporated by reference herein. Such two repeat domains can be linked by a polypeptide linker by genetic means by methods known to the person skilled in the art. In one embodiment of the invention, a recombinant binding protein comprising an ankyrin repeat domain specifically binding PDGF-BB and an ankyrin repeat domain specifically binding VEGF-A may be used to treat diseases of the retina and choroidal neovascular diseases, such as exudative age-related macular degeneration, polypoidal choroidal neovascularization, and pathological myopia.
- Another preferred embodiment is a recombinant binding protein comprising an ankyrin repeat domain with binding specificity for PDGF-BB comprising one, two, three or more internal repeat modules that will participate in binding to PDGF-BB. Preferably, such an ankyrin repeat domain comprises an N-terminal capping module, two to four internal repeat modules, and a C-terminal capping module. Preferably, said capping modules are capping repeats. Also preferably, said capping modules will participate in binding to PDGF-BB.
- Further preferred is a recombinant binding protein comprising two or more of said ankyrin repeat domains with binding specificity for PDGF-BB. Preferably, said binding protein comprises 2 or 3 of said repeat domains. Said two or more repeat domains have the same or different amino acid sequence.
- In a further preferred embodiment of a recombinant binding protein comprising an ankyrin repeat domain according to the present invention, one or more of the amino acid residues of the repeat modules of said ankyrin repeat domain are exchanged by an amino acid residue found at the corresponding position on alignment of a repeat unit. Preferably, up to 30% of the amino acid residues are exchanged, more preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged. Most preferably, such a repeat unit is a naturally occurring repeat unit.
- In still another particular embodiment, up to 30% of the amino acid residues, for example 29%, 28%, 27%, 26%, 25%, 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or 0% of the amino acid residues are exchanged with amino acids which are not found in the corresponding positions of repeat units. More preferably, up to 20%, and even more preferably, up to 10% of the amino acid residues are exchanged with amino acids which are not found in the corresponding positions of repeat units.
- In further embodiments, any of the recombinant PDGF-BB binding proteins or domains described herein may be covalently bound to one or more additional moieties, including, for example, a moiety that binds to a different target to create a dual-specificity binding agent, a bioactive compound, a labeling moiety (e.g. a fluorescent label such as fluorescein, or a radioactive tracer), a moiety that facilitates protein purification (e.g. a small peptide tag, such as a His- or strep-tag), a moiety that provides effector functions for improved therapeutic efficacy (e.g. the Fc part of an antibody to provide antibody-dependent cell-mediated cytotoxicity, a toxic protein moiety such as Pseudomonas aeruginosa exotoxin A (ETA) or a small molecular toxic agent such as maytansinoids or DNA alkylating agents) or a moiety that provides improved pharmacokinetics. Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing. In some instances, it is desirable to improve the continuity of the serum concentration of the protein over time (e.g., decrease the difference in serum concentration of the protein between the concentration shortly after administration and the concentration shortly before the next administration). Moieties that tend to slow clearance of a protein from the blood include hydroxyethyl starch (HES), polyethylene glycol (PEG), sugars (e.g. sialic acid), well-tolerated protein moieties (e.g. Fc fragments or serum albumin), and binding domains or peptides with specificity and affinity for abundant serum proteins, such as antibody Fc fragments or serum albumin. Examples of such binding domains with affinity for serum albumin are provided in WO 2012/069654. The recombinant binding protein of the invention may be attached to a moiety that reduces the clearance rate of polypeptides in a mammal (e.g. in mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptides.
- In a further embodiment, the invention relates to nucleic acid molecules encoding the particular recombinant binding proteins, the particular ankyrin repeat domains, the particular ankyrin repeat modules and the particular capping modules. Further, a vector comprising said nucleic acid molecule is considered.
- Further, a pharmaceutical composition comprising one or more of the above mentioned recombinant binding proteins, in particular binding proteins comprising repeat domains, or nucleic acid molecules encoding the particular binding proteins, and optionally a pharmaceutical acceptable carrier and/or diluent is considered. Pharmaceutical acceptable carriers and/or diluents are known to the person skilled in the art and are explained in more detail below. Even further, a diagnostic composition comprising one or more of the above mentioned recombinant binding proteins, in particular binding proteins comprising repeat domains, is considered.
- A pharmaceutical composition comprises recombinant binding proteins as described above and a pharmaceutically acceptable carrier, excipient or stabilizer, for example as described in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. [1980]. Suitable carriers, excipients or stabilizers known to the skilled man are saline, Ringer's solution, dextrose solution, Hank's solution, fixed oils, ethyl oleate, 5% dextrose in saline, substances that enhance isotonicity and chemical stability, buffers and preservatives. Other suitable carriers include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids and amino acid copolymers. A pharmaceutical composition may also be a combination formulation, comprising an additional active agent, such as an anti-cancer agent or an anti-angiogenic agent.
- The formulations to be used for in vivo administration must be aseptic or sterile. This is readily accomplished by filtration through sterile filtration membranes.
- The pharmaceutical composition may be administered by any suitable method within the knowledge of the person skilled in the art.
- Further, any of the above mentioned pharmaceutical composition is considered for the treatment of a disorder.
- The invention further provides methods of treatment. The method comprises administering, to a patient in need thereof, a therapeutically effective amount of a recombinant binding protein of the invention, that is, an amount that is sufficient to produce a desired effect on a patient.
- Further, a method of treating a pathological condition in a mammal including man, comprising administering to a patient in need thereof an effective amount of the above mentioned pharmaceutical composition is considered.
- Examples of such pathological conditions are atherosclerosis, restenosis, pulmonary hypertension, ocular and retinal diseases and fibrotic diseases, including pulmonary fibrosis, liver cirrhosis, scleroderma, glomerulosclerosis and cardiac fibrosis. In addition, anti-PDGF-BB therapy is useful for oncology pathological conditions, such as gliomas, sarcomas, leukemias, lymphomas and epithelial cancers.
- The recombinant binding protein or ankyrin repeat domain according to the invention may be obtained and/or further evolved by several methods such as display on the surface of bacteriophages (WO 1990/002809, WO 2007/006665) or bacterial cells (WO 1993/010214), ribosomal display (WO 1998/048008), display on plasmids (WO 1993/008278) or by using covalent RNA-repeat protein hybrid constructs (WO 2000/032823), or intracellular expression and selection/screening such as by protein complementation assay (WO 1998/341120). Such methods are known to the person skilled in the art.
- A library of ankyrin repeat proteins used for the selection/screening of a recombinant binding protein or ankyrin repeat domain according to the invention may be obtained according to protocols known to the person skilled in the art (WO 2002/020565, Binz, H. K., et al., J. Mol. Biol., 332, 489-503, 2003, and Binz et al., 2004, loc. cit). The use of such libraries for the selection of ankyrin repeat domains with specificity for PDGF-BB is exemplified in Example 1. Furthermore, ankyrin repeat domains of the present invention may be modularly assembled from ankyrin repeat modules according to the current invention and appropriate capping modules or capping repeats (Forrer, P., et al., FEBS letters 539, 2-6, 2003) using standard recombinant DNA technologies (e.g. WO 2002/020565, Binz et al., 2003, loc. cit. and Binz et al., 2004, loc. cit).
- The invention is not restricted to the particular embodiments described in the Examples. Other sources may be used and processed following the general outline described below.
- All of the starting materials and reagents disclosed below are known to those skilled in the art, and are available commercially or can be prepared using well-known techniques.
- Materials
- Chemicals were purchased from Fluka (Switzerland). Oligonucleotides were from Microsynth (Switzerland). Unless stated otherwise, DNA polymerases, restriction enzymes and buffers were from New England Biolabs (USA) or Fermentas (Lithuania). The cloning and protein production strain was E. coli XL1-blue (Stratagene, USA) or BL21 (Novagen, USA). Recombinant human and murine PDGF-BB was purchased from Reliatech (Germany; product numbers 200-055 and M10-125, respectively). Biotinylated PDGF-BB was obtained chemically via coupling of the biotin moiety to primary amines of the protein using standard biotinylation reagents and methods (Pierce, USA).
- Molecular Biology
- Unless stated otherwise, methods are performed according to described protocols (Sambrook J., Fritsch E. F. and Maniatis T., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory 1989, New York).
- Designed Ankyrin Repeat Protein Libraries
- Methods to generate designed ankyrin repeat protein libraries are described (WO 2002/020565; Binz et al. 2003, loc. cit.; Binz et al. 2004, loc. cit.). By such methods designed ankyrin repeat protein libraries having randomized ankyrin repeat modules and/or randomized capping modules can be constructed. For example, such libraries could accordingly be assembled based on a fixed N-terminal capping module (e.g. the N-terminal capping module of SEQ ID NO: 2) or a randomized N-terminal capping module according to SEQ ID NO: 64, one or more randomized repeat modules according to the sequence motif of SEQ ID NO: 20, 62 or 63, and a fixed C-terminal capping module (e.g. the C-terminal capping module of SEQ ID NO: 8) or a randomized C-terminal capping module according to SEQ ID NO: 65. Preferably, such libraries are assembled to not have the amino acids C, G, M, N (in front of a G residue) or P at randomized positions of repeat or capping modules. In addition, randomized repeat modules according to the sequence motif of SEQ ID NO: 20, 62 or 63 could be further randomized at
position 10 and/or position 17; the randomized N-terminal capping module according to the sequence motif of SEQ ID NO: 64 could be further randomized atposition 7 and/or position 9; and the randomized C-terminal capping modules according to the sequence motif of SEQ ID NO: 65 could be further randomized atpositions 10, 11 and/or 17. - Furthermore, such randomized modules in such libraries may comprise additional polypeptide loop insertions with randomized amino acid positions. Examples of such polypeptide loop insertions are complement determining region (CDR) loop libraries of antibodies or de novo generated peptide libraries. For example, such a loop insertion could be designed using the structure of the N-terminal ankyrin repeat domain of human ribonuclease L (Tanaka, N., Nakanishi, M, Kusakabe, Y, Goto, Y., Kitade, Y, Nakamura, K. T., EMBO J. 23(30), 3929-3938, 2004) as guidance. In analogy to this ankyrin repeat domain where ten amino acids are inserted in the beta-turn present close to the boarder of two ankyrin repeats, ankyrin repeat proteins libraries may contain randomized loops (with fixed and randomized positions) of variable length (e.g. 1 to 20 amino acids) inserted in one or more beta-turns of an ankyrin repeat domain.
- Any such N-terminal capping module of an ankyrin repeat protein library preferably possesses the RELLKA or RILKAA motif instead of the RILLAA motif (e.g. present from position 21 to 26 in SEQ ID NO:64) and any such C-terminal capping module of an ankyrin repeat protein library preferably possesses the KAA or KLA motif instead of the KLN motif (e.g. the last three amino acids in SEQ ID NO:65).
- The design of such an ankyrin repeat protein library may be guided by known structures of an ankyrin repeat domain interacting with a target. Examples of such structures, identified by their Protein Data Bank (PDB) unique accession or identification codes (PDB-IDs), are 1WDY, 3V31, 3V30, 3V2X, 3V20, 3UXG, 3TWQ-3TWX, 1N11, 1S70 and 2ZGD.
- Examples of designed ankyrin repeat protein libraries, such as the N2C and N3C designed ankyrin repeat protein libraries, are described (WO 2002/020565; Binz et al. 2003, loc. cit.; Binz et al. 2004, loc. cit.). The digit in N2C and N3C describes the number of randomized repeat modules present between the N-terminal and C-terminal capping modules.
- The nomenclature used to define the positions inside the repeat units and modules is based on Binz et al. 2004, loc. cit. with the modification that borders of the ankyrin repeat modules and ankyrin repeat units are shifted by one amino acid position. For example,
position 1 of an ankyrin repeat module of Binz et al. 2004 (loc. cit.) corresponds to position 2 of a ankyrin repeat module of the current disclosure and consequently position 33 of a ankyrin repeat module of Binz et al. 2004, loc. cit. corresponds to position 1 of a following ankyrin repeat module of the current disclosure. - All the DNA sequences were confirmed by sequencing, and the calculated molecular weight of all described proteins was confirmed by mass spectrometry.
- Using ribosome display (Hanes, J. and Plückthun, A., PNAS 94, 4937-42, 1997) many designed ankyrin repeat proteins (DARPins) with binding specificity for PDGF-BB were selected from DARPin libraries as described by Binz et al. 2004 (loc. cit.). The binding of the selected clones toward specific (PDGF-BB) and unspecific (MBP, E. coli maltose binding protein) targets was assessed by crude extract ELISA indicating that hundreds PDGF-BB binding proteins were successfully selected. For example, the ankyrin repeat domains of SEQ ID NO: 23 to 61 constitute amino acid sequences of selected binding proteins comprising an ankyrin repeat domain with binding specificity for PDGF-BB. Individual ankyrin repeat modules from such ankyrin repeat domains with binding specificity to PDGF-BB are provided in SEQ ID NO: 12, 14, 15, 17, 18 and 19. Individual capping modules of such ankyrin repeat domains with binding specificity to PDGF-BB are provided in SEQ ID NO: 13 and 16.
- Selection of PDGF-BB Specific Ankyrin Repeat Proteins by Ribosome Display
- The selection of PDGF-BB specific ankyrin repeat proteins was performed by ribosome display (Hanes and Plückthun, loc. cit.) using human and mouse PDGF-BB as target proteins, libraries of designed ankyrin repeat proteins as described above and established protocols (Zahnd, C., Amstutz, P. and Plückthun, A., Nat. Methods 4, 69-79, 2007). The number of reverse transcription (RT)-PCR cycles after each selection round was constantly reduced from 40 to 30, adjusting to the yield due to enrichment of binders. The first four rounds of selection employed standard ribosome display selection, using decreasing target concentration and increasing washing stringency to increase selection pressure from
round 1 to round 4 (Binz et al. 2004, loc. cit.). To enrich high affinity anti-PDGF-BB DARPins, the output from the fourth round of standard ribosome display selection (above) was subjected to an off-rate selection round with increased selection stringency (Zahnd, 2007, loc. cit.). A final standard selection round was performed to amplify and recover the off-rate selected binding proteins. - Selected Clones Bind Specifically to PDGF-BB as Shown by Crude Extract ELISA
- Individual selected DARPins specifically binding PDGF-BB were identified by an enzyme-linked immunosorbent assay (ELISA) using crude Escherichia coli extracts of DARPin expression cells using standard protocols. DARPins selected by ribosome display were cloned into the pQE30 (Qiagen) expression vector, transformed into E. coli XL1-Blue (Stratagene) and then grown overnight at 37° C. in a 96-deep-well plate (each clone in a single well) containing 1 ml growth medium (2YT containing 1% glucose and 100 μg/ml ampicillin). 1 ml of fresh 2YT containing 50 μg/ml ampicillin was inoculated with 100 μl of the overnight culture in a fresh 96-deep-well plate. After incubation for 2 h at 37° C., expression was induced with IPTG (1 mM final concentration) and continued for 3 h. Cells were harvested, resuspended in 100 μl B-PERII (Pierce) and incubated for 15 min at room temperature with shaking. Then, 900 μl PBS-TC (PBS supplemented with 0.25% Casein hydrolysate, 0.1% Tween 20®, pH 7.4) were added and cell debris were removed by centrifugation. 100 μl of each lysed clone were applied to a well of a Neutravidin coated MaxiSorp plate containing either PDGF-BB or the unrelated MBP immobilized via their biotin moiety and incubated for 1 h at RT. After extensive washing with PBS-T (PBS supplemented with 0.1% Tween 20®, pH 7.4) the plate was developed using standard ELISA procedures using the monoclonal horse-radish-labeled anti-RGS(His)4 antibody (34650, Qiagen) Binding was then detected by POD substrate (Roche). The color development was measured at 405 nm. Screening of several hundred clones by such a crude cell extract ELISA revealed more than hundred different DARPins with specificity for PDGF-BB. These binding proteins were chosen for further analysis. Examples of amino acid sequences of selected ankyrin repeat domains that specifically bind to PDGF-BB are provided in SEQ ID NO:23 to 61.
- These ankyrin repeat domains with binding specificity for PDGF-BB and negative control DARPins with no binding specificity for PDGF-BB (i.e. DARPin #21 and #22) were cloned into a pQE (QIAgen, Germany) based expression vector providing an N-terminal His-tag to facilitate simple protein purification as described below. Thus, expression vectors encoding the following DARPins were constructed:
- DARPin #21 (SEQ ID NO:21 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #22 (SEQ ID NO:22 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #23 (SEQ ID NO:23 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #24 (SEQ ID NO:24 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #25 (SEQ ID NO:25 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #26 (SEQ ID NO:26 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #27 (SEQ ID NO:27 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #28 (SEQ ID NO:28 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #29 (SEQ ID NO:29 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #30 (SEQ ID NO:30 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #31 (SEQ ID NO:31 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #32 (SEQ ID NO:32 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #33 (SEQ ID NO:33 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #34 (SEQ ID NO:34 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #35 (SEQ ID NO:35 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #36 (SEQ ID NO:36 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #37 (SEQ ID NO:37 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #38 (SEQ ID NO:38 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #39 (SEQ ID NO:39 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #40 (SEQ ID NO:40 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #41 (SEQ ID NO:41 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #42 (SEQ ID NO:42 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #43 (SEQ ID NO:43 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #44 (SEQ ID NO:44 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #45 (SEQ ID NO:45 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #46 (SEQ ID NO:46 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #47 (SEQ ID NO:47 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #48 (SEQ ID NO:48 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #49 (SEQ ID NO:49 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #50 (SEQ ID NO:50 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #51 (SEQ ID NO:51 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #52 (SEQ ID NO:52 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #53 (SEQ ID NO:53 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #54 (SEQ ID NO:54 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #55 (SEQ ID NO:55 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #56 (SEQ ID NO:56 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #57 (SEQ ID NO:57 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #58 (SEQ ID NO:58 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #59 (SEQ ID NO:59 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #60 (SEQ ID NO:60 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- DARPin #61 (SEQ ID NO:61 with a His-tag (SEQ ID NO:9) fused to its N-terminus);
- High Level and Soluble Expression of DARPins
- For further analysis, the selected clones showing specific PDGF-BB binding in the crude cell extract ELISA as described above were expressed in E. coli BL21 or XL1-Blue cells and purified using their His-tag using standard protocols. 50 ml of stationary overnight cultures (TB, 1% glucose, 100 mg/l of ampicillin; 37° C.) were used to inoculate 1 l cultures (same medium without glucose). At an absorbance of 0.7 (1 for BL21) at 600 nm, the cultures were induced with 0.5 mM IPTG and incubated at 37° C. for 4-5 h. The cultures were centrifuged and the resulting pellets were resuspended in 40 ml of TBS500 (50 mM Tris-HCl, 500 mM NaCl, pH 8) and sonicated. The lysate was recentrifuged, and glycerol (10% (v/v) final concentration) and imidazole (20 mM final concentration) were added to the resulting supernatant. Proteins were purified over a Ni-nitrilotriacetic acid column (2.5 ml column volume) according to the manufacturer's instructions (QIAgen, Germany). Alternatively, DARPins or selected repeat domains devoid of a 6× His-tag were purified by anion exchange chromatography followed by size exclusion chromatography according to standard resins and protocols known to the person skilled in the art. Up to 200 mg of highly soluble DARPins with binding specificity to PDGF-BB can be purified from one liter of E. coli culture with a purity >95% as estimated from SDS-15% PAGE. Such purified DARPins are used for further characterizations.
- Biotinylated PDGF-BB molecules from human and mouse were immobilized in a flow cell through binding to coated Streptavidin and the interaction with various selected DARPins was analyzed.
- Surface Plasmon Resonance (SPR) Analysis
- SPR was measured using a ProteOn instrument (BioRad) and measurement was performed according standard procedures known to the person skilled in the art. The running buffer was PBS, pH 7.4, containing 0.005% Tween 20®. Neutravidin was covalently immobilized on a GLC chip (BioRad) to a level of about 8000 resonance units (RU). Immobilization of PDGF-BB on the neutravidin coated chip was then performed. The interaction of DARPin PDGF-BB was then measured by injecting 100 μl running buffer (PBS containing 0.005% Tween®) containing serial dilutions of DARPins of concentration of 12.5, 6.26, 3.13 and 1.67 nM (on-rate measurement), followed by a running buffer flow for between 10 minutes and up to to 3 hours at a constant flow rate of 30 μl/min (off-rate measurement). The signals (i.e. resonance unit (RU) values) of an uncoated reference cell and a reference injection (i.e. injection of running buffer only) were subtracted from the RU traces obtained after injection of PDGF-BB (double-referencing). From the SRP traces obtained from the on-rate and off-rate measurements the on- and off-rate of the corresponding DARPin PDGF-BB interaction can be determined.
- The results are summarized in Table 1. Dissociation constants (Kd) were calculated from the estimated on- and off-rates using standard procedures known to the person skilled in the art.
-
TABLE 1 Dissociation constants of DARPin PDGF-BB interactions (human and mouse) determined by SPR DARPin# Kd [M] (human) Kd [M] (mouse) 23 2.14E−11 1.72E−11 24 3.01E−11 n.d. 25 1.47E−11 1.28E−11 26 1.77E−11 1.74E−11 28 1.71E−11 n.d. 29 1.05E−10 n.d. 30 1.10E−10 n.d. 31 1.09E−10 n.d. 32 6.38E−11 8.34E−11 33 8.06E−11 9.04E−11 34 7.75E−11 5.92E−11 35 9.56E−11 9.81E−11 36 2.42E−11 5.30E−11 37 1.52E−10 8.28E−11 38 9.41E−11 5.83E−11 39 1.72E−10 3.82E−10 40 3.44E−11 6.08E−11 42 8.05E−11 9.74E−11 43 1.29E−06 1.51E−06 44 7.68E−11 9.02E−11 45 1.08E−10 n.d. 46 1.12E−10 n.d. 47 9.37E−11 n.d. 48 1.13E−10 1.21E−10 49 7.69E−11 1.02E−10 50 1.15E−10 n.d. 51 1.21E−10 n.d. 53 1.28E−10 n.d. 54 2.45E−10 n.d. 55 5.55E−11 n.d. 56 1.50E−10 n.d. 57 1.23E−10 n.d. 58 2.57E−10 n.d. 59 1.71E−10 n.d. n.d.: not determined. - NIH-3T3 fibroblast cells are a standard cell line used for assays involving PDGF-BB. On
day 1 at 70%-80% confluence, the cells were harvested and seeded in a 96-well culture plate with density of 5000 cells/well in a growth medium, followed by starving of cells around 7-8 hours later by changing of medium to assay medium and incubated for 24 hours. All incubation condition was 37° C. with 5% CO2 flow. Following the starving of cells, on day 2 the media was changed into a fresh assay media containing the dilution series of growth factor human PDGF-BB (for the proliferation assay) or a inhibition mixture of 20 ng/mL human PDGF-BB with a 2.5-fold dilution series of DARPins (200 nM to 0.05 nM) for the inhibition assay. The cells were incubated for another 48 h in this condition upon the addition of 20 μL of WST-1 reagent (Roche product no. 11644807001). This reagent enables a colorimetric assay that analyzes the number of viable cells. Readout of the signals was done at A450 nm with a correction background at A600 nm at several time points of 2, 4 and 6 hours after the addition of WST-1. - Example results are summarized in Table 2. IC50 values were calculated from the titration curves obtained as described above using GraphPad Prism software and standard procedures known to the person skilled in the art. An example titration curve is given for DARPin #49 in
FIG. 1 . -
TABLE 2 Inhibition potency by various DARPins of NIH- 3T3 cell proliferation induced by PDGF-BB DARPin# IC50 [nM] 24 1.4 28 1.6 30 3.2 49 1.9 59 2.0 - The potency of PEGylated anti-PDGF-BB DARPins to inhibit the binding of human PDGF-BB to its receptor PDGFRbeta was determined in a in a receptor competition ELISA (based on PDGF-BB Quantikine, R&D Systems). PDGFRbeta/Fc chimera has been pre-coated on a microplate. The DARPins were preincubated in assay diluent from the PDGF-BB Quantikine kit (R&D Systems) with a defined amount of PDGF-BB and incubated at room temperature for 2 hours with shaking at 750 rpm. These preincubation mixtures were then transferred into the precoated wells and any PDGF-BB that is not blocked by the DARPins was bound by the immobilized receptor. After washing away any unbound substances, a horse radish peroxidase-linked polyclonal antibody specific for PDGF-BB was added to the wells. Following a wash to remove any unbound antibody-enzyme reagent, a substrate solution was added to the wells and color was developing in proportion to the amount of PDGF-BB bound. The color development was stopped and the intensity of the color was measured at 405 nm. In this assay, the tested DARPins showed high PDGF-BB inhibition potency as summarized in Table 3. Example titration curves are given for a set of DARPins in
FIG. 2 . IC50 values were calculated from such titration curves obtained as described above using Graph Pad Prism software and standard procedures known to the person skilled in the art. -
TABLE 3 Inhibition of the PDGF-BB interaction with its receptor PDGFRbeta by DARPins (mean IC50 values are given) DARPin# IC50 [pM] 23 22 24 15 28 16 29 15 30 490 31 480 34 210 37 >400 38 85 44 130 45 160 46 150 47 140 49 66 50 32 51 8 52 68 53 36 54 210 55 14 56 170 57 204 58 470 - The effect on the growth of neovessels was tested in vivo. A mouse laser choroidal neovascularization model was chosen and performed as published described (Takahashi, K., Saishin, Y., Saishin, Y., King, A. G., Levin, R. and Campochiaro, P. A., Arch. Ophthalmol. 127(4), 494-499, 2009).
- Choroidal neovascularization (CNV) was induced by laser photocoagulation-induced rupture of Bruch's membrane as previously described. On day 2, adult C57BL/6 mice were anesthetized with ketamine hydrochloride (100 mg/kg body weight), and pupils were dilated with 1% tropicamide. Three burns of 532 nm diode laser photocoagulation (75 μm spot size, 0.1 seconds duration, 120 mW) were delivered to each retina with the slit lamp delivery system of an OcuLight GL diode laser using a handheld cover slip as a contact lens to view the retina. Burns were performed in the 9, 12, and 3 o'clock positions of the posterior pole of the retina. Production of a bubble at the time of laser, which indicates rupture of Bruch's membrane, is an important factor in obtaining choroidal neovascularization, and therefore, only burns in which a bubble was produced were included in the study. DARPin #61-PEG20 was administered daily with a concentration of 10 or 1 mg/kg, respectively, as indicated in
FIG. 3 . On day 14, mice were heart perfused with fluorescein-labeled dextran, retinal flat-mounts were prepared as described (Takahashi et al., loc cit) and the area of neovascularization was quantified by image analysis. Statistical analysis was performed using 1-way ANOVA and Dunnett post-test to compare all DARPin groups to the vehicle group. These techniques are all known to persons skilled in the art. The results are presented inFIG. 3 .
Claims (3)
1-27. (canceled)
28. A method of treating a condition selected from exudative age-related macular degeneration, polypoidal choroidal neovascularization, and pathological myopia, the method comprising the step of administering, to a patient in need of such treatment, a therapeutically effect amount of a recombinant binding protein comprising at least one ankyrin repeat domain, wherein said ankyrin repeat domain binds PDGF-BB in PBS with a Kd below 10−7M.
29. A method of treating a condition selected from exudative age-related macular degeneration, polypoidal choroidal neovascularization, and pathological myopia, the method comprising the step of administering, to a patient in need of such treatment, a therapeutically effect amount of a binding protein comprising an ankyrin repeat domain specifically binding PDGF-BB and an ankyrin repeat domain specifically binding VEGF-A.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/847,403 US20150368302A1 (en) | 2012-06-28 | 2015-09-08 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP12174020.3 | 2012-06-28 | ||
| EP12174020 | 2012-06-28 | ||
| US13/928,973 US9163070B2 (en) | 2012-06-28 | 2013-06-27 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
| US14/847,403 US20150368302A1 (en) | 2012-06-28 | 2015-09-08 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/928,973 Division US9163070B2 (en) | 2012-06-28 | 2013-06-27 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20150368302A1 true US20150368302A1 (en) | 2015-12-24 |
Family
ID=48699826
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/928,973 Active US9163070B2 (en) | 2012-06-28 | 2013-06-27 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
| US14/847,403 Abandoned US20150368302A1 (en) | 2012-06-28 | 2015-09-08 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/928,973 Active US9163070B2 (en) | 2012-06-28 | 2013-06-27 | Designed ankyrin repeat proteins binding to platelet-derived growth factor |
Country Status (16)
| Country | Link |
|---|---|
| US (2) | US9163070B2 (en) |
| EP (1) | EP2867360B1 (en) |
| JP (1) | JP2015522576A (en) |
| KR (1) | KR20150023957A (en) |
| CN (1) | CN104508129A (en) |
| AU (1) | AU2013283296A1 (en) |
| BR (1) | BR112014032316A2 (en) |
| CA (1) | CA2877584A1 (en) |
| HK (1) | HK1209156A1 (en) |
| IL (1) | IL236428A0 (en) |
| IN (1) | IN2014MN02522A (en) |
| MX (1) | MX2014015825A (en) |
| RU (1) | RU2014150224A (en) |
| SG (1) | SG11201408196RA (en) |
| WO (1) | WO2014001442A1 (en) |
| ZA (1) | ZA201408872B (en) |
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160251404A1 (en) * | 2013-05-31 | 2016-09-01 | Molecular Partners Ag | Designed ankyrin repeat proteins binding to hepatocyte growth factor |
| WO2019162472A1 (en) | 2018-02-22 | 2019-08-29 | Universität Zürich | Ligands to gm-csf or gm-csf-receptor for use in treatment of a haematologic malignancy in a patient having undergone allo-hct |
| WO2019180243A1 (en) | 2018-03-22 | 2019-09-26 | Charité-Universitätsmedizin Berlin | Crispr associated protein reactive t cell immunity |
| WO2019238966A1 (en) | 2018-06-15 | 2019-12-19 | Universität Bern | LIGANDS TO LIGHT OR ITS RECEPTOR LTßR FOR USE IN HAEMATOLOGIC MALIGNANCIES |
| EP3623382A1 (en) | 2018-09-14 | 2020-03-18 | Universität Zürich | Ligands to gm-csf or gm-csf-receptor for use in leukemia in a patient having undergone allo-hct |
| WO2020074469A1 (en) | 2018-10-08 | 2020-04-16 | Universität Zürich | Her2-binding tetrameric polypeptides |
| WO2020104627A1 (en) | 2018-11-21 | 2020-05-28 | Universität Zürich | Photochemically induced conjugation of radiometals to small molecules, peptides and nanoparticles in a simultaneous one-pot reaction |
| EP3677911A2 (en) | 2019-01-03 | 2020-07-08 | Universität Basel | Use of non-agonist ligands for suppression of metastasis |
| WO2020144378A1 (en) | 2019-01-11 | 2020-07-16 | Universitätsspital Basel | Sglt-2 inhibitors or il-1r antagonists for reduction of hypoglycaemia after bariatric surgery |
| WO2020207771A1 (en) | 2019-04-10 | 2020-10-15 | Universität Zürich | A method for determining the likelihood of a patient being responsive to cancer immunotherapy |
| WO2020245173A1 (en) * | 2019-06-04 | 2020-12-10 | Molecular Partners Ag | Recombinant fap binding proteins and their use |
| WO2021044050A1 (en) | 2019-09-05 | 2021-03-11 | Genome Biologics Ug | Inhibition of mthfd1l for use in hypertrophic heart disease and heart failure |
| WO2021122813A1 (en) | 2019-12-16 | 2021-06-24 | Universität Basel | Angiogenesis promoting agents for prevention of metastatic cancer |
| WO2021176008A1 (en) | 2020-03-04 | 2021-09-10 | Cornell University | Agents targeting baf155 or brg1 for use in treatment of advanced prostate cancer |
| WO2021204781A1 (en) | 2020-04-06 | 2021-10-14 | Universität Zürich | Artc1 ligands for cancer treatment |
| WO2021239999A1 (en) | 2020-05-28 | 2021-12-02 | Universität Zürich | Il-12 pd-l1 ligand fusion protein |
| WO2021239844A1 (en) | 2020-05-27 | 2021-12-02 | Universitätsspital Basel | Sglt-2 inhibitors or il-1r antagonists for reduction of hypoglycaemia in prediabetes |
| WO2022038193A1 (en) | 2020-08-18 | 2022-02-24 | Universität Zürich | A cd25-biased anti-il-2 antibody |
| WO2022171831A1 (en) | 2021-02-11 | 2022-08-18 | Universität Zürich | Use of markers found on lymph node metastatic samples for the prognosis of breast cancer |
| WO2023012348A1 (en) | 2021-08-05 | 2023-02-09 | Immunos Therapeutics Ag | A modified hla-b57 with increased expression levels |
| WO2023012350A1 (en) | 2021-08-05 | 2023-02-09 | Immunos Therapeutics Ag | Combination medicaments comprising hla fusion proteins |
| WO2023021006A1 (en) | 2021-08-16 | 2023-02-23 | Universität Zürich | Il-1 targeting agents for treatment of pitiyriasis rubra pilaris |
| WO2023036849A1 (en) | 2021-09-07 | 2023-03-16 | ETH Zürich | Identifying and predicting future coronavirus variants |
| EP4163380A1 (en) | 2021-10-08 | 2023-04-12 | ETH Zurich | Device and method for manipulation of extracellular vesicles |
| WO2023110942A1 (en) | 2021-12-14 | 2023-06-22 | Charité-Universitätsmedizin Berlin | Prevention of impaired fracture healing |
| EP4260907A1 (en) | 2022-04-11 | 2023-10-18 | Universität Zürich | Agents for treatment of endometriosis and other benign gynecological neoplasms |
| WO2024002914A1 (en) | 2022-06-27 | 2024-01-04 | Charité-Universitätsmedizin Berlin | Prediction of, and composition to improve, tendon healing |
| WO2024133013A1 (en) | 2022-12-19 | 2024-06-27 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e. V. | Means and methods to target endogenous condensates |
| WO2024165671A1 (en) | 2023-02-08 | 2024-08-15 | Immunos Therapeutics Ag | FUSION PROTEINS OF ß2 MICROGLOBULIN, HLA HEAVY CHAIN POLYPEPTIDES, AND INHIBITOR OF CD47-SIRPA |
| WO2025008519A1 (en) | 2023-07-05 | 2025-01-09 | Universität Bern | Il-1ra blockers for treatment and prevention of sepsis |
| WO2025021293A1 (en) | 2023-07-25 | 2025-01-30 | Universität Zürich | Disruption of rbr1 expression in plant cells |
| WO2025202503A1 (en) | 2024-03-28 | 2025-10-02 | Universität Zürich | Extracellular vesicles carrying cancer specific splice variants |
Families Citing this family (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AR081361A1 (en) | 2010-04-30 | 2012-08-29 | Molecular Partners Ag | MODIFIED UNION PROTEINS THAT INHIBIT THE RECEPTOR INTERACTION OF THE VASCULAR ENDOTELIAL GROWTH FACTOR FROM GLICOPROTEIN TO VEGF-A |
| CN113278077A (en) | 2010-11-26 | 2021-08-20 | 分子组合公司 | Designed repeat proteins that bind to serum albumin |
| PL2846836T3 (en) | 2012-05-07 | 2020-01-31 | Allergan, Inc. | Method of treating amd in patients refractory to anti-vegf therapy |
| EP2738180A1 (en) | 2012-11-30 | 2014-06-04 | Molecular Partners AG | Binding proteins comprising at least two binding domains against HER2. |
| CN106605228B (en) | 2014-07-07 | 2019-08-16 | 耶达研究及发展有限公司 | Method for calculating protein design |
| US20170226158A1 (en) * | 2014-08-11 | 2017-08-10 | Medimmune Limited | Intracellular antigen binding |
| AU2015345322A1 (en) | 2014-11-10 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-PDGF-B antibodies and methods of use |
| AU2015345321A1 (en) | 2014-11-10 | 2017-04-20 | F. Hoffmann-La Roche Ag | Anti-ANG2 antibodies and methods of use |
| CA2963175A1 (en) | 2014-11-10 | 2016-05-19 | F. Hoffmann-La Roche Ag | Bispecific antibodies and methods of use in ophthalmology |
| SG11201702550WA (en) | 2014-11-10 | 2017-04-27 | Hoffmann La Roche | ANTI-IL-1beta ANTIBODIES AND METHODS OF USE |
| BR112017020986A2 (en) | 2015-04-02 | 2018-08-14 | Molecular Partners Ag. | recombinant binding proteins and their use |
| US10283384B2 (en) * | 2015-04-27 | 2019-05-07 | Taiwan Semiconductor Manufacturing Co., Ltd. | Method for etching etch layer and wafer etching apparatus |
| ES2953516T3 (en) | 2016-09-22 | 2023-11-14 | Molecular Partners Ag | Recombinant binding proteins and their use |
| US10037890B2 (en) * | 2016-10-11 | 2018-07-31 | Lam Research Corporation | Method for selectively etching with reduced aspect ratio dependence |
| US11127483B2 (en) | 2017-03-07 | 2021-09-21 | Igc Bio, Inc. | Computational pipeline for antibody modeling and design |
| EP3980443A1 (en) | 2019-06-04 | 2022-04-13 | Molecular Partners AG | Multispecific proteins |
| CN114222757A (en) * | 2019-06-04 | 2022-03-22 | 分子伴侣公司 | Recombinant 4-1BB binding proteins and uses thereof |
| BR112022011177A2 (en) | 2019-12-11 | 2022-09-27 | Molecular Partners Ag | ANCHYRIN REPETITION DOMAINS DESIGNED WITH ALTERED SURFACE RESIDUES |
| WO2021224686A1 (en) | 2020-05-06 | 2021-11-11 | Molecular Partners Ag | Novel ankyrin repeat binding proteins and their uses |
| EP4149959A1 (en) | 2020-05-14 | 2023-03-22 | Molecular Partners AG | Multispecific proteins |
| CA3202358A1 (en) | 2020-12-16 | 2022-06-23 | Andreas BOSSHART | Novel slow-release prodrugs |
| JP2024509890A (en) | 2021-03-09 | 2024-03-05 | モレキュラー パートナーズ アクチェンゲゼルシャフト | Protease cleavable prodrugs |
| US20240150475A1 (en) | 2021-03-09 | 2024-05-09 | Molecular Partners Ag | Novel darpin based cd123 engagers |
| JP2024508969A (en) | 2021-03-09 | 2024-02-28 | モレキュラー パートナーズ アクチェンゲゼルシャフト | Novel DARPin-based CD33 engager |
| IL305677A (en) | 2021-03-09 | 2023-11-01 | Molecular Partners Ag | A new derpin based on multispecific T-cell phases |
| EP4447990A1 (en) | 2021-12-14 | 2024-10-23 | Molecular Partners AG | Designed repeat domains with dual binding specificity and their use |
| WO2024028278A1 (en) | 2022-08-01 | 2024-02-08 | Molecular Partners Ag | Charge modified designed repeat domains and their use |
| WO2024038307A1 (en) | 2022-08-19 | 2024-02-22 | Novartis Ag | Dosing regimens for sars-cov-2 binding molecules |
| EP4673159A1 (en) | 2023-02-27 | 2026-01-07 | Molecular Partners AG | Darpins for use in reducing renal accumulation of drugs |
| WO2025146491A1 (en) | 2024-01-05 | 2025-07-10 | Molecular Partners Ag | Designed repeat domains with dual binding specificity for cd117 and cd47-binding agent |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7417130B2 (en) * | 2000-09-08 | 2008-08-26 | University Of Zurich | Collection of repeat proteins comprising repeat modules |
| US20110207668A1 (en) * | 2008-11-03 | 2011-08-25 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
| US20120277143A1 (en) * | 2011-04-29 | 2012-11-01 | Steven Jacobs | IL4/IL13 Binding Repeat Proteins and Uses |
| US20130116197A1 (en) * | 2010-04-30 | 2013-05-09 | Hans Kaspar Binz | Modified binding proteins inhibiting the vegf-a receptor interaction |
| US20130244940A1 (en) * | 2010-11-26 | 2013-09-19 | Molecular Partners Ag | Designed repeat proteins binding to serum albumin |
Family Cites Families (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5094941A (en) * | 1987-12-31 | 1992-03-10 | Zymogenetics, Inc. | Monoclonal antibodies to PDGF |
| EP0768377A1 (en) | 1988-09-02 | 1997-04-16 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5270170A (en) | 1991-10-16 | 1993-12-14 | Affymax Technologies N.V. | Peptide library and screening method |
| US5348867A (en) | 1991-11-15 | 1994-09-20 | George Georgiou | Expression of proteins on bacterial surface |
| CA2196496A1 (en) | 1997-01-31 | 1998-07-31 | Stephen William Watson Michnick | Protein fragment complementation assay for the detection of protein-protein interactions |
| JP4086325B2 (en) | 1997-04-23 | 2008-05-14 | プリュックテュン,アンドレアス | Method for identifying a nucleic acid molecule encoding a (poly) peptide that interacts with a target molecule |
| PT1137812E (en) | 1998-12-02 | 2007-05-31 | Adnexus Therapeutics Inc | Dna-protein fusions and uses thereof |
| JP2005512962A (en) * | 2001-09-20 | 2005-05-12 | アレクシオン ファーマシューティカルズ, インコーポレイテッド | Method for producing anti-PDGF antibody and designed antibody |
| NZ592039A (en) | 2003-08-27 | 2013-03-28 | Ophthotech Corp | Combination therapy for the treatment of ocular neovascular disorders |
| EP2292246A1 (en) * | 2004-11-12 | 2011-03-09 | Bayer Schering Pharma Aktiengesellschaft | Recombinant Newcastle Disease Virus |
| US7875465B2 (en) * | 2005-05-31 | 2011-01-25 | Canon Kabushiki Kaisha | Target substance capturing molecule |
| MX2008000345A (en) | 2005-07-08 | 2008-04-02 | Univ Zuerich | Phage display using cotranslational translocation of fusion polypeptides. |
| DK2402754T4 (en) | 2006-03-06 | 2023-08-28 | Amunix Operating Inc | Unstructured recombinant polymers and uses thereof |
| JP5351889B2 (en) | 2007-06-21 | 2013-11-27 | テクニシェ ユニバーシタット ミュンヘン | Biologically active proteins with increased in vivo and / or in vitro stability |
| EP2222709B1 (en) * | 2007-11-30 | 2016-11-23 | Glaxo Group Limited | Antigen-binding constructs |
| WO2009100990A1 (en) * | 2008-02-13 | 2009-08-20 | Dsm Ip Assets B.V. | Process for the production of a peptide |
| WO2009115919A2 (en) * | 2008-03-19 | 2009-09-24 | Institut Pasteur | Reagentless fluorescent biosensors comprising a designed ankyrin repeat protein module, rational design methods to create reagentless fluorescent biosensors and methods of their use |
| TW201120210A (en) * | 2009-11-05 | 2011-06-16 | Hoffmann La Roche | Glycosylated repeat-motif-molecule conjugates |
-
2013
- 2013-06-27 EP EP13731809.3A patent/EP2867360B1/en active Active
- 2013-06-27 MX MX2014015825A patent/MX2014015825A/en unknown
- 2013-06-27 CA CA2877584A patent/CA2877584A1/en not_active Abandoned
- 2013-06-27 JP JP2015519089A patent/JP2015522576A/en active Pending
- 2013-06-27 CN CN201380034192.1A patent/CN104508129A/en active Pending
- 2013-06-27 RU RU2014150224A patent/RU2014150224A/en not_active Application Discontinuation
- 2013-06-27 US US13/928,973 patent/US9163070B2/en active Active
- 2013-06-27 SG SG11201408196RA patent/SG11201408196RA/en unknown
- 2013-06-27 AU AU2013283296A patent/AU2013283296A1/en not_active Abandoned
- 2013-06-27 KR KR20157002327A patent/KR20150023957A/en not_active Withdrawn
- 2013-06-27 BR BR112014032316A patent/BR112014032316A2/en not_active IP Right Cessation
- 2013-06-27 HK HK15109777.3A patent/HK1209156A1/en unknown
- 2013-06-27 WO PCT/EP2013/063488 patent/WO2014001442A1/en not_active Ceased
-
2014
- 2014-12-03 ZA ZA2014/08872A patent/ZA201408872B/en unknown
- 2014-12-11 IN IN2522MUN2014 patent/IN2014MN02522A/en unknown
- 2014-12-24 IL IL236428A patent/IL236428A0/en unknown
-
2015
- 2015-09-08 US US14/847,403 patent/US20150368302A1/en not_active Abandoned
Patent Citations (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7417130B2 (en) * | 2000-09-08 | 2008-08-26 | University Of Zurich | Collection of repeat proteins comprising repeat modules |
| US20090082274A1 (en) * | 2000-09-08 | 2009-03-26 | Universitat Zurich | Collections of repeat proteins comprising repeat modules |
| US8110653B2 (en) * | 2000-09-08 | 2012-02-07 | Universitat Zurich | Collections of repeat proteins comprising repeat modules |
| US20120142611A1 (en) * | 2000-09-08 | 2012-06-07 | Universitat Zurich | Repeat protein from collection of repeat proteins comprising repeat modules |
| US20110207668A1 (en) * | 2008-11-03 | 2011-08-25 | Molecular Partners Ag | Binding proteins inhibiting the vegf-a receptor interaction |
| US20130116197A1 (en) * | 2010-04-30 | 2013-05-09 | Hans Kaspar Binz | Modified binding proteins inhibiting the vegf-a receptor interaction |
| US8710187B2 (en) * | 2010-04-30 | 2014-04-29 | Molecular Partners Ag | Modified binding proteins inhibiting the VEGF-A receptor interaction |
| US20140221295A1 (en) * | 2010-04-30 | 2014-08-07 | Molecular Partners Ag | Modified binding proteins inhibiting the vegf-a receptor interaction |
| US20130244940A1 (en) * | 2010-11-26 | 2013-09-19 | Molecular Partners Ag | Designed repeat proteins binding to serum albumin |
| US20130296221A1 (en) * | 2010-11-26 | 2013-11-07 | Molecular Partners Ag | Improved capping modules for designed ankyrin repeat proteins |
| US20120277143A1 (en) * | 2011-04-29 | 2012-11-01 | Steven Jacobs | IL4/IL13 Binding Repeat Proteins and Uses |
| US8722618B2 (en) * | 2011-04-29 | 2014-05-13 | Janssen Biotech, Inc. | IL4/IL13 binding repeat proteins and uses |
Non-Patent Citations (3)
| Title |
|---|
| Heldin "Targeting the PDGF signaling pathway in tumor treatment," Cell Communication and Signaling 2013, 11:97, pp. 1-18 * |
| Jo et al. "Inhibition of Platelet-Derived Growth Factor B Signaling Enhances the Efficacy of Anti-Vascular Endothelial Growth Factor Therapy in Multiple Models of Ocular Neovascularization," American Journal of Pathology, Vol. 168, No. 6, June 2006 * |
| Wolf et al. "Phase I Mp0112 Wet AMD Study: Results Of A Single Escalating Dose Study With DARPin® MP0112 In Wet AMD," Investigative Ophthalmology & Visual Science April 2011, Vol.52, 1655, meeting abstract * |
Cited By (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11453708B2 (en) * | 2013-05-31 | 2022-09-27 | Molecular Partners Ag | Designed ankyrin repeat proteins binding to hepatocyte growth factor |
| US20160251404A1 (en) * | 2013-05-31 | 2016-09-01 | Molecular Partners Ag | Designed ankyrin repeat proteins binding to hepatocyte growth factor |
| WO2019162472A1 (en) | 2018-02-22 | 2019-08-29 | Universität Zürich | Ligands to gm-csf or gm-csf-receptor for use in treatment of a haematologic malignancy in a patient having undergone allo-hct |
| US12384839B2 (en) | 2018-02-22 | 2025-08-12 | Universitat Zurich | Ligands to GM-CSF or GM-CSF-receptor for use in leukemia in a patient having undergone allo-HCT |
| US11655293B2 (en) | 2018-02-22 | 2023-05-23 | Universitat Zurich | Ligands to GM-CSF or GM-CSF-receptor for use in leukemia in a patient having undergone allo-HCT |
| WO2019180243A1 (en) | 2018-03-22 | 2019-09-26 | Charité-Universitätsmedizin Berlin | Crispr associated protein reactive t cell immunity |
| WO2019238966A1 (en) | 2018-06-15 | 2019-12-19 | Universität Bern | LIGANDS TO LIGHT OR ITS RECEPTOR LTßR FOR USE IN HAEMATOLOGIC MALIGNANCIES |
| EP3623382A1 (en) | 2018-09-14 | 2020-03-18 | Universität Zürich | Ligands to gm-csf or gm-csf-receptor for use in leukemia in a patient having undergone allo-hct |
| WO2020074469A1 (en) | 2018-10-08 | 2020-04-16 | Universität Zürich | Her2-binding tetrameric polypeptides |
| WO2020104627A1 (en) | 2018-11-21 | 2020-05-28 | Universität Zürich | Photochemically induced conjugation of radiometals to small molecules, peptides and nanoparticles in a simultaneous one-pot reaction |
| EP3677911A2 (en) | 2019-01-03 | 2020-07-08 | Universität Basel | Use of non-agonist ligands for suppression of metastasis |
| WO2020144378A1 (en) | 2019-01-11 | 2020-07-16 | Universitätsspital Basel | Sglt-2 inhibitors or il-1r antagonists for reduction of hypoglycaemia after bariatric surgery |
| WO2020207771A1 (en) | 2019-04-10 | 2020-10-15 | Universität Zürich | A method for determining the likelihood of a patient being responsive to cancer immunotherapy |
| JP2022535415A (en) * | 2019-06-04 | 2022-08-08 | モレキュラー パートナーズ アクチェンゲゼルシャフト | Recombinant FAP binding proteins and uses thereof |
| JP7611173B2 (en) | 2019-06-04 | 2025-01-09 | モレキュラー パートナーズ アクチェンゲゼルシャフト | Recombinant FAP-binding proteins and their uses |
| WO2020245173A1 (en) * | 2019-06-04 | 2020-12-10 | Molecular Partners Ag | Recombinant fap binding proteins and their use |
| WO2021044050A1 (en) | 2019-09-05 | 2021-03-11 | Genome Biologics Ug | Inhibition of mthfd1l for use in hypertrophic heart disease and heart failure |
| WO2021122813A1 (en) | 2019-12-16 | 2021-06-24 | Universität Basel | Angiogenesis promoting agents for prevention of metastatic cancer |
| WO2021176008A1 (en) | 2020-03-04 | 2021-09-10 | Cornell University | Agents targeting baf155 or brg1 for use in treatment of advanced prostate cancer |
| WO2021204781A1 (en) | 2020-04-06 | 2021-10-14 | Universität Zürich | Artc1 ligands for cancer treatment |
| WO2021239844A1 (en) | 2020-05-27 | 2021-12-02 | Universitätsspital Basel | Sglt-2 inhibitors or il-1r antagonists for reduction of hypoglycaemia in prediabetes |
| WO2021239999A1 (en) | 2020-05-28 | 2021-12-02 | Universität Zürich | Il-12 pd-l1 ligand fusion protein |
| WO2022038193A1 (en) | 2020-08-18 | 2022-02-24 | Universität Zürich | A cd25-biased anti-il-2 antibody |
| WO2022171831A1 (en) | 2021-02-11 | 2022-08-18 | Universität Zürich | Use of markers found on lymph node metastatic samples for the prognosis of breast cancer |
| WO2023012350A1 (en) | 2021-08-05 | 2023-02-09 | Immunos Therapeutics Ag | Combination medicaments comprising hla fusion proteins |
| WO2023012348A1 (en) | 2021-08-05 | 2023-02-09 | Immunos Therapeutics Ag | A modified hla-b57 with increased expression levels |
| WO2023021006A1 (en) | 2021-08-16 | 2023-02-23 | Universität Zürich | Il-1 targeting agents for treatment of pitiyriasis rubra pilaris |
| WO2023036849A1 (en) | 2021-09-07 | 2023-03-16 | ETH Zürich | Identifying and predicting future coronavirus variants |
| EP4163380A1 (en) | 2021-10-08 | 2023-04-12 | ETH Zurich | Device and method for manipulation of extracellular vesicles |
| WO2023057643A1 (en) | 2021-10-08 | 2023-04-13 | ETH Zürich | Device and method for manipulation of extracellular vesicles |
| WO2023110942A1 (en) | 2021-12-14 | 2023-06-22 | Charité-Universitätsmedizin Berlin | Prevention of impaired fracture healing |
| EP4260907A1 (en) | 2022-04-11 | 2023-10-18 | Universität Zürich | Agents for treatment of endometriosis and other benign gynecological neoplasms |
| WO2023198677A1 (en) | 2022-04-11 | 2023-10-19 | Universität Zürich | Agents for treatment of endometriosis and other benign gynecological neoplasms |
| WO2024002914A1 (en) | 2022-06-27 | 2024-01-04 | Charité-Universitätsmedizin Berlin | Prediction of, and composition to improve, tendon healing |
| WO2024133013A1 (en) | 2022-12-19 | 2024-06-27 | Max-Planck-Gesellschaft zur Förderung der Wissenschaften e. V. | Means and methods to target endogenous condensates |
| WO2024165671A1 (en) | 2023-02-08 | 2024-08-15 | Immunos Therapeutics Ag | FUSION PROTEINS OF ß2 MICROGLOBULIN, HLA HEAVY CHAIN POLYPEPTIDES, AND INHIBITOR OF CD47-SIRPA |
| WO2025008519A1 (en) | 2023-07-05 | 2025-01-09 | Universität Bern | Il-1ra blockers for treatment and prevention of sepsis |
| WO2025021293A1 (en) | 2023-07-25 | 2025-01-30 | Universität Zürich | Disruption of rbr1 expression in plant cells |
| WO2025202503A1 (en) | 2024-03-28 | 2025-10-02 | Universität Zürich | Extracellular vesicles carrying cancer specific splice variants |
Also Published As
| Publication number | Publication date |
|---|---|
| EP2867360A1 (en) | 2015-05-06 |
| IN2014MN02522A (en) | 2015-07-17 |
| CN104508129A (en) | 2015-04-08 |
| CA2877584A1 (en) | 2014-01-03 |
| IL236428A0 (en) | 2015-02-26 |
| WO2014001442A1 (en) | 2014-01-03 |
| BR112014032316A2 (en) | 2017-06-27 |
| SG11201408196RA (en) | 2015-03-30 |
| MX2014015825A (en) | 2015-08-10 |
| JP2015522576A (en) | 2015-08-06 |
| EP2867360B1 (en) | 2019-05-08 |
| AU2013283296A1 (en) | 2015-02-05 |
| RU2014150224A (en) | 2016-08-20 |
| US9163070B2 (en) | 2015-10-20 |
| ZA201408872B (en) | 2016-05-25 |
| HK1209156A1 (en) | 2016-03-24 |
| US20140005125A1 (en) | 2014-01-02 |
| KR20150023957A (en) | 2015-03-05 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9163070B2 (en) | Designed ankyrin repeat proteins binding to platelet-derived growth factor | |
| US11453708B2 (en) | Designed ankyrin repeat proteins binding to hepatocyte growth factor | |
| CN103459415B (en) | designed repeat protein that binds to serum albumin | |
| US20210069293A1 (en) | Modified binding proteins inhibiting the vegf-a receptor interaction | |
| RU2650765C1 (en) | Binding proteins, inhibiting interaction of vegf-a receptor | |
| US20220096596A1 (en) | Method of treating amd in patients refractory to anti-vegf therapy | |
| HK40059771A (en) | Designed repeat proteins binding to serum albumin | |
| HK1213001B (en) | Designed ankyrin repeat proteins binding to hepatocyte growth factor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |