US20150323549A1 - Methods for Identifying Compounds That Modulate Ion Channel Activity of a Kir Channel - Google Patents
Methods for Identifying Compounds That Modulate Ion Channel Activity of a Kir Channel Download PDFInfo
- Publication number
- US20150323549A1 US20150323549A1 US14/813,396 US201514813396A US2015323549A1 US 20150323549 A1 US20150323549 A1 US 20150323549A1 US 201514813396 A US201514813396 A US 201514813396A US 2015323549 A1 US2015323549 A1 US 2015323549A1
- Authority
- US
- United States
- Prior art keywords
- kir
- channel
- compound
- human
- turret
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 150000001875 compounds Chemical class 0.000 title claims abstract description 103
- 238000000034 method Methods 0.000 title claims abstract description 89
- 230000000694 effects Effects 0.000 title claims abstract description 42
- 102000004310 Ion Channels Human genes 0.000 title claims abstract description 23
- 108091006146 Channels Proteins 0.000 claims abstract description 316
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 25
- 150000007523 nucleic acids Chemical group 0.000 claims abstract description 23
- 108090000862 Ion Channels Proteins 0.000 claims abstract description 22
- 230000002159 abnormal effect Effects 0.000 claims abstract description 3
- 238000003556 assay Methods 0.000 claims description 67
- 108090000623 proteins and genes Proteins 0.000 claims description 66
- 102000004169 proteins and genes Human genes 0.000 claims description 64
- 241000287828 Gallus gallus Species 0.000 claims description 41
- 102000039446 nucleic acids Human genes 0.000 claims description 20
- 108020004707 nucleic acids Proteins 0.000 claims description 20
- 238000001262 western blot Methods 0.000 claims description 17
- 238000002965 ELISA Methods 0.000 claims description 14
- 229910052716 thallium Inorganic materials 0.000 claims description 11
- BKVIYDNLLOSFOA-UHFFFAOYSA-N thallium Chemical compound [Tl] BKVIYDNLLOSFOA-UHFFFAOYSA-N 0.000 claims description 11
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 8
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 8
- 150000003384 small molecules Chemical class 0.000 claims description 8
- 239000000232 Lipid Bilayer Substances 0.000 claims description 7
- 206010020772 Hypertension Diseases 0.000 claims description 5
- 206010003119 arrhythmia Diseases 0.000 claims description 5
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 claims description 4
- 108060003951 Immunoglobulin Proteins 0.000 claims description 4
- 239000007850 fluorescent dye Substances 0.000 claims description 4
- 102000018358 immunoglobulin Human genes 0.000 claims description 4
- 206010012601 diabetes mellitus Diseases 0.000 claims description 3
- 206010015037 epilepsy Diseases 0.000 claims description 3
- 238000000338 in vitro Methods 0.000 claims description 3
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 11
- 229920001184 polypeptide Polymers 0.000 abstract description 5
- 102000034573 Channels Human genes 0.000 description 63
- 235000018102 proteins Nutrition 0.000 description 57
- 102100021178 ATP-sensitive inward rectifier potassium channel 12 Human genes 0.000 description 50
- 101000614708 Homo sapiens ATP-sensitive inward rectifier potassium channel 12 Proteins 0.000 description 50
- 150000002500 ions Chemical class 0.000 description 46
- 230000027455 binding Effects 0.000 description 45
- 239000011148 porous material Substances 0.000 description 39
- 210000004027 cell Anatomy 0.000 description 38
- 239000000243 solution Substances 0.000 description 36
- 235000001014 amino acid Nutrition 0.000 description 33
- 239000013078 crystal Substances 0.000 description 30
- 150000001413 amino acids Chemical class 0.000 description 27
- 239000012528 membrane Substances 0.000 description 23
- 210000004379 membrane Anatomy 0.000 description 23
- 210000000287 oocyte Anatomy 0.000 description 23
- 230000001086 cytosolic effect Effects 0.000 description 22
- 108010050306 Kir2.2 channel Proteins 0.000 description 20
- 239000002299 complementary DNA Substances 0.000 description 20
- 231100000765 toxin Toxicity 0.000 description 19
- 239000000872 buffer Substances 0.000 description 18
- 230000006870 function Effects 0.000 description 18
- 239000003053 toxin Substances 0.000 description 18
- 108700012359 toxins Proteins 0.000 description 18
- 150000002632 lipids Chemical class 0.000 description 17
- 230000035772 mutation Effects 0.000 description 16
- 108020004414 DNA Proteins 0.000 description 15
- 230000000903 blocking effect Effects 0.000 description 15
- 238000003018 immunoassay Methods 0.000 description 13
- 101000944272 Homo sapiens ATP-sensitive inward rectifier potassium channel 1 Proteins 0.000 description 12
- 101000944277 Homo sapiens Inward rectifier potassium channel 2 Proteins 0.000 description 12
- 102100033114 Inward rectifier potassium channel 2 Human genes 0.000 description 12
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 12
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 12
- 230000003834 intracellular effect Effects 0.000 description 12
- 150000001768 cations Chemical class 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 239000000203 mixture Substances 0.000 description 11
- 229910001419 rubidium ion Inorganic materials 0.000 description 11
- 102100033056 ATP-sensitive inward rectifier potassium channel 1 Human genes 0.000 description 10
- 201000010099 disease Diseases 0.000 description 10
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 10
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 10
- 239000000975 dye Substances 0.000 description 10
- 239000003112 inhibitor Substances 0.000 description 10
- 238000002823 phage display Methods 0.000 description 10
- NCCSSGKUIKYAJD-UHFFFAOYSA-N rubidium(1+) Chemical compound [Rb+] NCCSSGKUIKYAJD-UHFFFAOYSA-N 0.000 description 10
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 9
- 238000012286 ELISA Assay Methods 0.000 description 9
- 102000004190 Enzymes Human genes 0.000 description 9
- 108090000790 Enzymes Proteins 0.000 description 9
- 239000000427 antigen Substances 0.000 description 9
- 108091007433 antigens Proteins 0.000 description 9
- 102000036639 antigens Human genes 0.000 description 9
- 229940088598 enzyme Drugs 0.000 description 9
- 230000004907 flux Effects 0.000 description 9
- 229910052739 hydrogen Inorganic materials 0.000 description 9
- 239000001257 hydrogen Substances 0.000 description 9
- 230000001225 therapeutic effect Effects 0.000 description 9
- 102100021176 ATP-sensitive inward rectifier potassium channel 10 Human genes 0.000 description 8
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 8
- 230000004913 activation Effects 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 230000005764 inhibitory process Effects 0.000 description 8
- 229910001414 potassium ion Inorganic materials 0.000 description 8
- 102100033063 G protein-activated inward rectifier potassium channel 1 Human genes 0.000 description 7
- 101000944266 Homo sapiens G protein-activated inward rectifier potassium channel 1 Proteins 0.000 description 7
- 101000614712 Homo sapiens G protein-activated inward rectifier potassium channel 4 Proteins 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- 230000002209 hydrophobic effect Effects 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 229920000768 polyamine Polymers 0.000 description 7
- 238000010561 standard procedure Methods 0.000 description 7
- 238000012360 testing method Methods 0.000 description 7
- 238000011282 treatment Methods 0.000 description 7
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 6
- 108091023037 Aptamer Proteins 0.000 description 6
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 6
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 6
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 6
- 239000007995 HEPES buffer Substances 0.000 description 6
- 239000007836 KH2PO4 Substances 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 125000003275 alpha amino acid group Chemical group 0.000 description 6
- 229940098773 bovine serum albumin Drugs 0.000 description 6
- 239000001110 calcium chloride Substances 0.000 description 6
- 229910001628 calcium chloride Inorganic materials 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 6
- 229910000396 dipotassium phosphate Inorganic materials 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 230000033001 locomotion Effects 0.000 description 6
- 229910001629 magnesium chloride Inorganic materials 0.000 description 6
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 6
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 6
- 238000000159 protein binding assay Methods 0.000 description 6
- FGDZQCVHDSGLHJ-UHFFFAOYSA-M rubidium chloride Chemical compound [Cl-].[Rb+] FGDZQCVHDSGLHJ-UHFFFAOYSA-M 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 230000007704 transition Effects 0.000 description 6
- 239000013598 vector Substances 0.000 description 6
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 5
- 102100021240 ATP-sensitive inward rectifier potassium channel 8 Human genes 0.000 description 5
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 5
- 101710107217 Tertiapin Proteins 0.000 description 5
- 230000002547 anomalous effect Effects 0.000 description 5
- 238000013459 approach Methods 0.000 description 5
- 210000003050 axon Anatomy 0.000 description 5
- 229910052799 carbon Inorganic materials 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 238000002447 crystallographic data Methods 0.000 description 5
- 230000002999 depolarising effect Effects 0.000 description 5
- 239000003599 detergent Substances 0.000 description 5
- 238000002703 mutagenesis Methods 0.000 description 5
- 231100000350 mutagenesis Toxicity 0.000 description 5
- 239000012071 phase Substances 0.000 description 5
- 239000011591 potassium Substances 0.000 description 5
- 102100022844 ATP-sensitive inward rectifier potassium channel 14 Human genes 0.000 description 4
- 102100022781 ATP-sensitive inward rectifier potassium channel 15 Human genes 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 102000029816 Collagenase Human genes 0.000 description 4
- 108060005980 Collagenase Proteins 0.000 description 4
- 102100021237 G protein-activated inward rectifier potassium channel 4 Human genes 0.000 description 4
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 4
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 4
- -1 H227 Substances 0.000 description 4
- 101000614696 Homo sapiens ATP-sensitive inward rectifier potassium channel 10 Proteins 0.000 description 4
- 101001047033 Homo sapiens ATP-sensitive inward rectifier potassium channel 14 Proteins 0.000 description 4
- 101000944267 Homo sapiens Inward rectifier potassium channel 4 Proteins 0.000 description 4
- 102100022774 Inward rectifier potassium channel 16 Human genes 0.000 description 4
- 102100033057 Inward rectifier potassium channel 4 Human genes 0.000 description 4
- 108010074781 Kcnj10 (channel) Proteins 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 229920002565 Polyethylene Glycol 400 Polymers 0.000 description 4
- 108700011066 PreScission Protease Proteins 0.000 description 4
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 4
- 230000002378 acidificating effect Effects 0.000 description 4
- 229910052786 argon Inorganic materials 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000011248 coating agent Substances 0.000 description 4
- 238000000576 coating method Methods 0.000 description 4
- 229960002424 collagenase Drugs 0.000 description 4
- 150000001945 cysteines Chemical class 0.000 description 4
- 210000000805 cytoplasm Anatomy 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000005684 electric field Effects 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 238000002001 electrophysiology Methods 0.000 description 4
- 230000007831 electrophysiology Effects 0.000 description 4
- 239000005090 green fluorescent protein Substances 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 239000006166 lysate Substances 0.000 description 4
- 239000012139 lysis buffer Substances 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- JLFNLZLINWHATN-UHFFFAOYSA-N pentaethylene glycol Chemical compound OCCOCCOCCOCCOCCO JLFNLZLINWHATN-UHFFFAOYSA-N 0.000 description 4
- 229910052700 potassium Inorganic materials 0.000 description 4
- 239000000523 sample Substances 0.000 description 4
- 229910001631 strontium chloride Inorganic materials 0.000 description 4
- AHBGXTDRMVNFER-UHFFFAOYSA-L strontium dichloride Chemical compound [Cl-].[Cl-].[Sr+2] AHBGXTDRMVNFER-UHFFFAOYSA-L 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 206010003658 Atrial Fibrillation Diseases 0.000 description 3
- 102000053602 DNA Human genes 0.000 description 3
- 239000003155 DNA primer Substances 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 101000614717 Homo sapiens ATP-sensitive inward rectifier potassium channel 8 Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 239000004285 Potassium sulphite Substances 0.000 description 3
- 241000270295 Serpentes Species 0.000 description 3
- 239000004809 Teflon Substances 0.000 description 3
- 229920006362 Teflon® Polymers 0.000 description 3
- 241000269370 Xenopus <genus> Species 0.000 description 3
- 239000011668 ascorbic acid Substances 0.000 description 3
- 125000004429 atom Chemical group 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 238000005421 electrostatic potential Methods 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 230000036571 hydration Effects 0.000 description 3
- 238000006703 hydration reaction Methods 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 230000010287 polarization Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 238000000926 separation method Methods 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 108010000982 uK-ATP-1 potassium channel Proteins 0.000 description 3
- 102100021177 ATP-sensitive inward rectifier potassium channel 11 Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108010039627 Aprotinin Proteins 0.000 description 2
- 241000283707 Capra Species 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- 241000270311 Crocodylus niloticus Species 0.000 description 2
- 102100025698 Cytosolic carboxypeptidase 4 Human genes 0.000 description 2
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 2
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 2
- 229910016644 EuCl3 Inorganic materials 0.000 description 2
- KRHYYFGTRYWZRS-UHFFFAOYSA-M Fluoride anion Chemical compound [F-] KRHYYFGTRYWZRS-UHFFFAOYSA-M 0.000 description 2
- 210000000712 G cell Anatomy 0.000 description 2
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 2
- 229930182566 Gentamicin Natural products 0.000 description 2
- 239000012981 Hank's balanced salt solution Substances 0.000 description 2
- 101000614701 Homo sapiens ATP-sensitive inward rectifier potassium channel 11 Proteins 0.000 description 2
- 101001047184 Homo sapiens ATP-sensitive inward rectifier potassium channel 15 Proteins 0.000 description 2
- 101000932590 Homo sapiens Cytosolic carboxypeptidase 4 Proteins 0.000 description 2
- 101001047190 Homo sapiens Inward rectifier potassium channel 16 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 108010051001 Kir2.1 channel Proteins 0.000 description 2
- 108010080609 Kir4.2 channel Proteins 0.000 description 2
- 108010002556 Kir5.1 channel Proteins 0.000 description 2
- 108010005516 Kir6.2 channel Proteins 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- GDBQQVLCIARPGH-UHFFFAOYSA-N Leupeptin Natural products CC(C)CC(NC(C)=O)C(=O)NC(CC(C)C)C(=O)NC(C=O)CCCN=C(N)N GDBQQVLCIARPGH-UHFFFAOYSA-N 0.000 description 2
- 101001033003 Mus musculus Granzyme F Proteins 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 229920001030 Polyethylene Glycol 4000 Polymers 0.000 description 2
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 241000239226 Scorpiones Species 0.000 description 2
- 101710137500 T7 RNA polymerase Proteins 0.000 description 2
- 101710162629 Trypsin inhibitor Proteins 0.000 description 2
- 229940122618 Trypsin inhibitor Drugs 0.000 description 2
- 241000269368 Xenopus laevis Species 0.000 description 2
- 108010084455 Zeocin Proteins 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000036982 action potential Effects 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- MGSKVZWGBWPBTF-UHFFFAOYSA-N aebsf Chemical compound NCCC1=CC=C(S(F)(=O)=O)C=C1 MGSKVZWGBWPBTF-UHFFFAOYSA-N 0.000 description 2
- 238000007818 agglutination assay Methods 0.000 description 2
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 229960004405 aprotinin Drugs 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000012131 assay buffer Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 239000003659 bee venom Substances 0.000 description 2
- PXXJHWLDUBFPOL-UHFFFAOYSA-N benzamidine Chemical compound NC(=N)C1=CC=CC=C1 PXXJHWLDUBFPOL-UHFFFAOYSA-N 0.000 description 2
- 238000010256 biochemical assay Methods 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 239000011549 crystallization solution Substances 0.000 description 2
- 230000001351 cycling effect Effects 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- WOQQAWHSKSSAGF-WXFJLFHKSA-N decyl beta-D-maltopyranoside Chemical compound O[C@@H]1[C@@H](O)[C@H](OCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 WOQQAWHSKSSAGF-WXFJLFHKSA-N 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- MTHSVFCYNBDYFN-UHFFFAOYSA-N diethylene glycol Chemical compound OCCOCCO MTHSVFCYNBDYFN-UHFFFAOYSA-N 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- NNMXSTWQJRPBJZ-UHFFFAOYSA-K europium(iii) chloride Chemical compound Cl[Eu](Cl)Cl NNMXSTWQJRPBJZ-UHFFFAOYSA-K 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 238000002523 gelfiltration Methods 0.000 description 2
- 230000005484 gravity Effects 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 2
- 125000001165 hydrophobic group Chemical group 0.000 description 2
- 230000002102 hyperpolarization Effects 0.000 description 2
- 239000000819 hypertonic solution Substances 0.000 description 2
- 229940021223 hypertonic solution Drugs 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 238000005462 in vivo assay Methods 0.000 description 2
- ZPNFWUPYTFPOJU-LPYSRVMUSA-N iniprol Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@H]2CSSC[C@H]3C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(N[C@H](C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC=4C=CC=CC=4)C(=O)N[C@@H](CC=4C=CC(O)=CC=4)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4C=CC=CC=4)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC2=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H]2N(CCC2)C(=O)[C@@H](N)CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N2[C@@H](CCC2)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC(O)=CC=2)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N2[C@@H](CCC2)C(=O)N3)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](C(=O)N1)C(C)C)[C@@H](C)O)[C@@H](C)CC)=O)[C@@H](C)CC)C1=CC=C(O)C=C1 ZPNFWUPYTFPOJU-LPYSRVMUSA-N 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- GDBQQVLCIARPGH-ULQDDVLXSA-N leupeptin Chemical compound CC(C)C[C@H](NC(C)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C=O)CCCN=C(N)N GDBQQVLCIARPGH-ULQDDVLXSA-N 0.000 description 2
- 108010052968 leupeptin Proteins 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000028161 membrane depolarization Effects 0.000 description 2
- 229910021645 metal ion Inorganic materials 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 238000011275 oncology therapy Methods 0.000 description 2
- 229950000964 pepstatin Drugs 0.000 description 2
- 108010091212 pepstatin Proteins 0.000 description 2
- FAXGPCHRFPCXOO-LXTPJMTPSA-N pepstatin A Chemical compound OC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)NC(=O)CC(C)C FAXGPCHRFPCXOO-LXTPJMTPSA-N 0.000 description 2
- 230000000144 pharmacologic effect Effects 0.000 description 2
- CWCMIVBLVUHDHK-ZSNHEYEWSA-N phleomycin D1 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC[C@@H](N=1)C=1SC=C(N=1)C(=O)NCCCCNC(N)=N)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C CWCMIVBLVUHDHK-ZSNHEYEWSA-N 0.000 description 2
- 229920001983 poloxamer Polymers 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- DBABZHXKTCFAPX-UHFFFAOYSA-N probenecid Chemical compound CCCN(CCC)S(=O)(=O)C1=CC=C(C(O)=O)C=C1 DBABZHXKTCFAPX-UHFFFAOYSA-N 0.000 description 2
- 229960003081 probenecid Drugs 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 229910052701 rubidium Inorganic materials 0.000 description 2
- IGLNJRXAVVLDKE-UHFFFAOYSA-N rubidium atom Chemical compound [Rb] IGLNJRXAVVLDKE-UHFFFAOYSA-N 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000003756 stirring Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000013518 transcription Methods 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 239000002753 trypsin inhibitor Substances 0.000 description 2
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 2
- 231100000611 venom Toxicity 0.000 description 2
- 210000001534 vitelline membrane Anatomy 0.000 description 2
- ASWBNKHCZGQVJV-UHFFFAOYSA-N (3-hexadecanoyloxy-2-hydroxypropyl) 2-(trimethylazaniumyl)ethyl phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(O)COP([O-])(=O)OCC[N+](C)(C)C ASWBNKHCZGQVJV-UHFFFAOYSA-N 0.000 description 1
- UFBJCMHMOXMLKC-UHFFFAOYSA-N 2,4-dinitrophenol Chemical compound OC1=CC=C([N+]([O-])=O)C=C1[N+]([O-])=O UFBJCMHMOXMLKC-UHFFFAOYSA-N 0.000 description 1
- 102000012440 Acetylcholinesterase Human genes 0.000 description 1
- 108010022752 Acetylcholinesterase Proteins 0.000 description 1
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 1
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 1
- 102000012739 Anion Transport Proteins Human genes 0.000 description 1
- 108010079442 Anion Transport Proteins Proteins 0.000 description 1
- 241000239290 Araneae Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108050001427 Avidin/streptavidin Proteins 0.000 description 1
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 241000238366 Cephalopoda Species 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- 102000002464 Galactosidases Human genes 0.000 description 1
- 108010093031 Galactosidases Proteins 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 102000005731 Glucose-6-phosphate isomerase Human genes 0.000 description 1
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 241001620684 Guillermo Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001047038 Homo sapiens Inward rectifier potassium channel 13 Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 208000019025 Hypokalemia Diseases 0.000 description 1
- 208000001953 Hypotension Diseases 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 102000013460 Malate Dehydrogenase Human genes 0.000 description 1
- 108010026217 Malate Dehydrogenase Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010059724 Micrococcal Nuclease Proteins 0.000 description 1
- 102000014171 Milk Proteins Human genes 0.000 description 1
- 108010011756 Milk Proteins Proteins 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102000019280 Pancreatic lipases Human genes 0.000 description 1
- 108050006759 Pancreatic lipases Proteins 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 241000237988 Patellidae Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 102000004257 Potassium Channel Human genes 0.000 description 1
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 101710204410 Scaffold protein Proteins 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 108010088160 Staphylococcal Protein A Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 229940022698 acetylcholinesterase Drugs 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 210000005091 airway smooth muscle Anatomy 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- VZTDIZULWFCMLS-UHFFFAOYSA-N ammonium formate Chemical compound [NH4+].[O-]C=O VZTDIZULWFCMLS-UHFFFAOYSA-N 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000002220 antihypertensive agent Substances 0.000 description 1
- 229940030600 antihypertensive agent Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 230000006793 arrhythmia Effects 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 238000002819 bacterial display Methods 0.000 description 1
- 210000000227 basophil cell of anterior lobe of hypophysis Anatomy 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000011797 cavity material Substances 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000019522 cellular metabolic process Effects 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 239000003593 chromogenic compound Substances 0.000 description 1
- 238000003271 compound fluorescence assay Methods 0.000 description 1
- 239000004020 conductor Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 238000013480 data collection Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 229940030606 diuretics Drugs 0.000 description 1
- 229960003638 dopamine Drugs 0.000 description 1
- 230000002900 effect on cell Effects 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 230000009881 electrostatic interaction Effects 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000001125 extrusion Methods 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000012817 gel-diffusion technique Methods 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 235000020294 guillermo Nutrition 0.000 description 1
- 230000035931 haemagglutination Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 102000055001 human KCNJ13 Human genes 0.000 description 1
- 102000057908 human KCNJ5 Human genes 0.000 description 1
- JYVNDCLJHKQUHE-UHFFFAOYSA-N hydroxymethyl acetate Chemical compound CC(=O)OCO JYVNDCLJHKQUHE-UHFFFAOYSA-N 0.000 description 1
- 230000001631 hypertensive effect Effects 0.000 description 1
- 230000036543 hypotension Effects 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000000951 immunodiffusion Effects 0.000 description 1
- 238000000760 immunoelectrophoresis Methods 0.000 description 1
- 238000010166 immunofluorescence Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 238000003017 in situ immunoassay Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000003914 insulin secretion Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000011813 knockout mouse model Methods 0.000 description 1
- 229910052747 lanthanoid Inorganic materials 0.000 description 1
- 150000002602 lanthanoids Chemical class 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000012160 loading buffer Substances 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 1
- 235000021239 milk protein Nutrition 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 210000002464 muscle smooth vascular Anatomy 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 150000002891 organic anions Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 229940116369 pancreatic lipase Drugs 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 210000001002 parasympathetic nervous system Anatomy 0.000 description 1
- 238000005192 partition Methods 0.000 description 1
- 238000012402 patch clamp technique Methods 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 208000029308 periodic paralysis Diseases 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 229920000447 polyanionic polymer Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 230000036619 pore blockages Effects 0.000 description 1
- 108020001213 potassium channel Proteins 0.000 description 1
- 208000024896 potassium deficiency disease Diseases 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000013615 primer Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 238000013197 protein A assay Methods 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001814 protein method Methods 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000000284 resting effect Effects 0.000 description 1
- 230000036390 resting membrane potential Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 239000002795 scorpion venom Substances 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 239000003998 snake venom Substances 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 239000002708 spider venom Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000010998 test method Methods 0.000 description 1
- 229960003766 thrombin (human) Drugs 0.000 description 1
- 230000024033 toxin binding Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 239000002435 venom Substances 0.000 description 1
- 210000001048 venom Anatomy 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
- LYTCVQQGCSNFJU-LKGYBJPKSA-N α-bungarotoxin Chemical compound C(/[C@H]1O[C@H]2C[C@H]3O[C@@H](CC(=C)C=O)C[C@H](O)[C@]3(C)O[C@@H]2C[C@@H]1O[C@@H]1C2)=C/C[C@]1(C)O[C@H]1[C@@]2(C)O[C@]2(C)CC[C@@H]3O[C@@H]4C[C@]5(C)O[C@@H]6C(C)=CC(=O)O[C@H]6C[C@H]5O[C@H]4C[C@@H](C)[C@H]3O[C@H]2C1 LYTCVQQGCSNFJU-LKGYBJPKSA-N 0.000 description 1
Images
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/566—Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6872—Intracellular protein regulatory factors and their receptors, e.g. including ion channels
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/04—Screening involving studying the effect of compounds C directly on molecule A (e.g. C are potential ligands for a receptor A, or potential substrates for an enzyme A)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/10—Screening for compounds of potential therapeutic value involving cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/04—Endocrine or metabolic disorders
- G01N2800/042—Disorders of carbohydrate metabolism, e.g. diabetes, glucose metabolism
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2857—Seizure disorders; Epilepsy
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/32—Cardiovascular disorders
- G01N2800/321—Arterial hypertension
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/32—Cardiovascular disorders
- G01N2800/326—Arrhythmias, e.g. ventricular fibrillation, tachycardia, atrioventricular block, torsade de pointes
Definitions
- the present invention relates to Kir channel proteins and methods for identifying compounds that modulate ion channel activity by Kir channels.
- the present invention relates to identifying compounds which are useful for treating diseases related to the function of Kir channel proteins.
- Kir channel proteins Inward rectifier K+ charnels (Kir channel proteins) are involved in the control of many physiological processes that are important to human health. Kir channel proteins normally function as K+ (potassium) selective pores that span cell membranes. The Kir channels are referred to as inward rectifier K+ (Kir) channels based on a fundamental ion conduction property of these channels: given an equal but opposite electrochemical driving force K+ conductance into the cell far exceeds conductance out of the cell.
- Kir channel proteins control the pace of the heart, regulate secretion of hormones into the blood stream, generate electrical impulses underlying information transfer in the nervous system and control airway and vascular smooth muscle tone. It is believed that various disease states are directly related to the function of Kir channel proteins. Members of this channel family include Kir1-Kir7, (Kubo et al., Pharmacological Rev., 57:509-526, 2005) Hypertension, atrial fibrillation, and type 2 diabetes are related to Kir channel protein function and are serious conditions for which new therapies are needed. Specific links between Kir channel proteins and disease have been found. Kir1.1 channels are present in the kidney and regulate salt secretion into the urine. Heritable mutations involving Kir1.1 cause Barter's syndrome and hypotension.
- Kir3.1 and Kir3.4 channels which assemble to form a heteromultimer, are called G-protein-gated K+ channels (GIRK). These channels control heart rate through stimulation by the parasympathetic nervous system. GIRK channel knock-out mice do not develop atrial fibrillation under any of the usual stimuli that induce this arrhythmia in mice.
- Kir6 channels are expressed in beta cells of the pancreas and control insulin secretion. With the identification of compounds that selectively inhibit the Kir6 channel new therapies could be realized for the treatment of type 2 diabetes. Accordingly, Kir channel proteins are good targets for the treatment of various diseases.
- the Kir channel family of proteins are very similar to each other in both sequence and, by inference, structure; thus, it has been very difficult to identify compounds that can specifically modulate one kind of Kir channel protein without cross-reacting with other types of Kir channel proteins.
- the turret region is an important functional region of the protein and faces the outside of the cell making this region an attractive target for identifying potential therapeutic compounds.
- the present invention provides a variety of methods by which the turret region may be used to identify compounds having therapeutic utility for treating the various diseases related to the function of Kir channels.
- the present invention provides for the first time the expression and purification of a eukaryotic Kir channel as explained in detail below. Study of the structure of this eukaryotic Kir channel resulted in a realization of the importance of the turret region and the invention of methods which allow identification of therapeutic compounds that can selectively bind to different members of the Kir channel family of proteins.
- the present invention relates to methods for identifying a compound that modulates ion channel activity of a Kir channel including identifying a compound which binds the turret region of a Kir channel; and determining if the compound modulates ion channel activity of the Kir channel.
- the method may be used to identify an antibody that binds the turret region of a Kir channel and modulates the Kir channel's activity.
- the antibody may be human, chimeric or humanized.
- the antibody may also be a polyclonal antibody, monoclonal antibody, an intact immunoglobulin molecule, an antibody fragment, a scFv, a Fab, a F(ab)2, a Fv, or a disulfide linked Fv.
- the method may be used to identify suitable nucleic acid molecules that can modulate a Kir channel's activity by binding to its turret region.
- the nucleic acid may be a DNA or RNA molecule.
- the nucleic acid is an aptamer.
- the method may also include identifying a suitable nucleic acid by using in vitro selection techniques.
- the method is used to identify a protein or peptide that can bind a turret region of a Kir channel and modulate the Kir channel.
- the protein/peptide may be attached to a protein scaffold or displayed on the surface of a phage.
- the method discussed above is used to screen for small molecules that can modulate Kir channel activity by binding to the Kir channel's turret region.
- the Kir channel may be a human Kir channel or a chicken/human hybrid Kir channel.
- the chicken/human hybrid Kir channel will comprise a human Kir channel turret region.
- the identifying step may comprise an ELISA and a Western blot to determine if the compound binds to a properly folded Kir channel but not to a denatured Kir channel.
- the identifying step may comprise determining if the compound binds to a Kir channel with a normal turret region but not a mutated turret region.
- the determining step may include a fluorescent assay such as one utilizing a thallium specific fluorescent dye.
- the present invention relates to a method for identifying a compound that selectively modulates ion channel activity of a specific type of Kir channel including identifying a compound which binds the turret region of a specific type of Kir channel but does not bind to other types of Kir channels; and determining if the compound modulates the activity of the Kir channel.
- the present invention relates to a method of identifying a compound to treat a condition associated with abnormal ion channel activity by a Kir channel including identifying a compound which binds the turret region of a Kir channel; determining if the compound modulates ion channel activity of the Kir channel; and administering the compound which modulates ion channel activity to a subject to determine if the compound is able to treat the condition.
- the condition may be diabetes mellitus, hypertension, cardiac arrhythmia, or epilepsy.
- the present invention relates to a purified antibody that specifically binds to an epitope in the turret region of a Kir channel.
- the purified antibody may be a polyclonal antibody, a monoclonal antibody, an intact immunoglobulin molecule, an antibody fragment, a scFv, a Fab, a F(ab)2, a Fv, or a disulfide linked Fv.
- the antibody may specifically bind to a human Kir channel such as a Kir1, Kir2, Kir3, Kir4, Kir5, Kir6, or Kir7 channel.
- the antibody preferably binds to an epitope within the turret region of a human Kir channel such as Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2 channel. Even more preferably, the antibody binds to the variable portion of the turret region of a human Kir channel.
- the present invention relates to a method of making an antibody that specifically binds to an epitope in the turret region of a human Kir channel, including providing a chicken/human hybrid Kir channel, wherein the chicken/human hybrid comprises a human Kir channel turret region; immunizing a non-human animal with the chicken/human hybrid Kir channel; and determining whether the antibody is binding to the human Kir channel turret region.
- the chicken portion of the chicken/human hybrid Kir channel may be derived from a chicken Kir2.2 channel.
- the human Kir channel turret region may be derived from Kir1, Kir2, Kir3, Kir4, Kir5, Kir6, or Kir7.
- the human Kir channel turret region is derived from a human Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2 channel.
- the present invention relates to a method of making an antibody that specifically binds to an epitope in the turret region of a human Kir channel, including providing a human Kir channel; immunizing a non-human animal with the Kir channel; and determining whether the antibody is binding to the human Kir channel turret region.
- the present invention relates to a purified polypeptide that consists of the turret region of human Kir channels such as Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2.
- the present invention relates to an isolated nucleic acid comprising a nucleotide sequence that encodes a polypeptide that consists of the turret region of human Kir channels such as Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2.
- FIG. 1A-1C shows key residues in eukaryotic Kir channels.
- Kir2.2 GI: 118097849
- human Kir2.2 GI:23110982
- human Kir2.1 GI:8132301
- human Kir1.1 GI:1352479)
- human Kir3.1 GI:1352482
- human Kir3.4 GI:1352484
- human Kir6.1 GI:2493600
- human Kir7.1 GI:3150184
- KirBac1.1 GI:
- FIG. 2A-2E illustrates a structure of Kir2.2.
- FIG. 2A Stereoview of a ribbon representation of the Kir2.2 tetramer from the side with the extracellular solution above. Four subunits of the channel are shown. Approximate boundaries of the lipid bilayer are shown as bars.
- FIG. 2B A close-up view of the pore-region of a single subunit (in ribbon representation) with the turret, pore helix and selectivity filter labeled. Side chains of residues E139, R149 and a pair of disulfide-bonded cysteines (C123 and C155) are shown as sticks. Ionized hydrogen-bonds are indicated by dashed black lines.
- FIG. 2C Electron density (wire mesh, 2F o -F c , calculated from 50-3.1 ⁇ using phases from the final model and contoured at 1.0 ⁇ ) is shown for the side chains of E139 and R149 forming a salt-bridge.
- FIG. 2D FIG. 2E
- K + selectivity filter of the Kir2.2 channel FIG. 2 D
- FIG. 2E PDB ID 2R9R
- K + cross hatched circles
- water molecules solid spheres
- hydrogen bonds between R149 and E139 Kir, dashed black lines
- D379, M380 and waters Kv, dashed black lines
- FIG. 3A-3G illustrates the cavity and gates region of a Kir channel.
- FIG. 3A Electron density in the cavity of the Kir2.2 channel (A, F o -F c omit map, calculated from 50-3.1 ⁇ using phases from the final model and contoured at 2.0 ⁇ ) and of the KcsA channel ( FIG. 3B , PDB ID 1K4C, F o -F c omit map, calculated from 50-3.1 ⁇ using phases from the final model and contoured at 2.8 ⁇ ).
- the channels are shown as ribbon representations with the subunit closest to the viewer removed. Only the side chains facing the cavity are shown (sticks).
- FIG. 3C FIG.
- FIG. 3D Comparison of the transmembrane inner helix bundle activation gate of Kir2.2 ( FIG. 3C ) with the KcsA structure ( FIG. 3D , PDB ID 1K4C). For clarity, only two of the four subunits (ribbon) are shown. Side chains of the residues in the bundle crossing are shown as sticks and van der Waals surfaces. K + ions are shown as cross hatched spheres. Inner and Outer helices are indicated.
- FIG. 3E Superposition of the chicken Kir2.2 cytoplasmic domain ( ⁇ -carbon trace) and the mouse Kir2.1 cytoplasmic domain ( ⁇ -carbon trace, PDB ID 1U4F) in stereo viewed from the extracellular side.
- FIG. 3F ( FIG.
- FIG. 3F Comparison of the apex (G-loop) of the cytoplasmic pores of Kir2.2 ( FIG. 3F ) and mouse Kir2.1 ( FIG. 3G ), with the same view as FIG. 3 E.
- the cytoplasmic domains are shown as ⁇ -carbon traces, with residues 303-309 (Kir2.2) and 302-308 (Kir2.1) shown as CPK models.
- FIG. 4A-4F illustration of ion binding sites.
- FIG. 4A ( FIG. 4B ) ( FIG. 4C ) Electron density (wire mesh) of Rb + ( FIG. 4A , F o -F c map calculated to 4.0 ⁇ , contoured at 3.5 ⁇ for density in the filter and 2.0 ⁇ for density elsewhere), Sr 2+ ( FIG. 4B , 10 mM, F o -F c map calculated to 3.3 ⁇ , contoured at 1.5 ⁇ for density in the cavity and 3.0 ⁇ for density elsewhere) and Eu 3+ ( FIG. 4C , 10 mM, anomalous difference map calculated to 6.0 ⁇ , contoured at 2.8 ⁇ ) inside the Kir2.2 channel ion conduction pathway.
- Kir2.2 is represented as a ⁇ -carbon trace with the transmembrane domain and cytoplasmic domain closest to viewer removed for clarity. The ions are shown as spheres.
- FIG. 4D Electron density (200 mM Sr 2+ , F o -F c map calculated from 50-3.8 ⁇ , contoured at 2.5 ⁇ , wire mesh) of Sr 2+ (spheres) in the cavity of Kir2.2. The channel is shown as a ribbon with the subunit closest to the viewer removed. Only the side chains facing the cavity are shown (sticks).
- FIG. 4E Stereoview of the ion binding site near the upper ring of charges in the cytoplasmic domain of Kir2.2, viewed from the extracellular side.
- Electron density (200 mM Sr 2+ , F o -F c map calculated from 50-3.8 ⁇ , contoured at 4.5 ⁇ ) of Sr 2+ (spheres) is shown as wire mesh.
- FIG. 4F Stereoview of the ion binding site at the lower ring of charges in the cytoplasmic domain of Kir2.2, viewed from the intracellular side. Residues F255, D256, and K257 are shown as sticks, and hydrogen bonds between D256 from different subunits are indicated as dashed black lines. Electron density (200 mM Sr 2+ , F o -F c map calculated from 50-3.8 ⁇ , contoured at 4.5 a) of Sr 2+ (spheres) is shown as wire mesh.
- FIG. 5A-5D illustrates the unique structure of the extracellular entryway.
- FIG. 5A FIG. 5B
- FIG. 5A Surface representation of chicken Kir2.2 ( FIG. 5A ) and Kv1.2-Kv2.1 paddle chimera ( FIG. 5B , PDB ID 2R9R) in stereo, viewed from the extracellular side.
- the four protrusions formed by the top of the turrets are highlighted with a black perimeter and F148 in Kir2.2 is labeled.
- FIG. 5C Stereo representation of electron density (wire mesh) for the turret region (2F o -F c , calculated from 50-3.1 ⁇ using phases from the final model and contoured at 1.0 ⁇ ).
- FIG. 5D A close-up view of the turret region in a single subunit in stereo. Side chains of those conserved residues among the turrets of eukaryotic Kir channels, as well as C155 are shown as sticks. Hydrogen bonds between H108, D110 and C123 are indicated as dashed black lines.
- FIG. 6A-6D results showing the chicken Kir2.2 channel is a strong inward rectifier.
- FIG. 6C Macroscopic currents recorded from oocytes using patch-clamp.
- FIG. 7 provides a surface representation of Kir2.2, viewed from the side with the extracellular side above. The surface is shaded for qualitative assessment of the negative and positive electrostatic potential at the surface.
- FIG. 8 illustrates ion binding sites of Kir2.2 in the selectivity filter, central cavity, upper and lower rings of charges are shown as sticks (oxygens and stippled).
- the channel is represented as a a-carbon trace with the transmembrane domain and cytoplasmic domain closest to viewer removed for clarity.
- the present invention is based in part on the discovery of an important structural feature present in Kir channel proteins.
- the present invention relates to the discovery of a “turret region” which is highly ordered in structure and which differs in sequence among different Kir channel proteins.
- this turret region faces the outside of the cell making the protein accessible to compounds that bind or otherwise interact with this turret region thereby affecting the ability of the Kir channel to function.
- the discovery of the fact that this turret region, which differs in sequence among members of the Kir channel family, is structured provides a basis to identify compounds which can treat disease states related to Kir channel functions.
- Example 1 presents a determination of the crystal structure of a eukaryotic Kir channel protein.
- the crystal structure of the chicken Kir channel protein, Kir2.2 is presented. Excluding unstructured amino and carboxy termini, the chicken Kir2.2 protein is 90% identical to human Kir2.2.
- these structural studies demonstrate that Kir channels have a large structured turret region which provide the basis for the development of compounds that may be used to bind and interact with these turrets and treat disease states related to the functioning of Kir channels.
- these turret regions suggest approaches to the development of inhibitory compounds which will bind to a specific member of the Kir channel family of proteins and inhibit Kir channel function.
- FIGS. 1A-1C illustrates that a sequence alignment of various human Kir channels indicates that the turret region begins with a consensus sequence HGDL (or minor sequence variations thereof) and extends six amino acid residues after a highly conserved cysteine residue labeled as C123 in FIGS. 1A-1C .
- This turret region is highly conserved and most of the variation that occurs in the sequence is located in a variable portion located after the sequence HGDL up to the cysteine labeled as C123.
- This variable portion within the turret region constitutes a basis for differentiating Kir channels from one another and provides a target for mutagenesis assays to identify compounds capable of turret specific binding.
- the turret region of other Kir channels may be identified using sequence alignment programs and the teachings of the present invention relating to the consensus sequence and structural features of the Kir channels.
- the methods of the present invention for identifying a compound that modulates ion channel activity of a Kir channel comprises a two step process: a first step of identifying a compound which binds the turret region of a Kir channel; and a second step of determining if the compound modulates the ion channel activity of the Kir channel.
- a Kir channel In a first method for identifying compounds that modulate the ion channel activity of a Kir Channel, antibodies are prepared against a Kir channel.
- Kir channels A variety of Kir channels are known and the methods described below may be used to prepare antibodies against any Kir channel.
- the first type are human Kir channel proteins.
- the second type are chimeric constructs which utilize a non-human sequence, preferably a eukaryotic sequence, such as a chicken sequence, in particular a chicken Kir 2.2 sequence into which a human Kir channel turret region has been inserted, thereby replacing the native turret region.
- chimeric proteins which utilize a chicken Kir2.2 “scaffold” into which the turret region from a given human Kir channel is inserted may be used to prepare antibodies which are specific for different human Kir channel proteins.
- Both human and chimeric Kir channels may be full length proteins or may contain deletions at the amino and/or carboxy termini of the protein if desired.
- the cDNA sequences for exemplary human Kir channels are presented in SEQ ID NOS 30-43.
- the cDNA sequence of the chicken Kir2.2 channel is presented in SEQ ID NO: 45.
- DNA and cDNA sequences for other types of Kir channels are available in public databases,
- the turret regions of exemplary human Kir proteins are identified in SEQ ID NOs: 46-56.
- a protocol for preparing a chicken Kir 2.2 channel protein is provided below. Using standard techniques this procedure may be modified to prepare any of the human Kir channel proteins or a desired chimeric Kir channel protein.
- a synthetic gene fragment (Bio Basic, Inc.) encoding residues 38 to 369 of chicken Kir2.2 channel (GI:118097849) was ligated into the XhoI/EcoRI cloning sites of a modified pPICZ-B vector (Invitrogen).
- the resulting protein has green fluorescent protein (GFP) and a 1D4 antibody recognition sequence (TETSQVAPA) on the C terminus (I), separated by a PreScission protease cleavage site (SNSLEVLFQ/GP).
- the construct was linearized using PmeI and transformed into a HIS+ strain of SMD1163 of Pichia pastoris (Invitrogen) by electroporation (BioRad Micropulser). Transformants were selected on YPDS plates containing 400-1200 ⁇ /ml Zeocin (Invitrogen). Resistant colonies were tested for expression by anti-1D4 tag Western Blot. For large-scale expression, small cultures grown from the best expressing colony were diluted into BMGY media (Invitrogen) and inoculated at 29° C. overnight, until OD600 reached between 20-30. Cells were then pelleted, resuspended in BMM media (Invitrogen) and expressed overnight at 24° C. Cells were harvested, flash-frozen in liquid N2, and stored at ⁇ 80° C. until needed.
- the lysis buffer contained 150 mM KCl, 50 mM TRIS-HCl pH 8.0, 0.1 mg/ml deoxyribonuclease I, 0.1 ⁇ g/ml pepstatin, 1 ⁇ g/ml leupeptin, 1 ⁇ g/ml aprotinin, 0.1 mg/ml soy trypsin inhibitor, 1 mM benzamidine, 0.1 mg/ml AEBSF, with 1 mM phenylmethysulfonyl fluoride added just before lysis (3.0 ml lysis buffer/g cells).
- pH of the lysate was adjusted to 8.0 with KOH.
- the lysate was extracted with 100 mM DM (n2 decyl- ⁇ -D-maltopyranoside, Anatrace, solgrade) at room temperature for 1 hour with stirring, and then centrifuged for 40 minutes at 30,000 g, 10° C. Supernatant was added to 1D4-affinity resin pre-equilibrated with 150 mM KCl, 50 mM TRIS-HCl pH 8.0, and 4 mM DM. Suspension was layered with Argon and mixed by inversion for 2 hours at room temperature.
- Beads were collected on a column by gravity, washed with 2 column volumes of buffer (150 mM KCl, 50 mM TRIS-HCl pH 8.0, 1 mM EDTA pH 8.0, and 4 mM DM), and eluted with buffer plus 1 mg/ml 1D4 peptide (AnaSpec, Inc.) over 1 hour at room temperature. 20 mM DTT (Dithiothreitol) and 3 mM TECP were added to eluted protein. The protein was then digested with PreScission protease (20:1 w/w ratio) overnight at 4° C.
- Concentrated protein was further purified on a Superdex-200 gel filtration column in 150 mM KCl, 20 mM TRIS-HCl pH 8.0, 4 mM DM (anagrade), 3 mM TCEP, 20 mM DTT and 1 mM EDTA at 4° C.
- the protein extract is maintained in a mild detergent, such as DM, which will maintain the three-dimensional structure of the Kir channel.
- chimeric Kir channel protein may be prepared by inserting the turret region of a human Kir channel protein into the Kir2.2 chicken sequence described above. The location of the turret regions are identified in FIGS. 1A-1C .
- site-directed mutagenesis procedures may be used to insert the coding sequence for a human turret region into a eukaryotic “scaffold” Kir channel coding region.
- Strategene's QuickChange® is used.
- QuickChange® utilizes a supercoiled double-stranded DNA (dsDNA) vector with an insert of interest and two synthetic oligonucleotide primers containing the desired mutation.
- the oligonucleotide primers, each complementary to opposite strands of the vector, are extended during temperature cycling by PfuTurbo DNA polymerase.
- the desired mutation (in this case—the insertion of the human turret region) should be in the middle of the primer with about 10-15 bases of correct sequence on both sides. Incorporation of the oligonucleotide primers generates a mutated plasmid containing staggered nicks. Following temperature cycling, the product is treated with Dpn I.
- the Dpn I endonuclease (target sequence: 5′-Gm 6 ATC-3′) is specific for methylated and hemimethylated DNA and is used to digest the parental DNA template and to select for mutation-containing synthesized DNA. DNA isolated from almost all E. coli strains is Dam methylated and therefore susceptible to Dpn I digestion.
- the nicked vector DNA containing the desired mutations is then transformed into XL1-Blue supercompetent cells. See, e.g. U.S. Pat. Nos. 5,789,166, 5,932,419, and 6,391,548.
- the chicken Kir2.2 protein may be used as a scaffold and the human Kir2.2 channel turret region synthesized for insertion. This methodology can be repeated with any combination of scaffold protein and human turret region.
- turret regions in the human Kir channels site directed mutagenesis may be used to prepare proteins having mutations in the DNA sequence of the turret.
- Strategene's QuickChange® is used.
- Such mutations should be non-silent mutations—that is the mutations should result in amino acid changes at positions within the turret region.
- a human Kir protein or a chimeric Kir channel protein is prepared using standard techniques such as those outlined herein, and used in standard techniques to obtain antibodies.
- antibodies include but are not limited to polyclonal, monoclonal, human, humanized chimeric, an intact immunoglobulin molecule, an antibody fragment, single chain, ScFv, Fab fragments, F(ab) 2 Fab, Fv and a disulfide linked Fv.
- Host animals can be immunized by injection with a human Kir channel protein, or chimeric Kir protein or fragments of these proteins. Animals which may be used to generate antibodies include, but are not limited to, rabbits, mice, rats, sheep, goats, and others known in the art.
- the human and chimeric proteins of the present invention may also be conjugated to an immunogenic carrier, e.g., bovine serum albumin (BSA) or keyhole limpet hemocyanin (KLH).
- BSA bovine serum albumin
- KLH keyhole limpet hemocyanin
- adjuvants may be used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hernocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (Bacille Calmette-Guerin) and Corynebacterium parvum.
- BCG Bacille Calmette-Guerin
- any technique that provides for the production of antibody molecules by continuous cell lines in culture may be used, These include but are not limited to the hybridoma technique originally developed by Kohler and Milstein [Nature 256:495-497 (1975)], as well as the trioma technique, the human B-cell hybridoma technique [Kozbor et al., Immunology Today 4:72 1983); Cote et al., Proc. Nail. Acad. Sci. U.S.A.
- Human antibodies can be prepared using any technique. Examples of techniques for human monoclonal antibody production include those described by Cole et al, (Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77, 1985) and by Boemer et al, (J. Immunol., 147(1):86-95, 1991). Human antibodies (and fragments thereof) can also be produced using phage display libraries (Hoogenboom et al., J. Mol. Biol., 227:331, 1991; Marks et al., J. Mol, Biol., 222:581, 1991), Information on monoclonal and other types of therapeutic antibodies can also be found in Cellular and Molecular Immunology, 6th Edition, [A. K. Abbas, A.
- Human antibodies can also be obtained from transgenic animals.
- transgenic, mutant mice that are capable of producing a full repertoire of human antibodies, in response to immunization, have been described (see, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551-255 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggennann et al., Year in Immunol., 7:33 (1993)).
- Humanized antibodies may also be used in the present invention.
- Antibody humanization techniques generally involve the use of recombinant DNA technology to manipulate the DNA sequence encoding one or more polypeptide chains of an antibody molecule.
- a humanized form of a non-human antibody is a chimeric antibody or antibody chain (or a fragment thereof, such as an Fv, Fab, Fab′, or other antigen-binding portion of an antibody) which contains a portion of an antigen binding site from a non-human (donor) antibody integrated into the framework of a human (recipient) antibody.
- Methods for humanizing non-human antibodies are well known in the art.
- humanized antibodies can be generated according to the methods of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986), Riechmann et al., Nature, 332:323-327 (1988), Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody.
- Methods that can be used to produce humanized antibodies are also described in U.S. Pat. No. 4,816,567 (Cabilly et al.), U.S. Pat. No. 5,565,332 (1-Hoogenboom et al.), U.S. Pat. No.
- Techniques described for the production of single chain antibodies [U.S. Pat. Nos. 5,476,786 and 5,132,405 to Huston; U.S. Pat. No. 4,946,778] can be adapted to produce single chain antibodies specific for a Kir channel protein.
- An additional embodiment of the invention utilizes the techniques described for the construction of Fab expression libraries [Huse et al., Science 246:1275-1281(1989)] to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity for the Kir channel proteins.
- Antibody fragments which contain the idiotype of the antibody molecule can be generated by known techniques.
- such fragments include but are not limited to: the F(ab′) 2 fragment which can be produced by pepsin digestion of the antibody molecule; the Fab′ fragments which can be generated by reducing the disulfide bridges of the F(ab′) 2 fragment, and the Fab fragments which can be generated by treating the antibody molecule with papain and a reducing agent.
- Antibodies or fragments thereof can also include insertions, deletions, substitutions, or other selected modifications of particular regions or specific amino acids residues, provided the activity of the antibody or antibody fragment is not significantly altered or impaired compared to the non-modified antibody or antibody fragment.
- Such methods are readily apparent to a skilled practitioner in the art and can include site-specific mutagenesis of the nucleic acid encoding the antibody or antibody fragment.
- the compounds of the present invention include nucleic acids.
- nucleic acid sequences capable of binding to a Kir channel may be used in the practice of the present invention. These nucleic acids may be identified using in vitro selection of sequences which bind Kir channel proteins, in particular the turret region of the Kir channel proteins.
- One type of nucleic acid that is of particular interest is an aptamer.
- aptamers are small nucleic acid sequences ranging from 15-50 bases in length that fold into defined secondary and tertiary structures that bind to another molecule. This binding is not the typical nucleic acid to nucleic acid hydrogen bond formation but the binding of aptamers can include all other types of covalent and noncovalent binding.
- the nucleic acid is DNA, however, other nucleic acids such as RNA may be used.
- the nucleic acids may be modified or prepared using techniques known in the art to increase the stability of nucleic acids. Representative examples of how to make and use aptamers to bind a variety of different target molecules can be found in the following U.S. Pat. Nos. 5,582,981; 5,595,877; 5,637,459; 6,020,130; 6,028,186; 6,030,776; and 6,051,698. See also Published U.S. patent application Ser. No. 11/917,884 (publication No.
- Small Protein/Peptide Compounds may also be used in the practice of the present invention.
- small proteins may be prepared and screened for the ability to bind to a Kir channel protein based on binding assays disclosed herein and known in the art.
- Small molecules such as toxins may also be used in the practice of the invention.
- small proteins/peptides modeled on toxins which bind to Kir channel proteins may be prepared and tested for the ability to bind and modulate the activity of Kir channel proteins. (Ramu, et al. (2008) Engineered specific and high affinity inhibition for a subtype of inward rectifier Kir channels Proc. Nat'l Acid Sci USA 105:10774-10778)
- a variety of toxins may provide information useful in designing a compound useful in the practice of the present invention.
- scorpion toxins (Lu and Mackinnon, 1997 Biochemistry, vol. 36, no, 23, pp 6936 to 6940) snake toxins (for example, the 57 amino acid ⁇ -dendrotoxin from the green mamba snake which inhibits Kir 1.1 channels, (J. P. Imredy, C. Chen, R. Mackinnon, BioChemistry 37, 14867 (Oct. 20, 1998)) and bee venom toxins (Ramu, et al. (2008) Engineered specific and high affinity inhibition for a subtype of inward rectifier Kir channels Proc.
- toxins are often small proteins typically between 20 and 50 amino acids in size containing disulfide bridges.
- disulfide bridges For some of these toxins, the surface important for binding to a Kir channel protein is known and stretches of amino acids of less than 10 amino acids are believed to be important for binding specificity.
- a library of these toxin-based compounds may be prepared while maintaining the key amino acids such as cysteine residues that are important for the folding and structure of the proteins.
- the amino acid residues important for binding to a Kir channel may be randomized to generate proteins/peptides with enhanced binding strength and turret based specificity for the different members of the Kir channel family of proteins.
- Phage display libraries may be prepared using known protocols. “Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface”. Science 288 (4705): 1315-1317. Smith G P, Petrenko V A (1997). “Phage display”. Chem. Rev. 97 (2): 391-410. Kehoe J W, Kay B K (2005), “Filamentous phage display in the new millennium”. Chem. Rev. 105 (11): 4056-4072. Hufton S E, Moerkerk P T, Meulemans E V, de Brüine A, Arends J W, Hoogenboom H R (1999).
- phage display the protein/peptide constructs may be expressed on the outer coat of the phage.
- a Kir channel protein may be immobilized on the surface of a well of a standard assay plate, and a phage that displays a protein that binds to Kir channels will bind the target Kir channel protein and remain bound while non-binding phage are removed by washing the plates. The bound phage can be eluted and used to produce more phage for further binding assays.
- These binding assays may be performed with Kir channels having mutated turrets and wild type turrets to select for proteins/peptides that bind in the turret region. Repeated cycles of these binding assays (‘panning’) results in the identification of phage containing potentially strong binding sequences.
- Phage that contain these strong binding sequences can be used to infect a suitable bacterial host, and phagemids are collected and the DNA sequence of interest encoding the binding region excised and sequenced to identify the protein/peptide compound which be further tested using the assays described below.
- Small molecules may also be used in the practice of the present invention.
- small molecules may be prepared and screened for the ability to bind to a Kir channel protein based on binding assays disclosed herein and known in the art. See for example U.S. Pat. No. 6,641,997. Additionally, small molecule libraries may also be screened.
- an antibody may be generated by the methods described above, a variety of different immunoassays may be performed to identify antibodies that bind property folded Kir channels, are specific for the turret region of the Kir channel and can differentiate between different members of the Kir family based on the turret region.
- immunoassays involve contacting a Kir channel protein with an anti-Kir channel antibody under conditions effective, and for a period of time sufficient, to allow the formation of immune complexes (primary immune complexes).
- a Kir channel protein with an anti-Kir channel antibody under conditions effective, and for a period of time sufficient, to allow the formation of immune complexes (primary immune complexes).
- Forming such complexes is generally a matter of simply bringing into contact the antibody and the Kir channel protein sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to, any molecule (e.g., antigens) present to which the antibodies can bind.
- any molecule e.g., antigens
- the sample-antibody composition such as an ELISA plate or Western blot
- the sample-antibody composition can then be washed to remove any non-specifically bound antibody species, allowing only those antibodies specifically bound within the primary immune complexes to be detected.
- Immunoassays can include methods for detecting or quantifying the amount of a molecule of interest (such as the disclosed biomarkers or their antibodies) in a sample.
- a label or marker such as any radioactive, fluorescent, biological or enzymatic tags or any other known label.
- Such assays include but are not limited to ELISA, western blots, radioimmunoassay, (enzyme-linked immunosorbant assay), “sandwich” immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), precipitation reactions, agglutination assays (e.g., gel agglutination assays, hemagglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, and other assays known in the art.
- Antibody binding can be detected by detecting a label on the primary antibody or the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody.
- the secondary antibody is labeled.
- Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
- Electrophoresis is the migration of charged molecules in solution in response to an electric field. Their rate of migration depends on the strength of the field; on the net charge, size and shape of the molecules and also on the ionic strength, viscosity and temperature of the medium in which the molecules are moving.
- electrophoresis is simple, rapid and highly sensitive. It is used analytically to study the properties of a single charged species, and as a separation technique. Electrophoresis is used in the Western blots described below.
- Enzyme-Linked Immunosorbent Assay is an immunoassay that can detect an antibody specific for a protein.
- a detectable label bound to either an antibody-binding or antigen-binding reagent is an enzyme. When exposed to its substrate, this enzyme reacts in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorometric or visual means.
- Enzymes which can be used to detectably label reagents useful for detection include, but are not limited to, horseradish peroxidase, alkaline phosphatase, glucose oxidase, galactosidase, ribonuclease, urease, catalase, malate dehydrogenase, staphylococcal nuclease, asparaginase, yeast alcohol dehydrogenase, alpha.-glycerophosphate dehydrogenase, triose phosphate isomerase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase.
- ELISA procedures see Voller, A. et al., J. Clin.
- ELISA assays are used to identify antibodies that bind to the Kir channel proteins and are specific to the turret region.
- a first ELISA assay is performed to identify antibodies that bind to the Kir channel protein.
- an ELISA Assay is performed to identify antibodies that bind to human Kir 2.2 channel protein.
- Substrate Solution 1:1 TMB:H 2 O 2 (100 ul/well, 10 ml/plate)
- the plates are then examined to determine if antibodies for a Kir channel protein are present using standard techniques as described above.
- Western blotting or immunoblotting allows the determination of the molecular mass of a protein and the measurement of relative amounts of the protein present in different samples. Detection methods include chemiluminescence and chromagenic detection. Standard methods for Western blot analysis can be found in, for example, D. M. Bollag et al., Protein Methods (2d edition 1996) and E. Harlow & D. Lane, Antibodies, a Laboratory Manual (1988), U.S. Pat. No. 4 , 452 , 901 , each of which is herein incorporated by reference in their entirety for teachings regarding Western blot methods. Generally, proteins are separated by gel electrophoresis, usually SDS-PAGE.
- the assays used in the present invention for initial antibody screening it is preferred to use an SDS-PAGE so as to denature the Kir channel proteins used in the blot.
- the proteins are transferred to a sheet of special blotting paper, e.g., nitrocellulose, though other types of paper, or membranes, can be used.
- the proteins retain the same pattern of separation they had on the gel.
- the blot is incubated with a generic protein (such as milk proteins) to bind to any remaining sticky places on the nitrocellulose.
- An antibody is then added to the solution which is able to bind to its specific protein.
- probes for the detection of antibody binding can be conjugated anti-immunoglobulins, conjugated staphylococcal Protein A (binds IgG), or probes to biotinylated primary antibodies (e.g., conjugated avidin/streptavidin).
- FLOWCHART 1 a western blot is performed to determine if an antibody binds to the denatured form of a Kir channel protein.
- the combination of the ELISA and the Western blot Kir channel assays as illustrated in FLOWCHART 1 facilitates the identification of antibodies that recognize the properly folded native Kir channel (ELISA Positive) but not the denatured (Western Negative) form of the protein.
- the determination of the atomic structure of what constitutes the turret region of the Kir channels identifies where to introduce such mutations so as to selectively identify anti-Kir Channel antibodies that are directed against the turret.
- Such mutations may be made in a variety of places, such as following the L residue in the sequence HGDL (or slight variations of that sequence) and up to but not including the conserved cysteine labeled C123 in the structure of the proteins (see FIGS. 1A-1C ). Examples of these variable portions of certain turret regions is provided in SEQ ID NOs 1-13. Kir channel proteins which contain mutations in the turret region, or preferably in the variable portion, may be used in assays described below.
- ELISA assays may be performed as illustrated in FLOWCHART 1. These ELISA assays utilize Kir channels with mutated turret regions. Antibodies that bind a normal Kir channel in an ELISA assay but do not bind a channel with a mutated turret will be isolated since these antibodies may be considered turret specific—that is the epitope for the antibody is located in the turret region of the protein. The source of these antibodies will be used to prepare monoclonal antibodies using standard techniques as described above. An additional assay described below and presented in FLOWCHART 2 identifies antibodies or other compounds with the ability to bind the turret region using a fluorescent assay.
- the next step is to determine if an antibody which binds the turret region of a Kir channel is capable of modulating electrolyte processing.
- Monoclonal antibodies prepared from turret specific antibodies identified above can be used in electrophysiological assays as can other compounds found to have binding specificity for the turret region of Kir channels.
- Useful electrophysiological assays include a variety of in vitro and in vivo assays, e.g., measuring voltage, current, measuring membrane potential, measuring ion flux, e.g., potassium or rubidium, measuring potassium concentration, measuring second messengers and transcription levels, and using e.g., voltage-sensitive dyes, radioactive tracers, electrode voltage clamps and patch-clamp electrophysiology. Such assays can be used to test for both inhibitors and activators of Kir channels.
- Modulators of the Kir channels may be tested using biologically active, functional Kir channels, either recombinant or naturally occurring.
- the subunits are typically expressed and modulation is tested using one of the in vitro or in vivo assays described herein.
- samples or assays that are treated with a potential Kir channel turret binding compounds inhibitors or activators are compared to control samples without the test compound, to examine the extent of modulation.
- Control samples e.g. those untreated with the compounds are assigned a relative Kir channel activity value of 100. Inhibition is present when Kir channel activity value relative to the control is about 90%, preferably 50%, more preferably 25%.
- the compounds may also result in activation of Kir channels. Activation of channels is achieved when the select Kir channel activity value relative to the control is 110%, more preferably 150%, more preferable 200% higher. It is possible that for treating some diseases states such activating compounds may be useful alone or in combination with inhibitors.
- Changes in ion flux may be assessed by determining changes in polarization (i.e., electrical potential) of the cell or membrane expressing the Kir channels of this invention.
- a preferred means to determine changes in cellular polarization is by measuring changes in current (thereby measuring changes in polarization) with voltage-clamp and patch-clamp techniques, e.g., the “outside-out” mode, and the “whole cell” mode (see, e.g., Ackerman et al., New Engl. J. Med. 336:1575-1595 (1997) and Single Channel Recording , Plenum Press, B. Sakmann and E. Neher eds).
- Assays for compounds capable of inhibiting or increasing potassium flux through the channel proteins can be performed by application of the compounds to a bath solution in contact with and comprising cells having an channel of the present invention (see e.g., Blatz et al., Nature 323:718-720 (1986); Park, J. Physiol. 481:555-570 (1994)).
- the compounds to be tested are present in the range from 1 pM to 100 ⁇ M.
- the effects of the test compounds upon the function of the Kir channels can be measured by changes in the electrical currents or ionic flux or by the consequences of changes in currents and flux.
- Changes in electrical current or ionic flux are measured by either increases or decreases in flux of cations such as potassium or rubidium ions.
- the cations can be measured in a variety of standard ways. They can be measured directly by concentration changes of the ions or indirectly by membrane potential or by radiolabeling of the ions. Consequences of the test compound on ion flux can be quite varied. Accordingly, any suitable physiological change can be used to assess the influence of a test compound on the Kir channels of this invention.
- the effects of a test compound can be measured by a toxin binding assay.
- transmitter release e.g., dopamine
- hormone release e.g., insulin
- transcriptional changes to both known and uncharacterized genetic markers e.g., northern blots
- cell volume changes e.g., in red blood cells
- immunoresponses e.g., T cell activation
- changes in cell metabolism such as cell growth or pH changes
- changes in intracellular second messengers such as [Ca 2+ ].
- One assay that may be of particular use in the present invention is a two electrode voltage clamp assay. This assay may be performed using any of these Kir channel proteins and compounds of the present invention using modifications readily known to those in the art. In the example below, this assay was conducted using the chicken Kir 2.2 channel. To perform this assay, Xenopus oocytes will be harvested from mature female Xenopus laevis and defolliculated by collagenase treatment for 1-2 hours.
- Oocytes will then rinsed thoroughly and stored in ND96 solution (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl 2 , 1.0 mM MgCl 2 , 5 mM HEPES, 50 ⁇ g/ml gentamycin, pH 7.6 with NaOH).
- ND96 solution 96 mM NaCl, 2 mM KCl, 1.8 mM CaCl 2 , 1.0 mM MgCl 2 , 5 mM HEPES, 50 ⁇ g/ml gentamycin, pH 7.6 with NaOH.
- Defolliculated oocytes will be selected 2-4 hours after collagenase treatment and injected with cRNA the next day. The injected oocytes will be incubated in ND96 solution for 1-5 days before recording. All oocytes will be stored in an incubator at 18° C.
- the desired human or chimeric Kir channel protein DNA will be sub-cloned into the pGEM vector (Promega).
- cRNA will be prepared using T7 RNA polymerase (Promega) from NdeI-linearized plasmid DNA.
- oocytes will be held at 0 mV and pulsed from ⁇ 80 mV to +80 mV with 10 mV increment steps.
- Recording solution will contain 98 mM KCl, 0.3 mM CaCl 2 , 1 mM MgCl 2 , and 5 mM HEPES pH 7.6.
- the ionic currents will be recorded with an oocyte clamp amplifier (OC-725C, Warner Instrument Corp.).
- the recorded signal will be filtered at 1 kHz and sampled at 10 kHz using an analogue-to-digital converter (Digidata 1440A, Axon Instruments, Inc) interfaced with a computer.
- pClamp10.1 software (Axon Instruments, Inc) will be used for controlling the amplifier and data acquisition.
- Patch clamp assays use a micropipette attached to a cell membrane to allow recording from a single ion channel in the cell membrane.
- a micropipette which serves as a microelectrode is positioned next to a cell, and a piece of the cell membrane (the ‘patch’) is drawn into the microelectrode tip; the glass tip of the micropipette forms a high resistance ‘seal’ with the cell membrane, then whole cell mode is entered by applying suction. Next, the pipette is moved away from the cell to form an outside-out patch. Examples of useful protocols may be found in Single Channel Recording, Plenum Press, B. Sakmann and E. Neher eds. This configuration can be used to study Kir channels present in the isolated patch of membrane. Variations of this technique include the “perforated patch” technique, or the patch of membrane can be pulled away from the rest of the cell.
- each oocyte will be incubated in a hypertonic solution containing 200 mM NaCl, 130 mM KCl, 5 mM K 2 EDTA, 5 mM K 2 HPO 4 , 5 mM KH 2 PO 4 pH 7.2 for 5-10 minutes and the vitelline membrane will be removed before seal formation.
- Currents will be recorded in either cell-attached or outside-out configuration with an Axopatch 200B amplifier, Digidata 1440A analogue-to-digital converter and pClamp10.1 software to control membrane voltage and record.
- the membrane will be first held at 0 mV followed by a 10-second voltage ramp from +80 mV to ⁇ 80 mV.
- the pipette solution will contain 140 mM KCl, 5 mM K 2 HPO 4 , 5 mM KH 2 PO 4 , 0.3 mM CaCl 2 , 1 mM MgCl 2 , pH 7.2 with KOH.
- the bath solution will contain 130 mM KCl, 5 mM K 2 EDTA, 5 mM K 2 HPO 4 , 5 mM KH 2 PO 4 , pH 7.2 with KOH.
- a control current is measured while perfusing with the recording solution without the compound present. Then, a second current is recorded while perfusing with the solution and the compound of interest. Any difference in current levels indicates that the compound acts to modulate the activity of the Kir channel.
- An example of this type of assay may be found in Lu and MacKinnon 1997 Biochemistry, vol. 36, no. 23, pp. 6936-6940 or Namba et al., 1996 FEBS Letters vol. 386, pp. 211-214.
- Another electrophysiological assay which may be used in the present invention is a planar lipid bilayer assay.
- a lipid bilayer is created and the Kir channel protein is introduced into the lipid bilayer.
- a hydrophobic material such as Teflon is used to prepare the lipid bilayer by making a small hole (an aperture) in a sheet of Teflon.
- a syringe containing a solution of lipids dissolved in an organic solvent is introduced to the hole and a bilayer is formed in the center of the aperture, with solvent forming the perimeter of the newly formed bilayer.
- the Teflon sheet provides a partition between two chambers allowing the placement of electrodes on both sides of the sheet.
- the purified Kir channel is reconstituted into lipid vesicles and then fused with the bilayer after it is formed.
- the detergent coating facilitates insertion into the bilayer.
- the amount of lipid desired (preferably PE:PG 3:1) is pipetted into a glass vial (about 5-10 mg). The lipid is dried under argon and then further under a room temperature vacuum for about 3 hours.
- the lipid is rehydrated with hydration buffer (10 mM HEPES 7.4 (KOH), 450 mM KCl, 4 mM N-methylglucamine, 2 mM DM to a final lipid concentration of 10 mg/ml and vortexed briefly.
- the glass vial is flushed with argon and the lipid mixture is sonicated mildly, i.e., with short pulses of no longer than 30 seconds each. In between sonication pulses, the lipid mixture is cooled in a room temperature water bath to ensure that the lipid mixture does not get too hot. This procedure is repeated until the lipid mixture becomes translucent with a distinct pink shade.
- a solution containing 50 mM DM in the hydration buffer is prepared.
- the DM solution is added to the lipid mixture to give a final concentration of 10 mM of DM and rotated at room temperature for 2 hours.
- the Kir channel is added to the desired ratios (e.g., about 0.05-0.1).
- the concentration of DM is then raised to 17.5 mM and the mixture is rotated at room temperature for 1 hour.
- the detergent/lipid mixture is then put into dialysis tubing and dialysed against the hydration buffer.
- Another assay which may be used to identify compounds which specifically bind the Kir channel turret region is an assay utilizing a fluorescent dye.
- a suitable dye is FIuxORTM available from Invitrogen (catalog nos, F10016, E10017), An example of this method is shown in FLOWCHART 2.
- the FluxORTM reagent is a fluorogenic indicator dye, which is loaded into cells as a mernbrance-permeable Acetoxymethanol (AM) ester.
- the FluxORTM reagent is dissolved in DMSO and further diluted with the FluxORTM assay buffer, a physiological Hank's balanced salt solution, for loading into cells.
- Pluronic® surfactants which disperse and stabilize the dye are used to facilitate loading in aqueous solution.
- Mammalian cells such as HEK, COS or CHO cells are grown in culture and incubated with the dye. Inside the cell, the non-fluorescent AM ester form of the FluxORTM dye is cleaved by endogenous esterases into a flourogenic thallium-sensitive indicator. The thallium-sensitive form is retained in the cytosol and its extrusion is inhibited by water-soluble Probenecid, which blocks organic anion pumps. The dye-loading buffer is replaced with fresh, dye-free assay buffer, composed of physiological HBSS containing Probenecid, before the assay.
- thallium is added to the cells with a stimulus solution that opens potassium-permeant ion channels with a mild depolarization or agonist addition. Thallium then passes into cells through open potassium channels according to a strong inward driving force. Upon binding cytosolic thallium, the de-esterified FluxORTM dye exhibits a strong increase in fluorescence intensity at its peak emission of 525 mm Baseline and stimulated fluorescence is monitored in real time to give a dynamic, functional readout of thallium redistribution across the membrance with no interference from quencher dyes.
- inhibitors such as, for example, the compounds of the present invention may slow the rate of entry of thallium and thus reduce the onset of a fluorescent signal.
- This assay may be used for the selection of compounds that specifically bind to the turret regions of the Kir proteins. To identify such compounds a first group of cells would be transfected with wild type Kir channels and a second group of cells transfected with Kir channel having mutated turrets as illustrated in FLOWCHART 2. Test compounds such as the antibodies identified in the assays above would be added to the cells to screen for those compounds which inhibit or reduce the onset of fluorescence upon addition of the thallium dye due to inhibition of the channel. Compounds which reduced the rate of thallium intake in cells with normal turrets but had no effect on cells with mutant turrets would be classified as turret specific inhibitor compounds.
- This assay may also be used to determine the specificity of the compounds for given turrets, in other words, the compounds may be introduced into cells which have been transfected with different versions of the Kir Channel to determine if the compound is specific for a given type of Kir Channel protein.
- assays such as an ELISA assay may be performed in which an antibody is tested against a variety of different Kir Channels to determine if the antibody is specific for a single type of Kir Channel.
- antibodies that would be used as therapeutic compounds will bind to only one type of Kir channel in the turret region.
- Compounds that bind to the turret region of a Kir channel and which modulate the ion channel activity of a Kir channel may be administered to a subject to determine if such compounds are able to treat a given condition.
- a compound may be administered to a subject such as a mammal with a given disease state using known methods of administration and the subject is then monitored clinically and tested using biochemical assays to determine if the compound is able to treat the condition using known assays for the disease state. It is believed that a variety of conditions may be treated with the compounds of the present invention, including, but not limited to, diabetes mellitus, hypertension, cardiac arrhythmia and epilepsy.
- Example 1 provides the first determination of the crystal structure of a euraryotic Kir channel protein and identification of the structured turret region present in Kir channel proteins. (See Crystal Structure of the Eukaryotic Strong Inward - Rectifier K + Channel Kir 2.2 at 3.1 ⁇ Resolution , X. Tao, J. L. Avalos, J. Chen and R. MacKinnon, Science 2009 December 18; 326 (5960); 1668.)
- K + channels conduct K + ions most efficiently in one direction, into the cell.
- Kir2 channels control the resting membrane voltage in many electrically excitable cells and heritable mutations cause periodic paralysis and cardiac arrhythmia.
- the channel's extracellular surface might explain the relative insensitivity of eukaryotic inward rectifiers to toxins.
- These same surface features also suggest a possible approach to the development of inhibitory agents specific to each member of the inward-rectifier K + channel family.
- a crystal structure reveals the structural basis of diode-like conduction properties and relative toxin insensitivity in inward rectifier K + channels.
- Kir channels are analogous to one-way conductors, or diodes, in solid-state electronic devices.
- Kir channel toxins are rare, and no specific toxins against Kir2 channels have been discovered.
- the eukaryotic Kir channels contain several amino acid sequence motifs and conserved amino acids that are essential to their functional properties ( FIGS. 1A-1C ).
- the selectivity filter comprises the ‘canonical’ filter sequence TXGYGDX, where X represents an aliphatic amino acid ( FIGS. 1A-1C ).
- the corresponding sequence in eukaryotic Kir channels is TXGYGFR, with F sometimes replaced by another amino acid.
- the amino acids FR signify a marked variation on the filter sequence.
- Eukaryotic Kir channels also contain an absolutely conserved pair of cysteine residues flanking the pore-region, which is the re-entrant peptide segment that forms the pore-helix and selectivity filter of K + channels. Between the outer helix (the first transmembrane segment) and pore-region the ‘turret’, though varied amongst inward rectifiers, contains the sequence HGDL that could be considered a signature of eukaryotic Kir channels, Finally, through extensive studies combining electrophysiology and mutagenesis several acidic amino acids (D and E) are known to be critical to inward rectification (9-19), and motifs containing basic amino acids (e.g. PKKR) are critical to PIP 2 activation of Kir channels (28-35). These positions are enclosed in boxes on the sequences in FIGS. 1A-1C .
- D and E acidic amino acids
- PKKR motifs containing basic amino acids
- the Kir2.2 channel from chicken is 90% identical to the human ortholog (excluding the N- and C-termini) and contains all of the sequence characteristics of a strong inward rectifier (36).
- FIGS. 6A-6D shows that the chicken Kir2.2 channel expressed in Xenopus oocytes indeed functions as a strong rectifier.
- oocyte two-electrode voltage clamp recordings with 98 mM KCl in the bath solution inward currents are much larger than outward currents ( FIG. 6B ).
- on-cell and excised gigaseal patch recordings channel activity is observed at hyperpolarizing (negative internal) membrane voltages but not at depolarizing (positive internal) voltages ( FIG. 6C ).
- the single channel conductance measured near ⁇ 80 mV is approximately 40 pS, which is very similar to the values reported for the guinea pig and mouse Kir2.2 channels (37, 38) ( FIG. 6D , inset).
- the sharp transition between channel conductance and non-conductance as a function of membrane voltage is characteristic of a strong rectifier (36). Note that upon patch excision from the oocyte surface some outward current is observed at voltages slightly positive to the reversal potential because the concentration of intracellular blockers is decreased ( FIG. 6C , trace labeled (C)).
- FIGS. 6A-6D The electrophysiological recordings shown in FIGS. 6A-6D were made using a similar construct with N- and C-terminal truncations, confirming that the crystal structure corresponds to a functional channel unit with strong rectifying properties.
- the Kir2.2 model consisting of the cytoplasmic domain and transmembrane channel, was refined at 3.1 ⁇ to a free R-factor of 0.27.
- a ribbon diagram in stereo shows the transmembrane pore (above) and the cytoplasmic pore (below) ( FIG. 2A ).
- Kir2.2 is quite different from prokaryotic Kir channels owing to minimal ( ⁇ 20%) sequence conservation.
- the cysteine pair that is absolutely conserved among eukaryotic Kir channels creates a circularized pore region through covalent linkage of the segment preceding the pore helix (C123) to the segment following the selectivity filter (C155) ( FIG. 2B ).
- the existence of a disulfide bond was correctly predicted on the basis of mutagenesis studies: mutation of the corresponding cysteines in Kir2.1 led to the absence of currents even though expressed protein was detectable by Western Blot analysis (43, 44).
- Application of 10 mM DTT or reduced glutathione to the outside of cells expressing the wild-type channels did not affect currents.
- the pore region is further stapled together by an ionized hydrogen bond between R149 in the filter sequence TXGYGFR and E139 ( FIGS. 2B and 2C ).
- the Glu O- ⁇ to Arg distance is 2.4 ⁇ , compatible with an energetically strong interaction. Mutations altering this interaction are known to alter channel function (45, 46).
- the salt bridge was thought to be inter-subunit, but the crystal structure shows that this interaction ties together two segments of the pore-region within a single subunit (46).
- the main-chain structure of the filter in Kir2.2 is the same as in other K + channels (47).
- the main chain RMSD between Kv1.2 and Kir2.2 is 0.4 ⁇ , which is within the margin of certainty to discriminate atomic positions with 3.1 ⁇ diffraction data ( FIGS. 2D and 2E ) (20, 48, 49).
- One structural difference near the filter could possibly account for important pharmacological differences between Kir and other K + channels.
- the Asp (D) residue in the filter sequence is buried, creating a flat surface surrounding the filter opening.
- the Phe (F) residue at the corresponding position projects directly into aqueous solution, creating four protrusions on the perimeter where the filter opens to the extracellular solution.
- the pore lining on the intracellular side of the selectivity filter is mainly hydrophobic in nearly all K + channels.
- Eukaryotic Kir channels are an exception in which the central region of the pore—known as the central cavity—contains four polar amino acids (one from each subunit) projecting toward the ion pathway ( FIG. 3A ).
- these polar amino acids are Asp (D173), whereas in weak rectifiers such as Kir1.1 and Kir6.1 they are Asn ( FIG. 1A-1C ).
- Asp residues in the central cavity of strong rectifiers are hypothesized to influence the affinity of Mg 2+ and polyamines by an electrostatic mechanism (12, 18).
- FIG. 3E shows the cytoplasmic domain tetramer from the Kir2.2 channel superimposed onto the domain from Kir2.1, which was solved by crystallography in the absence of a transmembrane channel (11). Over most of the domain these structures are nearly identical. This observation supports the expectation (based on 80% sequence identity) that Kir2.2 should represent an excellent model for the complete Kir2.1 channel.
- Kir channels have been proposed to have a second gate (G-loop) at the apex of the cytoplasmic domain tetramer (11, 51). The G-loop is physically open in Kir2.2 and closed in the Kir2.1 domain ( FIGS. 3F and 3G ).
- FIG. 4A-F shows the locations of ions in difference Fourier maps from crystals containing Rb + , Sr 2+ , and Eu 3+ .
- Rb + is a K + analog that conducts. Density for this ion is observed at multiple sites in the selectivity filter and at three positions within the pore on the intracellular side of the selectivity filter, but is absent in the central cavity ( FIG. 4A ). The three occupied intracellular positions are: immediately internal to the activation gate in the transmembrane pore, in the cytoplasmic pore internal to the G-loop, and at the entryway to the cytoplasmic pore. We refer to the two sites in the cytoplasmic pore as the upper and lower rings of charges, respectively ( FIG. 8 ). The presence of multiple sites along the pore occupied by conducting ions area prerequisite for strong voltage-dependent block by intracellular cations that cannot pass through the selectivity filter (12, 52-57).
- the divalent cation Sr 2+ should behave as an electron dense mimic of Mg 2+ , a biologically important metal ion inhibitor of eukaryotic Kir channels (7, 8).
- F o -F c Fourier maps from crystals with 10 mM Si 2+ , 500 mM Na + and 150 mM K + density peaks due to Sr 2+ are observed at three sites inside the pore intracellular to the selectivity filter: in the cavity, at the upper ring and at the lower ring of charges ( FIGS. 8 and 4B ).
- the magnitude of the Sr 2+ peak is small in the cavity (3.4 ⁇ ) compared to the peaks at the upper (9.6 ⁇ ) and lower (7.2 ⁇ ) rings of charges.
- FIGS. 4D-F Detailed views of these sites are shown ( FIGS. 4D-F ). They each consist of planar rings of acidic amino acids arranged on the pore's perimeter. All three sites exhibit a preference for Sr 2+ :10 mM Sr 2+ out competes 150 mM K + . This selectivity is likely to be electrostatic in origin. The sites are too wide (10.5 ⁇ , 8.9 ⁇ and 9.3 ⁇ diameter for the cavity, upper and lower ring of charges) to mediate direct coordination of an ion at the center. Presumably ions at the center of these sites interact through bridging water molecules.
- a high extracellular K + (or Rb + ) concentration should favor occupation of the sites by conducting ions, and a more depolarizing voltage should be required to drive blocking ions into the pore from the cytoplasm to replace the conducting ions.
- the displaced conducting ions must move through the selectivity filter to the extracellular side. This is to say that movements of blocking and conducting ions must be coupled. Such coupling would have energetic consequences because movement of an ion across the membrane voltage difference constitutes work. In other words a blocking ion entering the pore will exhibit a voltage dependence that results from a combination of its own charge and the charge of the displaced ions.
- This can be the origin of strong voltage dependent block, which can be the origin of a biologically important property of strong rectifiers—their diode property of a sharp transition from a conductive to a non-conductive state as a function of membrane voltage (12, 52-55, 64).
- Two aspects of the structure may account for the fact that eukaryotic Kir channels, especially members of the Kir2 subfamily, are relatively insensitive to K + channel toxins (22-24).
- the turrets in Kir2.2 are larger and come closer together, constricting the pore entryway compared to Kv1.2; and F148 in the sequence TXGYGFR creates four protrusions on the surface at the pore opening ( FIGS. 5A and 5B ).
- the entryway is wider and the pore opens onto intersecting grooves with a flat base, which form the docking surface for pore-blocking scorpion toxins ( FIG. 5B ).
- the entryway is constricted and the grooves are absent ( FIG. 5A ).
- Kir1.1 and Kir3.4 channels have been identified.
- a bee venom toxin, tertiapin inhibits both of these channels (22).
- tertiapin is smaller than most other venom toxins so it might fit between the turrets more effectively, Alternatively, the turrets themselves might form the binding site for tertiapin (67-69).
- ⁇ -dendrotoxin from the green mamba snake is rather large and yet it inhibits Kir1.1 channels (23).
- ⁇ -dendrotoxin Compared to tertiapin less is known about the binding site on the channel for ⁇ -dendrotoxin, but one aspect of its inhibition is intriguing: the blocked state reduces single channel conductance to about 10% rather than inhibiting all the way. ⁇ -dendrotoxin most likely binds to the turrets but is too large to fit tightly over the pore, which would imply that binding to the turret may be sufficient to alter the channel's function.
- the turrets are structurally important elements of the channel. Between the sequence HGDL and the first Cys of the disulfide bridge the turret sequence is highly variable among Kir channel subtypes.
- the Kir2.1 channel becomes sensitive to tertiapin if the variable sequence is mutated to be Kir3.4-like (68). Therefore, the turrets appear to be structures through which specific inhibition of Kir channel subtypes might be achievable through directed evolution of specific protein binding partners.
- a synthetic gene fragment (Bio Basic, Inc) encoding residues 38 to 369 of chicken Kir2.2 channel (GI:118097849) was ligated into the XhoI/EcoRI cloning sites of a modified pPICZ-B vector (Invitrogen).
- the resulting protein has green fluorescent protein (GFP) and a 1D4 antibody recognition sequence (TETSQVAPA) on the C-terminus (1), separated by a PreScission protease cleavage site (SNSLEVLPQ/GP).
- the construct was linearized using PmeI and transformed into a HIS + strain of SMD1163 of Pichia pastoris (Invitrogen) by electroporation (BioRad Micropulser). Transformants were selected on YPDS plates containing 400-1200 ⁇ g/ml Zeocin (Invitrogen). Resistant colonies were tested for expression by anti-1D4 tag Western Blot. For large-scale expression, small cultures grown from the best expressing colony were diluted into BMGY media (Invitrogen) and inoculated at 29° C. overnight, until OD 600 reached between 20-30. Cells were then pelleted, resuspended in BMM media (Invitrogen) and expressed overnight at 24° C. Cells were harvested, flash-frozen in liquid N 2 , and stored at ⁇ 80° C. until needed.
- the lysis buffer contained 150 mM KCl, 50 mM TRIS-HCl pH 8.0, 0.1 mg/ml deoxyribonuclease I, 0.1 ⁇ g/ml pepstatin, 1 ⁇ l/ml leupeptin, 1 ⁇ g/ml aprotinin, 0.1 mg/ml soy trypsin inhibitor, 1 mM benzamidine, 0.1 mg/ml AEBSF, with 1 mM phenylmethysulfonyl fluoride added just before lysis (3.0 ml lysis buffer/g cells).
- pH of the lysate was adjusted to 8.0 with KOH.
- the lysate was extracted with 100 mM DM (n-decyl- ⁇ -D-maltopyranoside, Anatrace, solgrade) at room temperature for 1 hour with stirring, and then centrifuged for 40 minutes at 30,000 g, 10° C. Supernatant was added to 1D4-affinity resin pre-equilibrated with 150 mM KCl, 50 mM TRIS-HCl pH 8.0, and 4 mM DM. Suspension was layered with Argon and mixed by inversion for 2 hours at room temperature.
- Beads were collected on a column by gravity, washed with 2 column volumes of buffer (150 mM KCl, 50 mM TRIS-HCl pH 8.0, 1 mM EDTA pH 8.0, and 4 mM DM), and eluted with buffer plus 1 mg/ml 1D4 peptide (AnaSpec, Inc.) over 1 hour at room temperature. 20 mM DTT (Dithiothreitol) and 3 mM TECP were added to eluted protein. The protein was then digested with PreScission protease (20:1 w/w ratio) overnight at 4° C.
- Concentrated protein was further purified on a Superdex-200 gel filtration column in 150 mM KCl, 20 mM TRIS-HCl pH 8.0, 4 mM DM (anagrade), 3 mM TCEP, 20 mM DTT and 1 mM EDTA at 4° C.
- the fraction corresponding to the tetramer peak was concentrated to about 8 mg/ml, mixed 1:1 with crystallization solution and set up as hanging drops over reservoirs containing 0.1 ml crystallization solution. Crystals appeared in 7-20% PEG400 or 2-10% PEG4000, with 500 mM KCl or NaCl, and 50 mM buffer pH 6.0-9.5 at 4° C. overnight and grew to full size within 2-3 days.
- the protein was purified in a similar fashion except that KCl was replaced with RbCl in all buffer solutions and crystals were grown in 10-20% PEG400, 500 mM RbCl, and 50 mM MES pH 6.5.
- crystals were grown in 7-20% PEG400, 1 M ammonium formate, 50 mM TRIS-HCl pH 8.5, and 10 mM EuCl 3 .
- crystals were grown in 10-20% PEG400, 500 mM NaCl, 50 mM HEPES pH 7.5, and 10 mM SrCl 2 .
- crystals were grown in 3-7% PEG4000, 200 mM SrCl 2 , and 50 mM Na Citrate pH 5.6.
- Crystals were cryo-protected in reservoir plus 25% glycerol (v/v), 4 mM DM, 20 mM DTT, 3 mM TCEP, and 1 mM EDTA in a step-wise manner (5% glycerol increase each step) and flash-frozen in liquid nitrogen.
- Diffraction data from native crystals were collected to 3.1 ⁇ at beamline 24ID-C (APS) and for crystals in various metal ions (Rb + , Sr + , and Eu 3+ ) at beamline X29 (Brookhaven NSLS). Images were processed with DENZO and intensities merged with SCALEPACK (2). Data were further processed using the CCP4 suite (3). The crystals belong to the 14 space group.
- the structure was solved by molecular replacement using the program MOLREP (4), with the 2.4 ⁇ resolution structure of the cytoplasmic domain of mouse Kir2.1 (PDB 1U4F) as a search model. There is one copy of the subunit in the asymmetric unit.
- the final model contains residues 43-60 and 70-369 (residues 70 to 78 are modeled as alanines) of chicken Kir2.2, three additional residues SNS on the C-terminus corresponding to the PreScission cleavage site, and five K + ions.
- Ion binding was assessed by calculating anomalous difference Fourier maps for data with Eu 3+ and F o -F c maps for data with Rb + and Sr 2+ using fft in the CCP4 suite (3), Sr 2+ was analyzed at two different concentrations to discern whether the weak cavity peak was due to Sr 2+ . This peak became stronger when Sr 2+ was increased from 10 mM to 200 mM while the monovalent cation concentration was decreased, consistent with Sr 2+ being present in the cavity but probably at low occupancy. Phases used to calculate F o -F c omit maps were derived from a channel model devoid of ions in the cavity or cytoplasmic domain throughout refinement,
- Xenopus oocytes were harvested from mature female Xenopus laevis and defolliculated by collagenase treatment for 1-2 hours. Oocytes were then rinsed thoroughly and stored in ND96 solution (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl 2 , 1.0 mM MgCl 2 , 5 mM HEPES, 50 ⁇ g/ml gentamycin, pH 7.6 with NaOH). Defolliculated oocytes were selected 2-4 hours after collagenase treatment and injected with cRNA the next day. The injected oocytes were incubated in ND96 solution for 1-5 days before recording. All oocytes were stored in an incubator at 18° C.
- the chicken Kir2.2 (residues 38 to 369) gene was sub-cloned into the pGEM vector (Promega).
- cRNA was prepared using T7 RNA polymerase (Promega) from NdeI-linearized plasmid DNA.
- oocytes were held at 0 mV and pulsed from ⁇ 80 mV to +80 mV with 10 mV increment steps.
- Recording solution contained 98 mM KCl, 0.3 mM CaCl 2 , 1 mM MgCl 2 , and 5 mM HEPES pH 7.6.
- the ionic currents were recorded with an oocyte clamp amplifier (OC-725C, Warner Instrument Corp.).
- the recorded signal was filtered at 1 kHz and sampled at 10 kHz using an analogue-to-digital converter (Digidata 1440A, Axon Instruments, Inc) interfaced with a computer.
- pClamp10.1 software (Axon Instruments, Inc) was used for controlling the amplifier and data acquisition.
- each oocyte was incubated in a hypertonic solution containing 200 mM NaCl, 130 mM KCl, 5 mM K 2 EDTA, 5 mM K 2 HPO 4 , 5 mM KH 2 PO 4 pH 7.2 for 5-10 minutes and the vitelline membrane was removed before seal formation.
- Currents were recorded in either cell-attached or inside-out configuration with an Axopatch 200B amplifier, Digidata 1440A analogue-to-digital converter and pClamp10.1 software to control membrane voltage and record.
- the membrane was first held at 0 mV followed by a 10-second voltage ramp from +80 mV to ⁇ 80 mV .
- the pipette solution contained 140 mM KCl, 5 mM K 2 HPO 4 , 5 mM KH 2 PO 4 , 0.3 mM CaCl 2 , 1 mM MgCl 2 , pH 7.2 with KOH.
- the bath solution contained 130 mM KCl, 5 mM K 2 EDTA, 5 mM K 2 HPO 4 , 5 mM KH 2 PO 4 , pH 7.2 with KOH.
- each data point represents the current difference at a given voltage associated with the opening of a single channel.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Peptides Or Proteins (AREA)
Abstract
Methods for identifying compounds that modulate the ion channel activity of a Kir channel are provided. Methods for identifying compounds that selectively modulate the ion channel activity of specific types of Kir channels based on the turret region of a Kir channel are also provided. Methods for identifying compounds to treat conditions associated with abnormal ion channel activity are also provided. Compounds including purified antibodies and methods of making antibodies which bind to the turret region of a Kir channel are provided. Purified polypeptides including at least a portion of the turret region of a Kir channel and nucleic acid sequences encoding these polypeptides are also provided.
Description
- The present invention relates to Kir channel proteins and methods for identifying compounds that modulate ion channel activity by Kir channels. In particular, the present invention relates to identifying compounds which are useful for treating diseases related to the function of Kir channel proteins.
- Inward rectifier K+ charnels (Kir channel proteins) are involved in the control of many physiological processes that are important to human health. Kir channel proteins normally function as K+ (potassium) selective pores that span cell membranes. The Kir channels are referred to as inward rectifier K+ (Kir) channels based on a fundamental ion conduction property of these channels: given an equal but opposite electrochemical driving force K+ conductance into the cell far exceeds conductance out of the cell.
- Among their many functions Kir channel proteins control the pace of the heart, regulate secretion of hormones into the blood stream, generate electrical impulses underlying information transfer in the nervous system and control airway and vascular smooth muscle tone. It is believed that various disease states are directly related to the function of Kir channel proteins. Members of this channel family include Kir1-Kir7, (Kubo et al., Pharmacological Rev., 57:509-526, 2005) Hypertension, atrial fibrillation, and type 2 diabetes are related to Kir channel protein function and are serious conditions for which new therapies are needed. Specific links between Kir channel proteins and disease have been found. Kir1.1 channels are present in the kidney and regulate salt secretion into the urine. Heritable mutations involving Kir1.1 cause Barter's syndrome and hypotension. Compounds which selectively inhibit Kir1.1 have the potential to serve as a new form of anti-hypertensive agent in which hypokalemia, a major side-effect of currently used diuretics, should in principle not be a problem. Thus, hypertensive individuals could benefit from Kir1.1 inhibitor-based therapies. Kir3.1 and Kir3.4 channels, which assemble to form a heteromultimer, are called G-protein-gated K+ channels (GIRK). These channels control heart rate through stimulation by the parasympathetic nervous system. GIRK channel knock-out mice do not develop atrial fibrillation under any of the usual stimuli that induce this arrhythmia in mice. (Claphan et al., JACC 37, 2136-2143 (Jun. 15, 2001)) Accordingly, inhibition of GIRK channels in humans might provide effective treatment for atrial fibrillation. Kir6 channels are expressed in beta cells of the pancreas and control insulin secretion. With the identification of compounds that selectively inhibit the Kir6 channel new therapies could be realized for the treatment of type 2 diabetes. Accordingly, Kir channel proteins are good targets for the treatment of various diseases.
- The Kir channel family of proteins are very similar to each other in both sequence and, by inference, structure; thus, it has been very difficult to identify compounds that can specifically modulate one kind of Kir channel protein without cross-reacting with other types of Kir channel proteins.
- For the first time the structure of a eukaryotic Kir channel has been determined, and a structural feature “the turret region” has been identified that is highly ordered in structure and, based on the amino acid sequences will differ among Kir channels. Prior to this structure, only the structure of a prokaryotic Kir channel had been determined. (Nishida et al., EMBO, vol. 26, pp. 4005-4015 (2007)) The turret is an important functional region of the protein and faces the outside of the cell making this region an attractive target for identifying potential therapeutic compounds. Given the identification of the turret region in the various Kir channel proteins and the structure in a prototype, the present invention provides a variety of methods by which the turret region may be used to identify compounds having therapeutic utility for treating the various diseases related to the function of Kir channels.
- The present invention provides for the first time the expression and purification of a eukaryotic Kir channel as explained in detail below. Study of the structure of this eukaryotic Kir channel resulted in a realization of the importance of the turret region and the invention of methods which allow identification of therapeutic compounds that can selectively bind to different members of the Kir channel family of proteins.
- The present invention relates to methods for identifying a compound that modulates ion channel activity of a Kir channel including identifying a compound which binds the turret region of a Kir channel; and determining if the compound modulates ion channel activity of the Kir channel.
- In particular embodiments, the method may be used to identify an antibody that binds the turret region of a Kir channel and modulates the Kir channel's activity. The antibody may be human, chimeric or humanized. The antibody may also be a polyclonal antibody, monoclonal antibody, an intact immunoglobulin molecule, an antibody fragment, a scFv, a Fab, a F(ab)2, a Fv, or a disulfide linked Fv.
- In another embodiment, the method may be used to identify suitable nucleic acid molecules that can modulate a Kir channel's activity by binding to its turret region. In such an embodiment, the nucleic acid may be a DNA or RNA molecule. In certain embodiments the nucleic acid is an aptamer. The method may also include identifying a suitable nucleic acid by using in vitro selection techniques.
- In another embodiment, the method is used to identify a protein or peptide that can bind a turret region of a Kir channel and modulate the Kir channel. In this embodiment, the protein/peptide may be attached to a protein scaffold or displayed on the surface of a phage.
- In another embodiment, the method discussed above is used to screen for small molecules that can modulate Kir channel activity by binding to the Kir channel's turret region.
- In any of the methods discussed above, the Kir channel may be a human Kir channel or a chicken/human hybrid Kir channel. Typically, the chicken/human hybrid Kir channel will comprise a human Kir channel turret region.
- Various standard biochemical assays may be used to identify whether a compound binds to the turret region of a Kir channel in the method of the present invention. For example, the identifying step may comprise an ELISA and a Western blot to determine if the compound binds to a properly folded Kir channel but not to a denatured Kir channel. Moreover, the identifying step may comprise determining if the compound binds to a Kir channel with a normal turret region but not a mutated turret region.
- Regarding the determining whether a compound modulates the activity of a Kir channel, various electrophysiological assays may be used such as two-electrode voltage clamp, patch clamp, and planar lipid bilayer assays. Alternatively or additionally, the determining step may include a fluorescent assay such as one utilizing a thallium specific fluorescent dye.
- In another aspect, the present invention relates to a method for identifying a compound that selectively modulates ion channel activity of a specific type of Kir channel including identifying a compound which binds the turret region of a specific type of Kir channel but does not bind to other types of Kir channels; and determining if the compound modulates the activity of the Kir channel.
- In another embodiment, the present invention relates to a method of identifying a compound to treat a condition associated with abnormal ion channel activity by a Kir channel including identifying a compound which binds the turret region of a Kir channel; determining if the compound modulates ion channel activity of the Kir channel; and administering the compound which modulates ion channel activity to a subject to determine if the compound is able to treat the condition. In such a method, the condition may be diabetes mellitus, hypertension, cardiac arrhythmia, or epilepsy.
- In another aspect, the present invention relates to a purified antibody that specifically binds to an epitope in the turret region of a Kir channel. In this embodiment, the purified antibody may be a polyclonal antibody, a monoclonal antibody, an intact immunoglobulin molecule, an antibody fragment, a scFv, a Fab, a F(ab)2, a Fv, or a disulfide linked Fv. The antibody may specifically bind to a human Kir channel such as a Kir1, Kir2, Kir3, Kir4, Kir5, Kir6, or Kir7 channel. The antibody preferably binds to an epitope within the turret region of a human Kir channel such as Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2 channel. Even more preferably, the antibody binds to the variable portion of the turret region of a human Kir channel.
- In another embodiment, the present invention relates to a method of making an antibody that specifically binds to an epitope in the turret region of a human Kir channel, including providing a chicken/human hybrid Kir channel, wherein the chicken/human hybrid comprises a human Kir channel turret region; immunizing a non-human animal with the chicken/human hybrid Kir channel; and determining whether the antibody is binding to the human Kir channel turret region. In this embodiment, the chicken portion of the chicken/human hybrid Kir channel may be derived from a chicken Kir2.2 channel. Moreover, in this embodiment, the human Kir channel turret region may be derived from Kir1, Kir2, Kir3, Kir4, Kir5, Kir6, or Kir7. Preferably, the human Kir channel turret region is derived from a human Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2 channel.
- In another embodiment, the present invention relates to a method of making an antibody that specifically binds to an epitope in the turret region of a human Kir channel, including providing a human Kir channel; immunizing a non-human animal with the Kir channel; and determining whether the antibody is binding to the human Kir channel turret region.,
- In another embodiment, the present invention relates to a purified polypeptide that consists of the turret region of human Kir channels such as Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2. In another aspect, the present invention relates to an isolated nucleic acid comprising a nucleotide sequence that encodes a polypeptide that consists of the turret region of human Kir channels such as Kir1.1, Kir1.2, Kir2.1, Kir2.2, Kir2.3, Kir2.4, Kir3.1, Kir3.4, Kir4.1, Kir4.2, Kir5.1, Kir6.1, or Kir6.2.
-
FIG. 1A-1C shows key residues in eukaryotic Kir channels. A sequence alignment of chicken Kir2.2 (GI: 118097849), human Kir2.2 (GI:23110982), human Kir2.1 (GI:8132301), human Kir1.1 (GI:1352479), human Kir3.1 (GI:1352482), human Kir3.4 (GI:1352484), human Kir6.1 (GI:2493600), human Kir7.1 (GI:3150184), KirBac1.1 (GI:33357898), KcsA (GI:39654804), and rat Kv1.2 (G1:73536156) is shown. For all the Kir sequences only the core region corresponding to the expressed protein and atomic structure of Kir2.2 is included in the alignment. For Kv1.2 only the transmembrane pore region is shown. Secondary structure elements are indicated above the sequences and the turret is shown in small dotted lines above the sequence. Residues discussed in the text are boxed in a series of alternating dashes and dots (acidic residues), a series of large dots (two disulfide-bonded cysteines), alternating dashes and pairs of dots (the inner helix bundle activation gate), series of small dashes (conserved residues among the turrets of eukaryotic Kir channels), a series of small dots (the selectivity filter and E139), and a series of large dashes (critical residues for channel-PIP2 interactions). -
FIG. 2A-2E illustrates a structure of Kir2.2. (FIG. 2A ) Stereoview of a ribbon representation of the Kir2.2 tetramer from the side with the extracellular solution above. Four subunits of the channel are shown. Approximate boundaries of the lipid bilayer are shown as bars. (FIG. 2B ) A close-up view of the pore-region of a single subunit (in ribbon representation) with the turret, pore helix and selectivity filter labeled. Side chains of residues E139, R149 and a pair of disulfide-bonded cysteines (C123 and C155) are shown as sticks. Ionized hydrogen-bonds are indicated by dashed black lines. The region flanked by the two disulfide-bonded cysteines is stippled. (FIG. 2C ) Electron density (wire mesh, 2Fo-Fc, calculated from 50-3.1 Å using phases from the final model and contoured at 1.0σ) is shown for the side chains of E139 and R149 forming a salt-bridge. (FIG. 2D ) (FIG. 2E ) K+ selectivity filter of the Kir2.2 channel (FIG. 2 D) compared with that of the Kv1.2-Kv2.1 paddle chimera channel (FIG. 2E , PDB ID 2R9R). For clarity, only two of the four subunits are shown. K+(cross hatched circles), water molecules (solid spheres), and hydrogen bonds between R149 and E139 (Kir, dashed black lines), or between D379, M380 and waters (Kv, dashed black lines) are shown, -
FIG. 3A-3G illustrates the cavity and gates region of a Kir channel. (FIG. 3A ) (FIG. 3B ) Electron density in the cavity of the Kir2.2 channel (A, Fo-Fc omit map, calculated from 50-3.1 Å using phases from the final model and contoured at 2.0σ) and of the KcsA channel (FIG. 3B , PDB ID 1K4C, Fo-Fc omit map, calculated from 50-3.1 Å using phases from the final model and contoured at 2.8σ). The channels are shown as ribbon representations with the subunit closest to the viewer removed. Only the side chains facing the cavity are shown (sticks). (FIG. 3C ) (FIG. 3D ) Comparison of the transmembrane inner helix bundle activation gate of Kir2.2 (FIG. 3C ) with the KcsA structure (FIG. 3D , PDB ID 1K4C). For clarity, only two of the four subunits (ribbon) are shown. Side chains of the residues in the bundle crossing are shown as sticks and van der Waals surfaces. K+ ions are shown as cross hatched spheres. Inner and Outer helices are indicated. (FIG. 3E ) Superposition of the chicken Kir2.2 cytoplasmic domain (α-carbon trace) and the mouse Kir2.1 cytoplasmic domain (α-carbon trace, PDB ID 1U4F) in stereo viewed from the extracellular side. (FIG. 3F ) (FIG. 30 ) Comparison of the apex (G-loop) of the cytoplasmic pores of Kir2.2 (FIG. 3F ) and mouse Kir2.1 (FIG. 3G ), with the same view as FIG. 3E. The cytoplasmic domains are shown as α-carbon traces, with residues 303-309 (Kir2.2) and 302-308 (Kir2.1) shown as CPK models. -
FIG. 4A-4F illustration of ion binding sites. (FIG. 4A ) (FIG. 4B ) (FIG. 4C ) Electron density (wire mesh) of Rb+ (FIG. 4A , Fo-Fc map calculated to 4.0 Å, contoured at 3.5σ for density in the filter and 2.0σ for density elsewhere), Sr2+ (FIG. 4B , 10 mM, Fo-Fc map calculated to 3.3 Å, contoured at 1.5σ for density in the cavity and 3.0σ for density elsewhere) and Eu3+ (FIG. 4C , 10 mM, anomalous difference map calculated to 6.0 Å, contoured at 2.8σ) inside the Kir2.2 channel ion conduction pathway. Kir2.2 is represented as a α-carbon trace with the transmembrane domain and cytoplasmic domain closest to viewer removed for clarity. The ions are shown as spheres. (FIG. 4D ) Electron density (200 mM Sr2+, Fo-Fc map calculated from 50-3.8 Å, contoured at 2.5σ, wire mesh) of Sr2+ (spheres) in the cavity of Kir2.2. The channel is shown as a ribbon with the subunit closest to the viewer removed. Only the side chains facing the cavity are shown (sticks). (FIG. 4E ) Stereoview of the ion binding site near the upper ring of charges in the cytoplasmic domain of Kir2.2, viewed from the extracellular side. Residues E225, H227, E300, and Q311 are shown as sticks, and hydrogen bonds between them are indicated as dashed black lines. Electron density (200 mM Sr2+, Fo-Fc map calculated from 50-3.8 Å, contoured at 4.5σ) of Sr2+ (spheres) is shown as wire mesh. (FIG. 4F ) Stereoview of the ion binding site at the lower ring of charges in the cytoplasmic domain of Kir2.2, viewed from the intracellular side. Residues F255, D256, and K257 are shown as sticks, and hydrogen bonds between D256 from different subunits are indicated as dashed black lines. Electron density (200 mM Sr2+, Fo-Fc map calculated from 50-3.8 Å, contoured at 4.5 a) of Sr2+ (spheres) is shown as wire mesh. -
FIG. 5A-5D illustrates the unique structure of the extracellular entryway. (FIG. 5A ) (FIG. 5B ) Surface representation of chicken Kir2.2 (FIG. 5A ) and Kv1.2-Kv2.1 paddle chimera (FIG. 5B , PDB ID 2R9R) in stereo, viewed from the extracellular side. The four protrusions formed by the top of the turrets are highlighted with a black perimeter and F148 in Kir2.2 is labeled. (FIG. 5C ) Stereo representation of electron density (wire mesh) for the turret region (2Fo-Fc, calculated from 50-3.1 Å using phases from the final model and contoured at 1.0σ). The turret is shown as sticks (colored according to atom types), and residues corresponding to the highlighted protrusions in panel A are labeled. (FIG. 5D ) A close-up view of the turret region in a single subunit in stereo. Side chains of those conserved residues among the turrets of eukaryotic Kir channels, as well as C155 are shown as sticks. Hydrogen bonds between H108, D110 and C123 are indicated as dashed black lines. -
FIG. 6A-6D results showing the chicken Kir2.2 channel is a strong inward rectifier. (FIG. 6A ) (FIG. 6B ) Macroscopic currents are shown from an uninjected oocyte (FIG. 6A ) and a chicken Kir2.2 channel injected oocyte (FIG. 6B ) without subtracting leak and capacitive currents. The currents were recorded from oocytes using two-electrode voltage-clamp. Voltage pulses: holding potential (h.p.) 0 mV, depolarizing steps: −80 mV to +80 mV, ΔV=10 mV, stepping back to 0 mV. (FIG. 6C ) Macroscopic currents recorded from oocytes using patch-clamp. The three current traces show a current trace recorded on-cell (labeled B), a trace recorded immediately after excision of the inside-out patch (labeled C), and a trace recorded approximately 10 minutes after the excision (labeled A) Voltage pulses: ramp from −80 mV to =80 mV over 10 seconds duration, (FIG. 6D ) I-V curve from a patch containing only a few channels. The single channel current is graphed as a function of voltage (inset). -
FIG. 7 provides a surface representation of Kir2.2, viewed from the side with the extracellular side above. The surface is shaded for qualitative assessment of the negative and positive electrostatic potential at the surface. -
FIG. 8 illustrates ion binding sites of Kir2.2 in the selectivity filter, central cavity, upper and lower rings of charges are shown as sticks (oxygens and stippled). The channel is represented as a a-carbon trace with the transmembrane domain and cytoplasmic domain closest to viewer removed for clarity. - The present invention is based in part on the discovery of an important structural feature present in Kir channel proteins. in particular, the present invention relates to the discovery of a “turret region” which is highly ordered in structure and which differs in sequence among different Kir channel proteins. In addition, this turret region faces the outside of the cell making the protein accessible to compounds that bind or otherwise interact with this turret region thereby affecting the ability of the Kir channel to function. The discovery of the fact that this turret region, which differs in sequence among members of the Kir channel family, is structured provides a basis to identify compounds which can treat disease states related to Kir channel functions.
- Example 1 provided below presents a determination of the crystal structure of a eukaryotic Kir channel protein. In particular, the crystal structure of the chicken Kir channel protein, Kir2.2 is presented. Excluding unstructured amino and carboxy termini, the chicken Kir2.2 protein is 90% identical to human Kir2.2. More importantly, for the purposes of the present invention, these structural studies demonstrate that Kir channels have a large structured turret region which provide the basis for the development of compounds that may be used to bind and interact with these turrets and treat disease states related to the functioning of Kir channels. In particular, these turret regions suggest approaches to the development of inhibitory compounds which will bind to a specific member of the Kir channel family of proteins and inhibit Kir channel function.
- The turret region of a variety of Kir channel proteins are identified in
FIGS. 1A-1C and in the sequence listings of the present application. In particular,FIGS. 1A-1C illustrates that a sequence alignment of various human Kir channels indicates that the turret region begins with a consensus sequence HGDL (or minor sequence variations thereof) and extends six amino acid residues after a highly conserved cysteine residue labeled as C123 inFIGS. 1A-1C . This turret region is highly conserved and most of the variation that occurs in the sequence is located in a variable portion located after the sequence HGDL up to the cysteine labeled as C123. This variable portion within the turret region constitutes a basis for differentiating Kir channels from one another and provides a target for mutagenesis assays to identify compounds capable of turret specific binding. - Given the identification of the structured turret region in the crystal structure, the turret region of other Kir channels may be identified using sequence alignment programs and the teachings of the present invention relating to the consensus sequence and structural features of the Kir channels.
- Based on this structural information, methods are presented below in which the identification of the turret region and knowledge of the amino acid sequence of the turret may be used to develop assays to identify therapeutic compounds which include, but are not limited to, antibodies, nucleic acids, peptides and small molecules that are capable of selective binding to Kir channel proteins.
- In general the methods of the present invention for identifying a compound that modulates ion channel activity of a Kir channel comprises a two step process: a first step of identifying a compound which binds the turret region of a Kir channel; and a second step of determining if the compound modulates the ion channel activity of the Kir channel.
- Production of Antibodies
- In a first method for identifying compounds that modulate the ion channel activity of a Kir Channel, antibodies are prepared against a Kir channel. A variety of Kir channels are known and the methods described below may be used to prepare antibodies against any Kir channel.
- Given the present discovery of the importance of the turret region in distinguishing one Kir channel from another, it is particularly useful to obtain antibodies which bind the turret region,
- The Antigens and Assay Reagents
- Two types of Kir channel proteins may be of particular utility in preparing antibodies. The first type are human Kir channel proteins. The second type are chimeric constructs which utilize a non-human sequence, preferably a eukaryotic sequence, such as a chicken sequence, in particular a chicken Kir 2.2 sequence into which a human Kir channel turret region has been inserted, thereby replacing the native turret region. As an example, chimeric proteins which utilize a chicken Kir2.2 “scaffold” into which the turret region from a given human Kir channel is inserted may be used to prepare antibodies which are specific for different human Kir channel proteins. Both human and chimeric Kir channels may be full length proteins or may contain deletions at the amino and/or carboxy termini of the protein if desired.
- Conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art may be used in order to prepare human and chimeric Kir channel proteins. Such techniques are explained fully in the literature. See, e.g., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (herein “Sambrook et al., 1989”); DNA Cloning: A Practical Approach, Volumes I and II (D. N. Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed. 1984); Nucleic Acid Hybridization [B. D. Hames & S. J. Higgins eds. (1985)]; Transcription And Translation [B. D. Hames & S. J. Higgins, eds. (1984)]; Animal Cell Culture [R. I. Freshney, ed. (1986)]; Immobilized Cells And Enzymes [IRL Press, (1986)]; B. Perbal, A Practical Guide To Molecular Cloning (1984); F. M. Ausubel et al, (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (1994); Molecular Cloning: A Laboratory Manual Third Edition [Joseph Sambrook and David W, Russell Cold Spring Harbor Laboratory Press (2001)]; The Condensed Protocols from Molecular Cloning: A Laboratory Manual [Joseph Sambrook and David W. Russell, Cold Spring Harbor Laboratory Press (2006)]; Gene Cloning and Manipulation Second Edition [Christopher Howe, Cambridge University Press (2007)].
- The cDNA sequences for exemplary human Kir channels are presented in SEQ ID NOS 30-43. The cDNA sequence of the chicken Kir2.2 channel is presented in SEQ ID NO: 45. DNA and cDNA sequences for other types of Kir channels are available in public databases, The turret regions of exemplary human Kir proteins are identified in SEQ ID NOs: 46-56.
- Expression of Chicken Kir 2.2
- As an example of expression and purification of a eukaryotic Kir channel a protocol for preparing a chicken Kir 2.2 channel protein is provided below. Using standard techniques this procedure may be modified to prepare any of the human Kir channel proteins or a desired chimeric Kir channel protein.
- To prepare the chicken Kir 2.2 channel, a synthetic gene fragment (Bio Basic, Inc.) encoding residues 38 to 369 of chicken Kir2.2 channel (GI:118097849) was ligated into the XhoI/EcoRI cloning sites of a modified pPICZ-B vector (Invitrogen). The resulting protein has green fluorescent protein (GFP) and a 1D4 antibody recognition sequence (TETSQVAPA) on the C terminus (I), separated by a PreScission protease cleavage site (SNSLEVLFQ/GP).
- The construct was linearized using PmeI and transformed into a HIS+ strain of SMD1163 of Pichia pastoris (Invitrogen) by electroporation (BioRad Micropulser). Transformants were selected on YPDS plates containing 400-1200 μ/ml Zeocin (Invitrogen). Resistant colonies were tested for expression by anti-1D4 tag Western Blot. For large-scale expression, small cultures grown from the best expressing colony were diluted into BMGY media (Invitrogen) and inoculated at 29° C. overnight, until OD600 reached between 20-30. Cells were then pelleted, resuspended in BMM media (Invitrogen) and expressed overnight at 24° C. Cells were harvested, flash-frozen in liquid N2, and stored at −80° C. until needed.
- Cells were lysed in a Retsch, Inc. Model MM301 mixer mill (5×3.0 minutes at 25 cps). The lysis buffer contained 150 mM KCl, 50 mM TRIS-HCl pH 8.0, 0.1 mg/ml deoxyribonuclease I, 0.1 μg/ml pepstatin, 1 μg/ml leupeptin, 1 μg/ml aprotinin, 0.1 mg/ml soy trypsin inhibitor, 1 mM benzamidine, 0.1 mg/ml AEBSF, with 1 mM phenylmethysulfonyl fluoride added just before lysis (3.0 ml lysis buffer/g cells). pH of the lysate was adjusted to 8.0 with KOH. The lysate was extracted with 100 mM DM (n2 decyl-β-D-maltopyranoside, Anatrace, solgrade) at room temperature for 1 hour with stirring, and then centrifuged for 40 minutes at 30,000 g, 10° C. Supernatant was added to 1D4-affinity resin pre-equilibrated with 150 mM KCl, 50 mM TRIS-HCl pH 8.0, and 4 mM DM. Suspension was layered with Argon and mixed by inversion for 2 hours at room temperature. Beads were collected on a column by gravity, washed with 2 column volumes of buffer (150 mM KCl, 50 mM TRIS-HCl pH 8.0, 1 mM EDTA pH 8.0, and 4 mM DM), and eluted with buffer plus 1 mg/ml 1D4 peptide (AnaSpec, Inc.) over 1 hour at room temperature. 20 mM DTT (Dithiothreitol) and 3 mM TECP were added to eluted protein. The protein was then digested with PreScission protease (20:1 w/w ratio) overnight at 4° C. Concentrated protein was further purified on a Superdex-200 gel filtration column in 150 mM KCl, 20 mM TRIS-HCl pH 8.0, 4 mM DM (anagrade), 3 mM TCEP, 20 mM DTT and 1 mM EDTA at 4° C. In a preferred embodiment, the protein extract is maintained in a mild detergent, such as DM, which will maintain the three-dimensional structure of the Kir channel.
- Preparation of Human/Chicken Hybrid Kir Channels
- Using standard techniques in molecular biology, chimeric Kir channel protein may be prepared by inserting the turret region of a human Kir channel protein into the Kir2.2 chicken sequence described above. The location of the turret regions are identified in
FIGS. 1A-1C . - By way of example, site-directed mutagenesis procedures may be used to insert the coding sequence for a human turret region into a eukaryotic “scaffold” Kir channel coding region. In a preferred embodiment, Strategene's QuickChange® is used. QuickChange® utilizes a supercoiled double-stranded DNA (dsDNA) vector with an insert of interest and two synthetic oligonucleotide primers containing the desired mutation. The oligonucleotide primers, each complementary to opposite strands of the vector, are extended during temperature cycling by PfuTurbo DNA polymerase. The desired mutation (in this case—the insertion of the human turret region) should be in the middle of the primer with about 10-15 bases of correct sequence on both sides. Incorporation of the oligonucleotide primers generates a mutated plasmid containing staggered nicks. Following temperature cycling, the product is treated with Dpn I. The Dpn I endonuclease (target sequence: 5′-Gm6ATC-3′) is specific for methylated and hemimethylated DNA and is used to digest the parental DNA template and to select for mutation-containing synthesized DNA. DNA isolated from almost all E. coli strains is Dam methylated and therefore susceptible to Dpn I digestion. The nicked vector DNA containing the desired mutations is then transformed into XL1-Blue supercompetent cells. See, e.g. U.S. Pat. Nos. 5,789,166, 5,932,419, and 6,391,548.
- As an example, the chicken Kir2.2 protein may be used as a scaffold and the human Kir2.2 channel turret region synthesized for insertion. This methodology can be repeated with any combination of scaffold protein and human turret region.
- Preparation of Mutated Turret Regions
- Given the identification of the turret regions in the human Kir channels site directed mutagenesis or other techniques known in the art may be used to prepare proteins having mutations in the DNA sequence of the turret. In a preferred embodiment, Strategene's QuickChange® is used. Such mutations should be non-silent mutations—that is the mutations should result in amino acid changes at positions within the turret region.
- Generation of Antibodies
- A human Kir protein or a chimeric Kir channel protein is prepared using standard techniques such as those outlined herein, and used in standard techniques to obtain antibodies.
- A variety of antibodies may be used in the present invention and such antibodies include but are not limited to polyclonal, monoclonal, human, humanized chimeric, an intact immunoglobulin molecule, an antibody fragment, single chain, ScFv, Fab fragments, F(ab)2 Fab, Fv and a disulfide linked Fv.
- Various procedures known in the art may be used for the production of antibodies. Host animals can be immunized by injection with a human Kir channel protein, or chimeric Kir protein or fragments of these proteins. Animals which may be used to generate antibodies include, but are not limited to, rabbits, mice, rats, sheep, goats, and others known in the art. The human and chimeric proteins of the present invention may also be conjugated to an immunogenic carrier, e.g., bovine serum albumin (BSA) or keyhole limpet hemocyanin (KLH). Various adjuvants may be used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hernocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (Bacille Calmette-Guerin) and Corynebacterium parvum.
- For preparation of monoclonal antibodies directed toward a Kir channel protein of the present invention, any technique that provides for the production of antibody molecules by continuous cell lines in culture may be used, These include but are not limited to the hybridoma technique originally developed by Kohler and Milstein [Nature 256:495-497 (1975)], as well as the trioma technique, the human B-cell hybridoma technique [Kozbor et al., Immunology Today 4:72 1983); Cote et al., Proc. Nail. Acad. Sci. U.S.A. 80:2026-2030 (1983)], and the EBV-hybridoma technique to produce human monoclonal antibodies [Cole et al., in Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96 (1985)]. In addition, techniques developed for the production of “chimeric antibodies” [Morrison et al., J. Bacterial. 159:870 (1984); Neuberger et al., Nature 312:604-608 (1984); Takeda et al., Nature 314:452-454 (1985)] by splicing the genes from a mouse antibody molecule specific for an isolated Kir channel protein of the present invention, or conserved variants thereof, together with a fragment of a human antibody molecule of appropriate biological activity can be used.
- Human antibodies can be prepared using any technique. Examples of techniques for human monoclonal antibody production include those described by Cole et al, (Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77, 1985) and by Boemer et al, (J. Immunol., 147(1):86-95, 1991). Human antibodies (and fragments thereof) can also be produced using phage display libraries (Hoogenboom et al., J. Mol. Biol., 227:331, 1991; Marks et al., J. Mol, Biol., 222:581, 1991), Information on monoclonal and other types of therapeutic antibodies can also be found in Cellular and Molecular Immunology, 6th Edition, [A. K. Abbas, A. H. Lichtman, S. Pillai (Saunders Elsevier Press, 2007)], and U.S. Pat. Nos. 7,390,887 and 7,629,171. For a discussion of various types of therapeutic antibodies, see Strategies and Challenges for the Next Generation of Therapeutic Antibodies, A. Beck, T. Wurch, C. Bailly and N. Corvaia, Nature Rev. Immuno. 10, 345-352 (2010).
- Human antibodies can also be obtained from transgenic animals. For example, transgenic, mutant mice that are capable of producing a full repertoire of human antibodies, in response to immunization, have been described (see, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551-255 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggennann et al., Year in Immunol., 7:33 (1993)).
- Humanized antibodies may also be used in the present invention. Antibody humanization techniques generally involve the use of recombinant DNA technology to manipulate the DNA sequence encoding one or more polypeptide chains of an antibody molecule. Accordingly, a humanized form of a non-human antibody (or a fragment thereof) is a chimeric antibody or antibody chain (or a fragment thereof, such as an Fv, Fab, Fab′, or other antigen-binding portion of an antibody) which contains a portion of an antigen binding site from a non-human (donor) antibody integrated into the framework of a human (recipient) antibody. Methods for humanizing non-human antibodies are well known in the art. For example, humanized antibodies can be generated according to the methods of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986), Riechmann et al., Nature, 332:323-327 (1988), Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Methods that can be used to produce humanized antibodies are also described in U.S. Pat. No. 4,816,567 (Cabilly et al.), U.S. Pat. No. 5,565,332 (1-Hoogenboom et al.), U.S. Pat. No. 5,721,367 (Kay et al.), U.S. Pat. No. 5,837,243 (Deo et al.), U.S. Pat. No. 5,939,598 (Kucherlapati et al.), U.S. Pat. No. 6,130,364 (Jakobovits et al.), and U.S. Pat. No. 6,180,377 (Morgan et al.).
- Techniques described for the production of single chain antibodies [U.S. Pat. Nos. 5,476,786 and 5,132,405 to Huston; U.S. Pat. No. 4,946,778] can be adapted to produce single chain antibodies specific for a Kir channel protein. An additional embodiment of the invention utilizes the techniques described for the construction of Fab expression libraries [Huse et al., Science 246:1275-1281(1989)] to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity for the Kir channel proteins.
- Antibody fragments which contain the idiotype of the antibody molecule can be generated by known techniques. For example, such fragments include but are not limited to: the F(ab′)2 fragment which can be produced by pepsin digestion of the antibody molecule; the Fab′ fragments which can be generated by reducing the disulfide bridges of the F(ab′)2 fragment, and the Fab fragments which can be generated by treating the antibody molecule with papain and a reducing agent.
- Antibodies or fragments thereof, whether attached to other sequences or not, can also include insertions, deletions, substitutions, or other selected modifications of particular regions or specific amino acids residues, provided the activity of the antibody or antibody fragment is not significantly altered or impaired compared to the non-modified antibody or antibody fragment. Such methods are readily apparent to a skilled practitioner in the art and can include site-specific mutagenesis of the nucleic acid encoding the antibody or antibody fragment.
- Nucleic Acids
- The compounds of the present invention include nucleic acids. In particular, nucleic acid sequences capable of binding to a Kir channel may be used in the practice of the present invention. These nucleic acids may be identified using in vitro selection of sequences which bind Kir channel proteins, in particular the turret region of the Kir channel proteins. One type of nucleic acid that is of particular interest is an aptamer. Typically aptamers are small nucleic acid sequences ranging from 15-50 bases in length that fold into defined secondary and tertiary structures that bind to another molecule. This binding is not the typical nucleic acid to nucleic acid hydrogen bond formation but the binding of aptamers can include all other types of covalent and noncovalent binding. In a preferred embodiment, the nucleic acid is DNA, however, other nucleic acids such as RNA may be used. The nucleic acids may be modified or prepared using techniques known in the art to increase the stability of nucleic acids. Representative examples of how to make and use aptamers to bind a variety of different target molecules can be found in the following U.S. Pat. Nos. 5,582,981; 5,595,877; 5,637,459; 6,020,130; 6,028,186; 6,030,776; and 6,051,698. See also Published U.S. patent application Ser. No. 11/917,884 (publication No. US2009/0155779A1); Bock L C, Griffin L C, Latham J A, Vermaas E H, Took J J (February 1992). “Selection of single-stranded DNA molecules that bind and inhibit human thrombin” Nature 355(6360): 564-6; Bunka D H, Stockley P G (August 2006) “Aptamers come of age—at last” Nat Rev Microbio. 4(8): 588-96.
- Small Protein/Peptide Compounds
- Small Protein/Peptide Compounds may also be used in the practice of the present invention. In particular, small proteins may be prepared and screened for the ability to bind to a Kir channel protein based on binding assays disclosed herein and known in the art. Small molecules such as toxins may also be used in the practice of the invention. In particular, small proteins/peptides modeled on toxins which bind to Kir channel proteins may be prepared and tested for the ability to bind and modulate the activity of Kir channel proteins. (Ramu, et al. (2008) Engineered specific and high affinity inhibition for a subtype of inward rectifier Kir channels Proc. Nat'l Acid Sci USA 105:10774-10778)
- A variety of toxins may provide information useful in designing a compound useful in the practice of the present invention. In particular, scorpion toxins (Lu and Mackinnon, 1997 Biochemistry, vol. 36, no, 23, pp 6936 to 6940) snake toxins (for example, the 57 amino acid δ-dendrotoxin from the green mamba snake which inhibits Kir 1.1 channels, (J. P. Imredy, C. Chen, R. Mackinnon, BioChemistry 37, 14867 (Oct. 20, 1998)) and bee venom toxins (Ramu, et al. (2008) Engineered specific and high affinity inhibition for a subtype of inward rectifier Kir channels Proc. Nat'l Acid Sci USA 105:10774-10778) may be helpful in synthesizing libraries of protein/peptide compounds that can bind and effect a Kir channel. Known toxins are often small proteins typically between 20 and 50 amino acids in size containing disulfide bridges. For some of these toxins, the surface important for binding to a Kir channel protein is known and stretches of amino acids of less than 10 amino acids are believed to be important for binding specificity.
- A library of these toxin-based compounds may be prepared while maintaining the key amino acids such as cysteine residues that are important for the folding and structure of the proteins. The amino acid residues important for binding to a Kir channel may be randomized to generate proteins/peptides with enhanced binding strength and turret based specificity for the different members of the Kir channel family of proteins.
- Phage Display
- One method known in the art to rapidly screen a large variety of potential binding proteins/peptides is a phage display assay.
- Phage display libraries may be prepared using known protocols. “Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface”. Science 288 (4705): 1315-1317. Smith G P, Petrenko V A (1997). “Phage display”. Chem. Rev. 97 (2): 391-410. Kehoe J W, Kay B K (2005), “Filamentous phage display in the new millennium”. Chem. Rev. 105 (11): 4056-4072. Hufton S E, Moerkerk P T, Meulemans E V, de Brüine A, Arends J W, Hoogenboom H R (1999). “Phage display of cDNA repertoires: the pVI display system and its applications for the selection of immunogenic ligands.” J. Immunol. Methods 231 (1-2): 39-51, Lunder M, Bratkovic T, Doljak B, Kreft S, Urleb U, Strukelj B, Plazar N. (2005). “Comparison of bacterial and phage display peptide libraries in search of target-binding motif”. Appl. Biochem. Biotechnol. 127 (2): 125-31. Lunder M, Bratkovic T, Kreft S, Strukelj B (2005). “Peptide inhibitor of pancreatic lipase selected by phage display using different elution strategies”. J. Lipid Res. 2005 46 (7): 1512-6.)
- Using phage display the protein/peptide constructs may be expressed on the outer coat of the phage. To identify useful sequences a Kir channel protein may be immobilized on the surface of a well of a standard assay plate, and a phage that displays a protein that binds to Kir channels will bind the target Kir channel protein and remain bound while non-binding phage are removed by washing the plates. The bound phage can be eluted and used to produce more phage for further binding assays. These binding assays may be performed with Kir channels having mutated turrets and wild type turrets to select for proteins/peptides that bind in the turret region. Repeated cycles of these binding assays (‘panning’) results in the identification of phage containing potentially strong binding sequences.
- Phage that contain these strong binding sequences can be used to infect a suitable bacterial host, and phagemids are collected and the DNA sequence of interest encoding the binding region excised and sequenced to identify the protein/peptide compound which be further tested using the assays described below.
- Small Molecules
- Small molecules may also be used in the practice of the present invention. In particular, small molecules may be prepared and screened for the ability to bind to a Kir channel protein based on binding assays disclosed herein and known in the art. See for example U.S. Pat. No. 6,641,997. Additionally, small molecule libraries may also be screened.
- Immunoassays
- Once an antibody has been generated by the methods described above, a variety of different immunoassays may be performed to identify antibodies that bind property folded Kir channels, are specific for the turret region of the Kir channel and can differentiate between different members of the Kir family based on the turret region.
- It is believed that ELISA and Western blot assays are straightforward and efficient assays to identify such antibodies before performing functional assays such as electrophysiological assays.
- In general, immunoassays involve contacting a Kir channel protein with an anti-Kir channel antibody under conditions effective, and for a period of time sufficient, to allow the formation of immune complexes (primary immune complexes). Forming such complexes is generally a matter of simply bringing into contact the antibody and the Kir channel protein sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to, any molecule (e.g., antigens) present to which the antibodies can bind.
- In many forms of immunoassay, the sample-antibody composition, such as an ELISA plate or Western blot, can then be washed to remove any non-specifically bound antibody species, allowing only those antibodies specifically bound within the primary immune complexes to be detected. Immunoassays can include methods for detecting or quantifying the amount of a molecule of interest (such as the disclosed biomarkers or their antibodies) in a sample. In general, the detection of an immunocomplex formation is well known in the art and can be achieved by numerous approaches. These methods are generally based upon the detection of a label or marker, such as any radioactive, fluorescent, biological or enzymatic tags or any other known label. Such assays include but are not limited to ELISA, western blots, radioimmunoassay, (enzyme-linked immunosorbant assay), “sandwich” immunoassays, immunoradiometric assays, gel diffusion precipitin reactions, immunodiffusion assays, in situ immunoassays (using colloidal gold, enzyme or radioisotope labels, for example), precipitation reactions, agglutination assays (e.g., gel agglutination assays, hemagglutination assays), complement fixation assays, immunofluorescence assays, protein A assays, and immunoelectrophoresis assays, and other assays known in the art.
- Antibody binding can be detected by detecting a label on the primary antibody or the primary antibody is detected by detecting binding of a secondary antibody or reagent to the primary antibody. For some assays, the secondary antibody is labeled. Many means are known in the art for detecting binding in an immunoassay and are within the scope of the present invention.
- The use of immunoassays to detect a specific protein can involve the separation of the proteins by electrophoresis. Electrophoresis is the migration of charged molecules in solution in response to an electric field. Their rate of migration depends on the strength of the field; on the net charge, size and shape of the molecules and also on the ionic strength, viscosity and temperature of the medium in which the molecules are moving. As an analytical tool, electrophoresis is simple, rapid and highly sensitive. It is used analytically to study the properties of a single charged species, and as a separation technique. Electrophoresis is used in the Western blots described below.
- ELISA
- Enzyme-Linked Immunosorbent Assay (ELISA), or more generically termed EIA (Enzyme ImmunoAssay), is an immunoassay that can detect an antibody specific for a protein. In such an assay, a detectable label bound to either an antibody-binding or antigen-binding reagent is an enzyme. When exposed to its substrate, this enzyme reacts in such a manner as to produce a chemical moiety which can be detected, for example, by spectrophotometric, fluorometric or visual means. Enzymes which can be used to detectably label reagents useful for detection include, but are not limited to, horseradish peroxidase, alkaline phosphatase, glucose oxidase, galactosidase, ribonuclease, urease, catalase, malate dehydrogenase, staphylococcal nuclease, asparaginase, yeast alcohol dehydrogenase, alpha.-glycerophosphate dehydrogenase, triose phosphate isomerase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. For descriptions of ELISA procedures, see Voller, A. et al., J. Clin. Pathol. 31:507-520 (1978); Butler, J. E., Meth. Enzymol. 73:482-523 (1981); Maggio, E. (ed.), Enzyme Immunoassay, CRC Press, Boca Raton, 1980; Butler, J. E., In: Structure of Antigens, Vol. 1 (Van Regenmortel, M., CRC Press, Boca Raton, 1992, pp. 209-259; Butler, J. E., In: van Oss, C. J. et al., (eds), Immunochemistry, Marcel Dekker, Inc., New York, 1994, pp. 759-803; Butler, J. E. (ed.), Immunochemistry of Solid-Phase Immunoassay, CRC Press, Boca Raton, 1991); Crowther, “ELISA: Theory and Practice,” In: Methods in Molecule Biology, Vol. 42, Humana Press; New Jersey, 1995; U.S. Pat. No. 4,376,110, each of which is incorporated herein by reference in its entirety and specifically for teachings regarding ELISA methods.
- In preferred embodiments of the present invention, ELISA assays are used to identify antibodies that bind to the Kir channel proteins and are specific to the turret region.
- As illustrated in FLOWCHART I, a first ELISA assay is performed to identify antibodies that bind to the Kir channel protein. As an example, if a human Kir 2.2 channel protein is used as an antigen, an ELISA Assay is performed to identify antibodies that bind to human Kir 2.2 channel protein.
- By way of an example ELISA assay, solutions are prepared as follows:
-
- Buffer A: Protein buffer containing detergent slightly above CMC
- Coating Solution—Buffer A+20 ug/ml Protein (50 ul/well, 5.0 ml./plate)
- Wash Solution—Buffer A (200 ul/well×14 washes; 2.8 ml/well, 280 ml total/plate)
- Blocking Solution—Buffer A+5% BSA (0.45u filtered) (400 u/well, 40 ml./plate)
- Primary Ab solution—Cell culture supernatant (diluted 1:1 with 2×Buffer A/2% BSA) or control sera (1:100 in Buffer A+2% BSA)
- Secondary Ab Solution—1:10,000 goat α mouse-Horseradish peroxidase conjugate in Buffer A+2% BSA (100ul/well, 10 ml/plate)
- Substrate Solution—1:1 TMB:H2O2 (100 ul/well, 10 ml/plate)
-
- Stop Solution—2M H2SO4 (100 ul/well, 10 ml./plate)
The following steps are then performed:
- Stop Solution—2M H2SO4 (100 ul/well, 10 ml./plate)
- a) Add 50 ul of coating solution to each well. Prepare coated plates the day before the assay and store at 4° C. overnight, or prepare on day of assay and allow to shake for 1 hour at room temperature. Add solution directly to the bottom of the well, avoiding the sides as much as possible. Coat at least 2 more wells than you have samples for (+) and (−) controls, Leave at least 2 wells uncoated (just wash solution) as negative controls.
- b) Remove coating solution by pouring out and smacking plate face down on a paper towel. Wash wells 3× by adding 200 ul of wash solution to each well, shaking for 1 minute, pouring out wash solution and smacking plates face down on paper towels.
- c) Add 300 ul of blocking solution to each well and let plates sit at room temperature for 2 hour.
- d) Remove blocking solution and wash wells 3× with 200 ul of washing solution.
- e) Add 50 ul 2×Buffer to each well (except controls)
- f) Add 50 ul primary antibody solution to the 50 ul 2×buffer in each well and mix. Add diluted (+) control serum to a coated and uncoated well and diluted (−) control serum to coated and uncoated well. Let plates sit at room temperature for 1 hour on orbital shaker.
- g) Remove Primary Ab solution and wash wells 3× with 200 ul washing solution.
- h) Add 100 ul secondary Ab solution to each well and let plates sit at room temperature for 1 hour.
- The plates are then examined to determine if antibodies for a Kir channel protein are present using standard techniques as described above.
- Western blotting or immunoblotting allows the determination of the molecular mass of a protein and the measurement of relative amounts of the protein present in different samples. Detection methods include chemiluminescence and chromagenic detection. Standard methods for Western blot analysis can be found in, for example, D. M. Bollag et al., Protein Methods (2d edition 1996) and E. Harlow & D. Lane, Antibodies, a Laboratory Manual (1988), U.S. Pat. No. 4,452,901, each of which is herein incorporated by reference in their entirety for teachings regarding Western blot methods. Generally, proteins are separated by gel electrophoresis, usually SDS-PAGE. For the assays used in the present invention for initial antibody screening, it is preferred to use an SDS-PAGE so as to denature the Kir channel proteins used in the blot. The proteins are transferred to a sheet of special blotting paper, e.g., nitrocellulose, though other types of paper, or membranes, can be used. The proteins retain the same pattern of separation they had on the gel. The blot is incubated with a generic protein (such as milk proteins) to bind to any remaining sticky places on the nitrocellulose. An antibody is then added to the solution which is able to bind to its specific protein.
- The attachment of specific antibodies to specific immobilized antigens can be readily visualized by indirect enzyme immunoassay techniques, usually using a chromogenic substrate (e.g. alkaline phosphatase or horseradish peroxidase) or chemiluminescent substrates. Other possibilities for probing include the use of fluorescent or radioisotope labels (e.g., fluorescein, 125I). Probes for the detection of antibody binding can be conjugated anti-immunoglobulins, conjugated staphylococcal Protein A (binds IgG), or probes to biotinylated primary antibodies (e.g., conjugated avidin/streptavidin).
- As illustrated in
FLOWCHART 1, a western blot is performed to determine if an antibody binds to the denatured form of a Kir channel protein, The combination of the ELISA and the Western blot Kir channel assays as illustrated inFLOWCHART 1 facilitates the identification of antibodies that recognize the properly folded native Kir channel (ELISA Positive) but not the denatured (Western Negative) form of the protein. - In particular, if a given antibody binds to a Kir channel protein in an ELISA assay (“ELISA Positive”), but fails to bind to the same Kir channel protein in a Western blot (Western Negative), then the antibody is binding to the native conformation of the protein but not the denatured form.
- Identification of Antibodies with Turret Specificity
- Given the discovery in the present invention of the importance of the turret regions and the identification of the region of the Kir proteins which constitute the turret region it is possible to prepare Kir channel proteins which contain mutations located in the turret region. This in turn provides the basis for identification of antibodies that are specific for the turret region of the Kir channel proteins. In particular, the determination of the atomic structure of what constitutes the turret region of the Kir channels identifies where to introduce such mutations so as to selectively identify anti-Kir Channel antibodies that are directed against the turret. Such mutations may be made in a variety of places, such as following the L residue in the sequence HGDL (or slight variations of that sequence) and up to but not including the conserved cysteine labeled C123 in the structure of the proteins (see
FIGS. 1A-1C ). Examples of these variable portions of certain turret regions is provided in SEQ ID NOs 1-13. Kir channel proteins which contain mutations in the turret region, or preferably in the variable portion, may be used in assays described below. - To identify antibodies that are specific for the turret region of the Kir channel further ELISA assays may be performed as illustrated in
FLOWCHART 1. These ELISA assays utilize Kir channels with mutated turret regions. Antibodies that bind a normal Kir channel in an ELISA assay but do not bind a channel with a mutated turret will be isolated since these antibodies may be considered turret specific—that is the epitope for the antibody is located in the turret region of the protein. The source of these antibodies will be used to prepare monoclonal antibodies using standard techniques as described above. An additional assay described below and presented in FLOWCHART 2 identifies antibodies or other compounds with the ability to bind the turret region using a fluorescent assay. - Assays for Kir Channel Activity
- Even if an antibody or other type of compound binds the turret region its utility as a therapeutic compound is based on its functional effect on a Kir channel, Accordingly, the next step is to determine if an antibody which binds the turret region of a Kir channel is capable of modulating electrolyte processing. Monoclonal antibodies prepared from turret specific antibodies identified above can be used in electrophysiological assays as can other compounds found to have binding specificity for the turret region of Kir channels.
- There are a variety of electrophysiological assays known to those with skill in the art which may be used to determine whether the compounds of the present invention have an effect on the electrophysiological state of a Kir Channel.
- Useful electrophysiological assays include a variety of in vitro and in vivo assays, e.g., measuring voltage, current, measuring membrane potential, measuring ion flux, e.g., potassium or rubidium, measuring potassium concentration, measuring second messengers and transcription levels, and using e.g., voltage-sensitive dyes, radioactive tracers, electrode voltage clamps and patch-clamp electrophysiology. Such assays can be used to test for both inhibitors and activators of Kir channels.
- Modulators of the Kir channels may be tested using biologically active, functional Kir channels, either recombinant or naturally occurring. In recombinantly based assays, the subunits are typically expressed and modulation is tested using one of the in vitro or in vivo assays described herein.
- In brief, samples or assays that are treated with a potential Kir channel turret binding compounds inhibitors or activators are compared to control samples without the test compound, to examine the extent of modulation. Control samples e.g. those untreated with the compounds are assigned a relative Kir channel activity value of 100. Inhibition is present when Kir channel activity value relative to the control is about 90%, preferably 50%, more preferably 25%.
- It should be noted that the compounds may also result in activation of Kir channels. Activation of channels is achieved when the select Kir channel activity value relative to the control is 110%, more preferably 150%, more preferable 200% higher. It is possible that for treating some diseases states such activating compounds may be useful alone or in combination with inhibitors.
- Changes in ion flux may be assessed by determining changes in polarization (i.e., electrical potential) of the cell or membrane expressing the Kir channels of this invention. A preferred means to determine changes in cellular polarization is by measuring changes in current (thereby measuring changes in polarization) with voltage-clamp and patch-clamp techniques, e.g., the “outside-out” mode, and the “whole cell” mode (see, e.g., Ackerman et al., New Engl. J. Med. 336:1575-1595 (1997) and Single Channel Recording, Plenum Press, B. Sakmann and E. Neher eds). Whole cell currents are conveniently determined using the standard methodology (see, e.g., Hamil et al., P Fingers. Archly. 391:85 (1981). Other known assays include: radiolabeled rubidium flux assays and fluorescence assays using voltage-sensitive dyes (see, e.g., Vestergarrd-Bogind et al., J. Membrane Biol. 88:67-75 (1988); Daniel et al., J. Pharmacol. Meth. 25:185-193 (1991); Holevinsky et al., J. Membrane Biology 137:59-70 (1994)). Assays for compounds capable of inhibiting or increasing potassium flux through the channel proteins can be performed by application of the compounds to a bath solution in contact with and comprising cells having an channel of the present invention (see e.g., Blatz et al., Nature 323:718-720 (1986); Park, J. Physiol. 481:555-570 (1994)). Generally, the compounds to be tested are present in the range from 1 pM to 100 μM.
- The effects of the test compounds upon the function of the Kir channels can be measured by changes in the electrical currents or ionic flux or by the consequences of changes in currents and flux. Changes in electrical current or ionic flux are measured by either increases or decreases in flux of cations such as potassium or rubidium ions. The cations can be measured in a variety of standard ways. They can be measured directly by concentration changes of the ions or indirectly by membrane potential or by radiolabeling of the ions. Consequences of the test compound on ion flux can be quite varied. Accordingly, any suitable physiological change can be used to assess the influence of a test compound on the Kir channels of this invention. The effects of a test compound can be measured by a toxin binding assay. When the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as transmitter release (e.g., dopamine), hormone release (e.g., insulin), transcriptional changes to both known and uncharacterized genetic markers (e.g., northern blots), cell volume changes (e.g., in red blood cells), immunoresponses (e.g., T cell activation), changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as [Ca2+].
- Two Electrode Voltage Clamp Assay
- One assay that may be of particular use in the present invention is a two electrode voltage clamp assay. This assay may be performed using any of these Kir channel proteins and compounds of the present invention using modifications readily known to those in the art. In the example below, this assay was conducted using the chicken Kir 2.2 channel. To perform this assay, Xenopus oocytes will be harvested from mature female Xenopus laevis and defolliculated by collagenase treatment for 1-2 hours. Oocytes will then rinsed thoroughly and stored in ND96 solution (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl2, 1.0 mM MgCl2, 5 mM HEPES, 50 μg/ml gentamycin, pH 7.6 with NaOH). Defolliculated oocytes will be selected 2-4 hours after collagenase treatment and injected with cRNA the next day. The injected oocytes will be incubated in ND96 solution for 1-5 days before recording. All oocytes will be stored in an incubator at 18° C.
- The desired human or chimeric Kir channel protein DNA will be sub-cloned into the pGEM vector (Promega). cRNA will be prepared using T7 RNA polymerase (Promega) from NdeI-linearized plasmid DNA.
- All recordings will be performed at room temperature. For two-electrode voltage-clamp experiments, oocytes will be held at 0 mV and pulsed from −80 mV to +80 mV with 10 mV increment steps. Recording solution will contain 98 mM KCl, 0.3 mM CaCl2, 1 mM MgCl2, and 5 mM HEPES pH 7.6. The ionic currents will be recorded with an oocyte clamp amplifier (OC-725C, Warner Instrument Corp.). The recorded signal will be filtered at 1 kHz and sampled at 10 kHz using an analogue-to-digital converter (Digidata 1440A, Axon Instruments, Inc) interfaced with a computer. pClamp10.1 software (Axon Instruments, Inc) will be used for controlling the amplifier and data acquisition.
- Patch Clamp Assays
- Patch clamp assays use a micropipette attached to a cell membrane to allow recording from a single ion channel in the cell membrane.
- To perform this type of assay a micropipette which serves as a microelectrode is positioned next to a cell, and a piece of the cell membrane (the ‘patch’) is drawn into the microelectrode tip; the glass tip of the micropipette forms a high resistance ‘seal’ with the cell membrane, then whole cell mode is entered by applying suction. Next, the pipette is moved away from the cell to form an outside-out patch. Examples of useful protocols may be found in Single Channel Recording, Plenum Press, B. Sakmann and E. Neher eds. This configuration can be used to study Kir channels present in the isolated patch of membrane. Variations of this technique include the “perforated patch” technique, or the patch of membrane can be pulled away from the rest of the cell.
- As an example, for patch-clamp experiments in the outside-out mode, each oocyte will be incubated in a hypertonic solution containing 200 mM NaCl, 130 mM KCl, 5 mM K2EDTA, 5 mM K2HPO4, 5 mM KH2PO4 pH 7.2 for 5-10 minutes and the vitelline membrane will be removed before seal formation. Currents will be recorded in either cell-attached or outside-out configuration with an Axopatch 200B amplifier, Digidata 1440A analogue-to-digital converter and pClamp10.1 software to control membrane voltage and record. During the current recordings, the membrane will be first held at 0 mV followed by a 10-second voltage ramp from +80 mV to −80 mV. The pipette solution will contain 140 mM KCl, 5 mM K2HPO4, 5 mM KH2PO4, 0.3 mM CaCl2, 1 mM MgCl2, pH 7.2 with KOH. The bath solution will contain 130 mM KCl, 5 mM K2EDTA, 5 mM K2HPO4, 5 mM KH2PO4, pH 7.2 with KOH.
- To measure a compound for activity, first a control current is measured while perfusing with the recording solution without the compound present. Then, a second current is recorded while perfusing with the solution and the compound of interest. Any difference in current levels indicates that the compound acts to modulate the activity of the Kir channel. An example of this type of assay may be found in Lu and MacKinnon 1997 Biochemistry, vol. 36, no. 23, pp. 6936-6940 or Namba et al., 1996 FEBS Letters vol. 386, pp. 211-214.
- Planar Lipid Assay
- Another electrophysiological assay which may be used in the present invention is a planar lipid bilayer assay. In this type of assay a lipid bilayer is created and the Kir channel protein is introduced into the lipid bilayer. A hydrophobic material such as Teflon is used to prepare the lipid bilayer by making a small hole (an aperture) in a sheet of Teflon. A syringe containing a solution of lipids dissolved in an organic solvent is introduced to the hole and a bilayer is formed in the center of the aperture, with solvent forming the perimeter of the newly formed bilayer.
- The Teflon sheet provides a partition between two chambers allowing the placement of electrodes on both sides of the sheet. Preferably, the purified Kir channel is reconstituted into lipid vesicles and then fused with the bilayer after it is formed. The detergent coating facilitates insertion into the bilayer. (See U.S. Pat. No. 6,191,254 and Guillermo et al J. Membrane Biol (2008) 223: 13-26).
- The amount of lipid desired (preferably PE:PG 3:1) is pipetted into a glass vial (about 5-10 mg). The lipid is dried under argon and then further under a room temperature vacuum for about 3 hours.
- The lipid is rehydrated with hydration buffer (10 mM HEPES 7.4 (KOH), 450 mM KCl, 4 mM N-methylglucamine, 2 mM DM to a final lipid concentration of 10 mg/ml and vortexed briefly. The glass vial is flushed with argon and the lipid mixture is sonicated mildly, i.e., with short pulses of no longer than 30 seconds each. In between sonication pulses, the lipid mixture is cooled in a room temperature water bath to ensure that the lipid mixture does not get too hot. This procedure is repeated until the lipid mixture becomes translucent with a distinct pink shade.
- A solution containing 50 mM DM in the hydration buffer is prepared. The DM solution is added to the lipid mixture to give a final concentration of 10 mM of DM and rotated at room temperature for 2 hours. To the detergent/lipid mixture, the Kir channel is added to the desired ratios (e.g., about 0.05-0.1). The concentration of DM is then raised to 17.5 mM and the mixture is rotated at room temperature for 1 hour. The detergent/lipid mixture is then put into dialysis tubing and dialysed against the hydration buffer.
- Fluorescent Dye Assay
- Another assay which may be used to identify compounds which specifically bind the Kir channel turret region is an assay utilizing a fluorescent dye. An example of a suitable dye is FIuxOR™ available from Invitrogen (catalog nos, F10016, E10017), An example of this method is shown in FLOWCHART 2.
- The FluxOR™ reagent is a fluorogenic indicator dye, which is loaded into cells as a mernbrance-permeable Acetoxymethanol (AM) ester. According to the protocol, the FluxOR™ reagent is dissolved in DMSO and further diluted with the FluxOR™ assay buffer, a physiological Hank's balanced salt solution, for loading into cells. Pluronic® surfactants, which disperse and stabilize the dye are used to facilitate loading in aqueous solution.
- Mammalian cells such as HEK, COS or CHO cells are grown in culture and incubated with the dye. Inside the cell, the non-fluorescent AM ester form of the FluxOR™ dye is cleaved by endogenous esterases into a flourogenic thallium-sensitive indicator. The thallium-sensitive form is retained in the cytosol and its extrusion is inhibited by water-soluble Probenecid, which blocks organic anion pumps. The dye-loading buffer is replaced with fresh, dye-free assay buffer, composed of physiological HBSS containing Probenecid, before the assay. During the assay, a small amount of thallium is added to the cells with a stimulus solution that opens potassium-permeant ion channels with a mild depolarization or agonist addition. Thallium then passes into cells through open potassium channels according to a strong inward driving force. Upon binding cytosolic thallium, the de-esterified FluxOR™ dye exhibits a strong increase in fluorescence intensity at its peak emission of 525 mm Baseline and stimulated fluorescence is monitored in real time to give a dynamic, functional readout of thallium redistribution across the membrance with no interference from quencher dyes.
- inhibitors such as, for example, the compounds of the present invention may slow the rate of entry of thallium and thus reduce the onset of a fluorescent signal. This assay may be used for the selection of compounds that specifically bind to the turret regions of the Kir proteins. To identify such compounds a first group of cells would be transfected with wild type Kir channels and a second group of cells transfected with Kir channel having mutated turrets as illustrated in FLOWCHART 2. Test compounds such as the antibodies identified in the assays above would be added to the cells to screen for those compounds which inhibit or reduce the onset of fluorescence upon addition of the thallium dye due to inhibition of the channel. Compounds which reduced the rate of thallium intake in cells with normal turrets but had no effect on cells with mutant turrets would be classified as turret specific inhibitor compounds.
- This assay may also be used to determine the specificity of the compounds for given turrets, in other words, the compounds may be introduced into cells which have been transfected with different versions of the Kir Channel to determine if the compound is specific for a given type of Kir Channel protein.
- Assay for Selective Binding to Specific Types of Kir Channels
- In order to determine whether a given antibody is specific for a given type of Kir Channel, assays such as an ELISA assay may be performed in which an antibody is tested against a variety of different Kir Channels to determine if the antibody is specific for a single type of Kir Channel. Ideally, antibodies that would be used as therapeutic compounds will bind to only one type of Kir channel in the turret region.
- Methods to Identify Compounds to Treat Conditions
- Compounds that bind to the turret region of a Kir channel and which modulate the ion channel activity of a Kir channel may be administered to a subject to determine if such compounds are able to treat a given condition. As an example, a compound may be administered to a subject such as a mammal with a given disease state using known methods of administration and the subject is then monitored clinically and tested using biochemical assays to determine if the compound is able to treat the condition using known assays for the disease state. It is believed that a variety of conditions may be treated with the compounds of the present invention, including, but not limited to, diabetes mellitus, hypertension, cardiac arrhythmia and epilepsy.
- The present invention may be better understood by reference to the following non-limiting example, which is provided as exemplary of the invention. This example should in no way be construed, however, as limiting the broad scope of the invention. Example 1, which follows below, provides the first determination of the crystal structure of a euraryotic Kir channel protein and identification of the structured turret region present in Kir channel proteins. (See Crystal Structure of the Eukaryotic Strong Inward-Rectifier K + Channel Kir2.2 at 3.1 Å Resolution, X. Tao, J. L. Avalos, J. Chen and R. MacKinnon, Science 2009 December 18; 326 (5960); 1668.)
- Inward-rectifier K+ channels conduct K+ ions most efficiently in one direction, into the cell. Kir2 channels control the resting membrane voltage in many electrically excitable cells and heritable mutations cause periodic paralysis and cardiac arrhythmia. We present the crystal structure of Kir2.2 from chicken, which, excluding the unstructured N- and C-termini, is 90% identical to human Kir2.2, Crystals containing Rb+, Sr2+ and Eu3+ reveal binding sites along the ion conduction pathway that are both conductive and inhibitory. The sites correlate with extensive electrophysiological data and provide a structural basis for understanding rectification. The channel's extracellular surface, with large structured turrets and an unusual selectivity filter entryway, might explain the relative insensitivity of eukaryotic inward rectifiers to toxins. These same surface features also suggest a possible approach to the development of inhibitory agents specific to each member of the inward-rectifier K+ channel family. A crystal structure reveals the structural basis of diode-like conduction properties and relative toxin insensitivity in inward rectifier K+ channels.
- In 1949 Bernard Katz introduced the term ‘anomalous rectification’ to distinguish the K+ currents he observed in frog skeletal muscle from the ‘delayed rectification’ K+ currents of the squid axon action potential (1, 2). Today we know that ‘delayed rectifiers’ are a subset of the large family of voltage-dependent K+ (Kv) channels, while ‘anomalous rectifiers’ are members of a different family of channels more commonly known as inward rectifier K+ (Kir) channels (3). The name inward rectifier refers to a fundamental ion conduction property exhibited to a greater or lesser degree by all members of the family: given an equal but opposite electrochemical driving force, K+ conductance into the cell far exceeds conductance out of the cell. Thus, Kir channels are analogous to one-way conductors, or diodes, in solid-state electronic devices.
- Electrophysiological experiments have shown that inward rectification is a consequence of voltage-dependent pore blockage by intracellular multivalent cations, especially Mg2+ and polyamines (4-8). At internal negative (hyperpolarizing) membrane voltages the blocking ions are cleared from the pore so that K+conducts, whereas at internal positive (depolarizing) membrane voltages the blocking ions are driven into the pore from the cytoplasm so that K+ conduction is blocked. As a result, Kir channels are conductive when an excitable cell is at rest and non-conductive during excitation. This property is thought to foster energy efficiency because it enables Kir channels to regulate the resting membrane potential, but not dissipate the K+ gradient during an action potential (3).
- A central mechanistic question is why are Kir channels blocked by intracellular multivalent cations? Mutational studies have identified several amino acids that confer sensitivity to blocking ions (9-19), but a structural description of these sites has remained elusive. Structures of prokaryotic Kir channels, due to their low sequence similarity to eukaryotic Kir channels, do not contain the specific amino acids that are known to underlie blockage and rectification (20, 21).
- Another longstanding puzzle in eukaryotic Kir channel studies is their relative insensitivity to natural toxins that typically inhibit other K+ channels (22-24). Snake, spider and scorpion venoms, for example, contain numerous toxins against various Kv channels and Ca2+-activated K+ channels (25-27). By contrast, Kir channel toxins are rare, and no specific toxins against Kir2 channels have been discovered.
- The eukaryotic Kir channels contain several amino acid sequence motifs and conserved amino acids that are essential to their functional properties (
FIGS. 1A-1C ). For example, in most other K+ channels the selectivity filter comprises the ‘canonical’ filter sequence TXGYGDX, where X represents an aliphatic amino acid (FIGS. 1A-1C ). The corresponding sequence in eukaryotic Kir channels is TXGYGFR, with F sometimes replaced by another amino acid. In light of the structural importance of DX in the canonical sequence, the amino acids FR signify a marked variation on the filter sequence. Eukaryotic Kir channels also contain an absolutely conserved pair of cysteine residues flanking the pore-region, which is the re-entrant peptide segment that forms the pore-helix and selectivity filter of K+ channels. Between the outer helix (the first transmembrane segment) and pore-region the ‘turret’, though varied amongst inward rectifiers, contains the sequence HGDL that could be considered a signature of eukaryotic Kir channels, Finally, through extensive studies combining electrophysiology and mutagenesis several acidic amino acids (D and E) are known to be critical to inward rectification (9-19), and motifs containing basic amino acids (e.g. PKKR) are critical to PIP2 activation of Kir channels (28-35). These positions are enclosed in boxes on the sequences inFIGS. 1A-1C . - The Kir2.2 channel from chicken is 90% identical to the human ortholog (excluding the N- and C-termini) and contains all of the sequence characteristics of a strong inward rectifier (36).
FIGS. 6A-6D shows that the chicken Kir2.2 channel expressed in Xenopus oocytes indeed functions as a strong rectifier. In oocyte two-electrode voltage clamp recordings with 98 mM KCl in the bath solution inward currents are much larger than outward currents (FIG. 6B ). In on-cell and excised gigaseal patch recordings channel activity is observed at hyperpolarizing (negative internal) membrane voltages but not at depolarizing (positive internal) voltages (FIG. 6C ). The single channel conductance measured near −80 mV is approximately 40 pS, which is very similar to the values reported for the guinea pig and mouse Kir2.2 channels (37, 38) (FIG. 6D , inset). The sharp transition between channel conductance and non-conductance as a function of membrane voltage is characteristic of a strong rectifier (36). Note that upon patch excision from the oocyte surface some outward current is observed at voltages slightly positive to the reversal potential because the concentration of intracellular blockers is decreased (FIG. 6C , trace labeled (C)). However, the current still decreases with further depolarization (negative conductance) as channels become blocked in a voltage-dependent manner: this behavior reflects the inherent difficulty in washing away trace yet still active concentrations of polyamine molecules due to their very high affinity for the pore in strong rectifiers (39, 40). Several minutes following patch excision the currents decrease (FIG. 6C , trace labeled (A)). This ‘run-down’ reflects altered channel regulation mediated by kinases, phosphatases and lipid signaling (34, 36, 41, 42). - In order to obtain diffracting crystals the intrinsically disordered N- and C-terminal regions were removed, The electrophysiological recordings shown in
FIGS. 6A-6D were made using a similar construct with N- and C-terminal truncations, confirming that the crystal structure corresponds to a functional channel unit with strong rectifying properties. The Kir2.2 model, consisting of the cytoplasmic domain and transmembrane channel, was refined at 3.1 Å to a free R-factor of 0.27. A ribbon diagram in stereo shows the transmembrane pore (above) and the cytoplasmic pore (below) (FIG. 2A ). Lateral openings between the transmembrane and cytoplasmic pores, at the level of the lipid membrane headgroup layer, contain many arginine and lysine residues. The high density of positive charges makes it unlikely that K+ ions would pass through these openings (FIG. 7 ). InFIG. 7 the shading at the top of the Figure illustrates a negative electrostatic potential at the surface and the darker shaded region in the center of the Figure illustrates regions of positive electrostatic potential. The structure is therefore consistent with mutagenesis studies, which support the conclusion that the ion pathway extends across the full length of the transmembrane and cytoplasmic pores (9-19). The overall architecture is similar to prokaryotic Kir channels but with a notable difference: the Kir2.2 channel contains prominent, highly structured turrets on the extracellular face of the channel. These surround as if to protect the pore entryway. - At a detailed structural level Kir2.2 is quite different from prokaryotic Kir channels owing to minimal (<20%) sequence conservation. The cysteine pair that is absolutely conserved among eukaryotic Kir channels creates a circularized pore region through covalent linkage of the segment preceding the pore helix (C123) to the segment following the selectivity filter (C155) (
FIG. 2B ). The existence of a disulfide bond was correctly predicted on the basis of mutagenesis studies: mutation of the corresponding cysteines in Kir2.1 led to the absence of currents even though expressed protein was detectable by Western Blot analysis (43, 44). Application of 10 mM DTT or reduced glutathione to the outside of cells expressing the wild-type channels did not affect currents. From these two observations it was concluded that a disulfide bridge must be essential for proper folding, but apparently not for function (43, 44), The structure provides an alternative interpretation. The disulfide bridge is buried beneath the protein surface at the level of the membrane interface. Furthermore, the Kir2.2 channel was purified and crystallized in the presence of 20 mM DTT and 3 mM TCEP, and yet the disulfide bridge remained intact. It is therefore possible that the disulfide bridge remains intact upon exposure to moderate concentrations of DTT, and that the bridge may be important for channel function. - The pore region is further stapled together by an ionized hydrogen bond between R149 in the filter sequence TXGYGFR and E139 (
FIGS. 2B and 2C ). The Glu O-ε to Arg distance is 2.4 Å, compatible with an energetically strong interaction. Mutations altering this interaction are known to alter channel function (45, 46). On the basis of studies with concatenated subunits the salt bridge was thought to be inter-subunit, but the crystal structure shows that this interaction ties together two segments of the pore-region within a single subunit (46). - Despite the presence of substantially different protein contacts surrounding the selectivity filter, the main-chain structure of the filter in Kir2.2 is the same as in other K+ channels (47). For example, the main chain RMSD between Kv1.2 and Kir2.2 is 0.4 Å, which is within the margin of certainty to discriminate atomic positions with 3.1 Å diffraction data (
FIGS. 2D and 2E ) (20, 48, 49), One structural difference near the filter could possibly account for important pharmacological differences between Kir and other K+ channels. In the canonical filter sequence the Asp (D) residue in the filter sequence is buried, creating a flat surface surrounding the filter opening. By contrast, in Kir channels the Phe (F) residue at the corresponding position projects directly into aqueous solution, creating four protrusions on the perimeter where the filter opens to the extracellular solution. - The pore lining on the intracellular side of the selectivity filter is mainly hydrophobic in nearly all K+ channels. Eukaryotic Kir channels are an exception in which the central region of the pore—known as the central cavity—contains four polar amino acids (one from each subunit) projecting toward the ion pathway (
FIG. 3A ). In Kir2.2 and other strong rectifiers these polar amino acids are Asp (D173), whereas in weak rectifiers such as Kir1.1 and Kir6.1 they are Asn (FIG. 1A-1C ). On the basis of electrophysiological studies, Asp residues in the central cavity of strong rectifiers are hypothesized to influence the affinity of Mg2+ and polyamines by an electrostatic mechanism (12, 18). - Beneath the central cavity, residues I177 and M181 on the inner helices form two hydrophobic seals that close off the pore leading to the cytoplasm (
FIG. 3C ). Kir2.2 is therefore physically shut at the ‘activation gate’ (50). Amino acids corresponding to positions 177 and 181 are also large and hydrophobic in most other eukaryotic Kir channels, but not in many other K+ channels (FIGS. 1A-1C ). For example, in KcsA, Kv channels and prokaryotic Kir channels, the position corresponding to 177 usually contains a small and sometimes polar amino acid, typically Ala or Thr. In KcsA both seal positions contain small amino acids (FIG. 3D ). Because of the large hydrophobic residues at positions 177 and 181, the inner helices of Kir2.2 do not come as close together in the closed conformation as in KcsA (FIGS. 3C and 3D ). -
FIG. 3E shows the cytoplasmic domain tetramer from the Kir2.2 channel superimposed onto the domain from Kir2.1, which was solved by crystallography in the absence of a transmembrane channel (11). Over most of the domain these structures are nearly identical. This observation supports the expectation (based on 80% sequence identity) that Kir2.2 should represent an excellent model for the complete Kir2.1 channel. In addition to the activation gate formed by the transmembrane inner helices, Kir channels have been proposed to have a second gate (G-loop) at the apex of the cytoplasmic domain tetramer (11, 51). The G-loop is physically open in Kir2.2 and closed in the Kir2.1 domain (FIGS. 3F and 3G ). The differences in conformation are due to local movements of the G-loop rather than rigid body motions of the cytoplasmic domains. Local G-loop movements contrast observations on the cytoplasmic domain of Kir3.1, in which G-loop opening appears associated with rigid body movements of domains in the tetramer (20). -
FIG. 4A-F shows the locations of ions in difference Fourier maps from crystals containing Rb+, Sr2+, and Eu3+. Rb+ is a K+ analog that conducts. Density for this ion is observed at multiple sites in the selectivity filter and at three positions within the pore on the intracellular side of the selectivity filter, but is absent in the central cavity (FIG. 4A ). The three occupied intracellular positions are: immediately internal to the activation gate in the transmembrane pore, in the cytoplasmic pore internal to the G-loop, and at the entryway to the cytoplasmic pore. We refer to the two sites in the cytoplasmic pore as the upper and lower rings of charges, respectively (FIG. 8 ). The presence of multiple sites along the pore occupied by conducting ions area prerequisite for strong voltage-dependent block by intracellular cations that cannot pass through the selectivity filter (12, 52-57). - Crystals of Kir2.2 were grown in the presence of 650 mM Rb+ and yet electron density for Rh+ is not observed in the cavity (
FIG. 4A ). This finding is noteworthy because under similar conditions a strong monovalent cation peak is observed in the cavity of KcsA (47, 58). Native crystals of Kir2.2, grown in the presence of 150 mM K+ and 500 mM Na+, show a weak electron density peak at the cavity center with additional peaks on the perimeter, apparently bridging toward the D173 side-chain (FIG. 3A ). We can not discern whether these peaks represent a disordered ion, multiple ions, or a low occupancy K+ (or Na+) in the center, perhaps surrounded by water molecules hydrogen bonded to the Asp carboxylate. We can conclude, however, that the central cavity in Kir2.2, at least in the closed conformation, has cation attractive properties that are different from KcsA. - The divalent cation Sr2+ should behave as an electron dense mimic of Mg2+, a biologically important metal ion inhibitor of eukaryotic Kir channels (7, 8). In Fo-Fc Fourier maps from crystals with 10 mM Si2+, 500 mM Na+ and 150 mM K+, density peaks due to Sr2+ are observed at three sites inside the pore intracellular to the selectivity filter: in the cavity, at the upper ring and at the lower ring of charges (
FIGS. 8 and 4B ). The magnitude of the Sr2+ peak is small in the cavity (3.4σ) compared to the peaks at the upper (9.6σ) and lower (7.2σ) rings of charges. Separate experiments with crystals containing 200 mM Sr2+ support that the weak cavity peak is indeed due to Sr2+, which is present apparently at relatively low occupancy. Detailed views of these sites are shown (FIGS. 4D-F ). They each consist of planar rings of acidic amino acids arranged on the pore's perimeter. All three sites exhibit a preference for Sr2+:10 mM Sr2+ out competes 150 mM K+. This selectivity is likely to be electrostatic in origin. The sites are too wide (10.5 Å, 8.9 Å and 9.3 Å diameter for the cavity, upper and lower ring of charges) to mediate direct coordination of an ion at the center. Presumably ions at the center of these sites interact through bridging water molecules. Since each site has the potential to contain multiple negatively charged carboxyl groups, the resulting strong electric field is expected to create a good match for a multivalent cation. Crystals containing the lanthanide Eu3+, which we assume to be trivalent (59), provide support for this hypothesis. An anomalous difference Fourier map shows that Eu3+ binds at only one site, the upper ring of charges. This site appears to be more electronegative than the others because it contains two concentric rings of acidic amino acids, E225 and E300. - Mutagenesis studies have identified several amino acids that, when mutated, affect the affinity of Mg2+ and polyamines in strong rectifiers. D173 in the cavity, E225 and E300 forming the upper ring of charges, and D256 forming the lower ring of charges are among those known to be important (9-19). The weak Sr2+ peak in the cavity might seem incompatible with the large influence that mutations of the cavity Asp (D173) have on Mg2+ affinity. However, the channel in the crystal is not in an applied electric field: in an electric field imposed by a depolarized (positive inside) membrane we expect that the distribution of blocker occupancies among the multiple sites will change. Specifically, we expect the blocking cations to be driven deeper into the pore toward the cavity. In correlating the crystallographic with electrophysiological data, it is most significant that the amino acids forming the Sr2+ sites in the crystal are the same amino acids that are known to affect blockage and rectification in electrophysiology experiments (36). Beyond providing a structural basis with which to explain past electrophysiological studies, the Kir2.2 structure also suggests many new experiments. For example, most studies on the mechanism of rectification have focused on electrostatic interactions between the positively charged blocker and negatively charged groups on the protein. But hydrophobic interactions between methylene groups of polyamine molecules and hydrophobic residues in the channel may be important. In particular, we might anticipate that when the pore opens polyamines could interact strongly with the large hydrophobic amino acids at positions 177 and 181 when the leading amino group of the polyamine reaches into the central cavity (
FIG. 3C ) (54). - Since the earliest investigations of strong inward rectifiers two important properties have been noted: a sharp transition from a conductive state to a non-conductive (blocked) state over a very narrow voltage range, and a dependence of the transition on the extracellular K+ concentration (60-63). Specifically, the voltage at which the transition occurs shifts to more depolarizing values as extracellular K4 concentration is increased. Both properties, the sharp transition (i.e. strong voltage dependence) and its dependence on extracellular K+, have been attributed to the simple notion that conducting ions and blocking ions compete for sites in the pore (12, 52-57, 64-66). The crystallographic data presented here support this conclusion. We observe in the crystal Rb+binding at the same sites that can bind multivalent blocking ions. Therefore a high extracellular K+ (or Rb+) concentration should favor occupation of the sites by conducting ions, and a more depolarizing voltage should be required to drive blocking ions into the pore from the cytoplasm to replace the conducting ions. Moreover, as blocking ions enter the pore from the intracellular side, the displaced conducting ions must move through the selectivity filter to the extracellular side. This is to say that movements of blocking and conducting ions must be coupled. Such coupling would have energetic consequences because movement of an ion across the membrane voltage difference constitutes work. In other words a blocking ion entering the pore will exhibit a voltage dependence that results from a combination of its own charge and the charge of the displaced ions. This can be the origin of strong voltage dependent block, which can be the origin of a biologically important property of strong rectifiers—their diode property of a sharp transition from a conductive to a non-conductive state as a function of membrane voltage (12, 52-55, 64).
- Two aspects of the structure may account for the fact that eukaryotic Kir channels, especially members of the Kir2 subfamily, are relatively insensitive to K+ channel toxins (22-24). The turrets in Kir2.2 are larger and come closer together, constricting the pore entryway compared to Kv1.2; and F148 in the sequence TXGYGFR creates four protrusions on the surface at the pore opening (
FIGS. 5A and 5B ). Thus, in Kv channels the entryway is wider and the pore opens onto intersecting grooves with a flat base, which form the docking surface for pore-blocking scorpion toxins (FIG. 5B ). In Kir2.2 the entryway is constricted and the grooves are absent (FIG. 5A ). - Though the shape of the eukaryotic Kir channel pore entryway might offer fewer opportunities for inhibitory protein-protein interactions, inhibition might occur by a somewhat different strategy. Inhibitors of Kir1.1 and Kir3.4 channels have been identified. A bee venom toxin, tertiapin, inhibits both of these channels (22). At 21 amino acids tertiapin is smaller than most other venom toxins so it might fit between the turrets more effectively, Alternatively, the turrets themselves might form the binding site for tertiapin (67-69). At 57 amino acids δ-dendrotoxin from the green mamba snake is rather large and yet it inhibits Kir1.1 channels (23). Compared to tertiapin less is known about the binding site on the channel for δ-dendrotoxin, but one aspect of its inhibition is intriguing: the blocked state reduces single channel conductance to about 10% rather than inhibiting all the way. δ-dendrotoxin most likely binds to the turrets but is too large to fit tightly over the pore, which would imply that binding to the turret may be sufficient to alter the channel's function.
- The idea that binding to the turrets could alter function is not surprising when one considers that the turret in Kir2.2 is not a loop, but forms a highly ordered structure (
FIG. 5C ). The base of the turret is formed and pinned together by the HGDL sequence, which with only minor variation is found in all eukaryotic Kir channels (FIGS. 1A-1C andFIG. 5D .) H108 stabilizes D110 through a hydrogen bond. The Asp (D) itself is hydrogen bonded to the amide nitrogen of C123, which effectively holds the two ends of the turret together. L111 projects from the surface of a short 310 helix into the protein interior to make stabilizing hydrophobic interactions. Thus, the turrets are structurally important elements of the channel. Between the sequence HGDL and the first Cys of the disulfide bridge the turret sequence is highly variable among Kir channel subtypes. The Kir2.1 channel becomes sensitive to tertiapin if the variable sequence is mutated to be Kir3.4-like (68). Therefore, the turrets appear to be structures through which specific inhibition of Kir channel subtypes might be achievable through directed evolution of specific protein binding partners. - This presents the atomic structure of a eukaryotic Kir channel, Kir2.2, a strong inward rectifier. The sequence TXGYGFR gives rise to a K+ selectivity filter stabilized by disulfide bridges and salt bridges that distinguish eukaryotic Kir channels. Multiple ion binding sites on the intracellular side of the selectivity filter can be occupied by conducting ions but exhibit higher affinity for multivalent blocking ions. Thus, blocking ions entering from the cytoplasm must displace conducting ions through the pore. This situation is expected to give rise to strong voltage-dependent block and diode-like conduction properties. Structural features of the extracellular pore entryway offer an explanation for the relative insensitivity of Kir channels to venomous toxins and a possible approach to the development of selective Kir channel inhibitors,
-
- 1. H. A, Hodgkin A L, Katz B, Archives des Sciences Physiologiques 3, 129 (1949).
- 2. B. Katz, Arch. Sci. Physiol. (Paris) 3, 285 (1949).
- 3. B. Hille, Ion Channels of Excitable Membranes. (Sinauer Associates, Inc., Sunderland, Mass., 2001).
- 4. B. Fakler et al.,
Cell 80, 149 (Jan. 13, 1995). - 5. A. N, Lopatin, E. N. Makhina, C. G. Nichols, Nature 372, 366 (Nov. 24, 1994).
- 6. M. Haile, H. Irisawa, A. Noma, J Physiol 387, 251 (June 1987).
- 7. H. Matsuda, A. Saigusa, H. Irisawa, Nature 325, 156 (Jan. 8-14, 1987).
- 8. C. A. Vandenberg, Proc Natl Acad Sci USA 84, 2560 (April 1987).
- 9. H. T. Kuraia, W. W. Cheng, C. Ambit, P. A. Slesinger, C. G. Nichols, J Gen Physiol 130, 145 (August 2007).
- 10. Y. Fujiwara, Y. Kubo, J Gen Physiol 127, 401 (April 2006).
- 11. S. Pegan et al., Nat Neurosci 8, 279 (March 2005).
- 12. D. Guo, Z. Lu, J Gen Physiol 122, 485 (November 2003).
- 13. Y, Kubo, Y. Murata, J Physiol 531, 645 (Mar. 15, 2001),
- 14. J. Yang, Y. N. Jan, L. Y. Jan, Neuron 14, 1047 (May, 1995).
- 15. M. Taglialatela, E. Ficker, B. A. Wible, A. M. Brown, EMBO J 14, 5532 (Nov. 15, 1995).
- 16. B. A. Wible, M. Taglialatela, E. Ficker, A. M. Brown, Nature 371, 246 (Sep. 15, 1994).
- 17. P. R. Stanfield et al., J Physiol 478 (Pt 1), 1 (Jul. 1, 1994).
- 18. Z. Lu, R. MacKinnon, Nature 371, 243 (Sep. 15, 1994).
- 19. B. Fakler et al., FEBS Lett 356, 199 (Dec. 19, 1994),
- 20. M. Nishida, M. Cadene, B. T. Chait, R. MacKinnon, EMBO J 26, 4005 (Sep. 5, 2007).
- 21. A. Kuo et al.,
Science 300, 1922 (Jun. 20, 2003), - 22. W. Jin, Z. Lu, Biochemistry 37, 13291 (Sep. 22, 1998).
- 23. J. P. Imredy, C. Chen, R. MacKinnon, Biochemistry 37, 14867 (Oct. 20, 1998).
- 24. Z. Lu, R. MacKinnon, Biochemistry 36, 6936 (Jun. 10, 1997).
- 25. A. L. Harvey, B. Robertson, Curr Med Chem 11, 3065 (December 2004).
- 26. K. J. Swartz, R. MacKinnon,
Neuron 15, 941 (October 1995). - 27. M. L. Garcia, M. Hanner, H. G. Knaus, R. Slaughter, G. J. Kaczorowski, Methods Enzymol 294, 624 (1999).
- 28. D. Schulze, T. Krauter, H. Fritzenschaft, M. Soom, T. Baukrowitz, J Biol Chem 278, 10500 (Mar. 21, 2003).
- 29. W. Z. Zeng, H. H. Lieu, U, M. Krishna, J. R. Faick, C. L. Huang, Am J Physiol Renal Physiol 282, F826 (May, 2002).
- 30. C. M. Lopes et al., Neuron 34, 933 (Jun. 13, 2002).
- 31. M. Scorn et at, FEBS Lett 490, 49 (Feb. 9, 2001).
- 32. S. L. Shyng, C. A. Cukras, J. Harwood, C. G. Nichols, J Gen Physiol 116, 599 (November 2000).
- 33. H. Zhang, C. He, X. Yan, T. Mirshahi, D. E. Logothetis,
Nat Cell Biol 1, 183 (July 1999). - 34. C. L. Huang, S. Feng, D. W. Hilgemann, Nature 391, 803 (Feb. 19, 1998).
- 35, Z. Fan, J. C. Makielski, J Biol Chem 272, 5388 (Feb 28, 1997).
- 36. P. R. Stanfield, S. Nakajima, Y. Nakajima, Rev. Physiol Biochem. Pharmacol. 145, 47 (2002).
- 37. N, Takahashi et al., J Biol Chem 269, 23274 (Sep. 16, 1994).
- 38. G. X. Liu et al., J Physiol 532, 115 (Apr. 1, 2001).
- 39. Z. Lu, Annu Rev Physiol 66, 103 (2004).
- 40. C. G. Nichols, A. N. Lopatin, Annu Rev Physiol 59, 171 (1997).
- 41. P. Henry, W. L. Pearson, C. G. Nichols, J Physiol 495 (Pt 3), 681 (Sep. 15, 1996),
- 42. B. Fakler, U. Brandle, E. Glowatzki, H. P. Zenner, J. P. Ruppersberg, Neuron 13, 1413 (December 1994).
- 43. H, C, Cho, R, G. Tsushima, T. T, Nguyen, H. R. Guy, P. H. Backx, Biochemistry 39, 4649 (Apr. 25, 2000).
- 44. M. L. Leyland, C. Dart, P. J. Spencer, M. J. Sutcliffe, P. R. Stanfield, Pflugers Arch 438, 778 (November 1999).
- 45. K. M. Dibb et al., J Biol Chem 278, 49537 (Dec. 5, 2003).
- 46. J. Yang, M. Yu, Y. N. Jan, L. Y. Jan, Proc Natl
Acad Sci USA 94, 1568 (Feb. 18, 1997). - 47. Y. Thou, J. H. Morais-Cabral, A. Kaufman, R. MacKinnon, Nature 414, 43 (Nov. 1, 2001).
- 48. S. B. Long, X. Tao, E. B. Campbell, R. MacKinnon,
Nature 450, 376 (Nov. 15, 2007). - 49. S. B. Long, E, B. Campbell, R. Mackinnon, Science 309, 897 (Aug. 5, 2005).
- 50. Y. Jiang et al., Nature 417, 523 (May 30, 2002).
- 51. S. Pegan, C. Arrabit, P. A, Slesinger, S. Choe, Biochemistry 45, 8599 (Jul. 18, 2006).
- 52. H. G. Shin, Z. Lu, J Gen Physiol 125, 413 (April 2005).
- 53. H. G. Shin, Y. Xu, Z. Lu, J Gen Physiol 126, 123 (August 2005).
- 54. D. Guo, Y. Rarnu, A. M. Klein, Z. Lu, J Gen Physiol 121, 261 (April 2003).
- 55. D. Guo, Z. Lu,
J Gen Physiol 115, 799 (June 2000). - 56. M. Spassova, Z. Lu, J Gen Physiol 112, 211 (August 1998).
- 57. W. L. Pearson, C. G. Nichols, J Gen Physiol 112, 351 (September 1998).
- 58. Y. Thou, R. MacKinnon,
Biochemistry 43, 4978 (May 4, 2004). - 59. A. Cotton, G. Wilkinson, Wiley interscience.
- 60. D. Noble, R. W. Tsien, J Physiol 195, 185 (March 1968).
- 61. C. A. Leech, P. R. Stanfield, J Physiol 319, 295 (1981).
- 62. S. Hagiwara, M. Yoshii, J Physiol 292, 251 (July 1979).
- 63. A. L, Hodgkin, P. Horowicz,
J Physiol 148, 127 (October 1959). - 64. D. Guo, Z. Lu, J Gen Physiol 117, 395 (May, 2001).
- 65. D. Oliver, H. Hahn, C. Antz, J. P. Ruppersberg, B. Faller, Biophys J 74, 2318 (May, 1998).
- 66. M. Spassova, Z. Lu, J Gen Physiol 114, 415 (September 1999).
- 67. J. P. Felix et al., Biochemistry 45, 10129 (Aug. 22, 2006),
- 68. Y. Ramu, A. M. Klem, Z. Lu,
Biochemistry 43, 10701 (Aug. 24, 2004). - 69. W. Jin, A. M. Klem, J. H. Lewis, Z. Lu, Biochemistry 38, 14294 (Oct. 26, 1999).
- 70. The X-ray crystallographic coordinates and structure factor files have been deposited in the Protein Data Bank with accession ID 3JYC.
- A synthetic gene fragment (Bio Basic, Inc) encoding residues 38 to 369 of chicken Kir2.2 channel (GI:118097849) was ligated into the XhoI/EcoRI cloning sites of a modified pPICZ-B vector (Invitrogen). The resulting protein has green fluorescent protein (GFP) and a 1D4 antibody recognition sequence (TETSQVAPA) on the C-terminus (1), separated by a PreScission protease cleavage site (SNSLEVLPQ/GP).
- The construct was linearized using PmeI and transformed into a HIS+ strain of SMD1163 of Pichia pastoris (Invitrogen) by electroporation (BioRad Micropulser). Transformants were selected on YPDS plates containing 400-1200 μg/ml Zeocin (Invitrogen). Resistant colonies were tested for expression by anti-1D4 tag Western Blot. For large-scale expression, small cultures grown from the best expressing colony were diluted into BMGY media (Invitrogen) and inoculated at 29° C. overnight, until OD600 reached between 20-30. Cells were then pelleted, resuspended in BMM media (Invitrogen) and expressed overnight at 24° C. Cells were harvested, flash-frozen in liquid N2, and stored at −80° C. until needed.
- Cells were lysed in a Retsch, Inc. Model MM301 mixer mill (5×3.0 minutes at 25 cps). The lysis buffer contained 150 mM KCl, 50 mM TRIS-HCl pH 8.0, 0.1 mg/ml deoxyribonuclease I, 0.1 μg/ml pepstatin, 1 μl/ml leupeptin, 1 μg/ml aprotinin, 0.1 mg/ml soy trypsin inhibitor, 1 mM benzamidine, 0.1 mg/ml AEBSF, with 1 mM phenylmethysulfonyl fluoride added just before lysis (3.0 ml lysis buffer/g cells). pH of the lysate was adjusted to 8.0 with KOH. The lysate was extracted with 100 mM DM (n-decyl-β-D-maltopyranoside, Anatrace, solgrade) at room temperature for 1 hour with stirring, and then centrifuged for 40 minutes at 30,000 g, 10° C. Supernatant was added to 1D4-affinity resin pre-equilibrated with 150 mM KCl, 50 mM TRIS-HCl pH 8.0, and 4 mM DM. Suspension was layered with Argon and mixed by inversion for 2 hours at room temperature. Beads were collected on a column by gravity, washed with 2 column volumes of buffer (150 mM KCl, 50 mM TRIS-HCl pH 8.0, 1 mM EDTA pH 8.0, and 4 mM DM), and eluted with buffer plus 1 mg/ml 1D4 peptide (AnaSpec, Inc.) over 1 hour at room temperature. 20 mM DTT (Dithiothreitol) and 3 mM TECP were added to eluted protein. The protein was then digested with PreScission protease (20:1 w/w ratio) overnight at 4° C. Concentrated protein was further purified on a Superdex-200 gel filtration column in 150 mM KCl, 20 mM TRIS-HCl pH 8.0, 4 mM DM (anagrade), 3 mM TCEP, 20 mM DTT and 1 mM EDTA at 4° C.
- The fraction corresponding to the tetramer peak was concentrated to about 8 mg/ml, mixed 1:1 with crystallization solution and set up as hanging drops over reservoirs containing 0.1 ml crystallization solution. Crystals appeared in 7-20% PEG400 or 2-10% PEG4000, with 500 mM KCl or NaCl, and 50 mM buffer pH 6.0-9.5 at 4° C. overnight and grew to full size within 2-3 days.
- For studies with RbCl, the protein was purified in a similar fashion except that KCl was replaced with RbCl in all buffer solutions and crystals were grown in 10-20% PEG400, 500 mM RbCl, and 50 mM MES pH 6.5. For studies with 10 mM EuCl3, crystals were grown in 7-20% PEG400, 1 M ammonium formate, 50 mM TRIS-HCl pH 8.5, and 10 mM EuCl3. For studies with 10 mM SrCl2, crystals were grown in 10-20% PEG400, 500 mM NaCl, 50 mM HEPES pH 7.5, and 10 mM SrCl2. For studies with 200 mM SrCl2, crystals were grown in 3-7% PEG4000, 200 mM SrCl2, and 50 mM Na Citrate pH 5.6.
- Crystals were cryo-protected in reservoir plus 25% glycerol (v/v), 4 mM DM, 20 mM DTT, 3 mM TCEP, and 1 mM EDTA in a step-wise manner (5% glycerol increase each step) and flash-frozen in liquid nitrogen. Diffraction data from native crystals were collected to 3.1 Å at beamline 24ID-C (APS) and for crystals in various metal ions (Rb+, Sr+, and Eu3+) at beamline X29 (Brookhaven NSLS). Images were processed with DENZO and intensities merged with SCALEPACK (2). Data were further processed using the CCP4 suite (3). The crystals belong to the 14 space group. The structure was solved by molecular replacement using the program MOLREP (4), with the 2.4 Å resolution structure of the cytoplasmic domain of mouse Kir2.1 (PDB 1U4F) as a search model. There is one copy of the subunit in the asymmetric unit. The model was built using O (5) and refined with CNS (50-3.1 Å) to Rfree=27.2% (6). The final model contains residues 43-60 and 70-369 (
residues 70 to 78 are modeled as alanines) of chicken Kir2.2, three additional residues SNS on the C-terminus corresponding to the PreScission cleavage site, and five K+ ions. During the final minimization refinement step in CNS, occupancies of the K+ ions were set to 0.5 (which gave rise to a lower R free compared to occupancy of 1.0) and B-factors of the K+ ions were set to 85 (roughly the average B-factor of surrounding protein atoms). Crystallographic data and refinement statistics are shown in Table S1. Figures were made using PYMOL (www.pymol.org) (7). - Ion binding was assessed by calculating anomalous difference Fourier maps for data with Eu3+ and Fo-Fc maps for data with Rb+ and Sr2+ using fft in the CCP4 suite (3), Sr2+ was analyzed at two different concentrations to discern whether the weak cavity peak was due to Sr2+. This peak became stronger when Sr2+ was increased from 10 mM to 200 mM while the monovalent cation concentration was decreased, consistent with Sr2+ being present in the cavity but probably at low occupancy. Phases used to calculate Fo-Fc omit maps were derived from a channel model devoid of ions in the cavity or cytoplasmic domain throughout refinement,
- Xenopus oocytes were harvested from mature female Xenopus laevis and defolliculated by collagenase treatment for 1-2 hours. Oocytes were then rinsed thoroughly and stored in ND96 solution (96 mM NaCl, 2 mM KCl, 1.8 mM CaCl2, 1.0 mM MgCl2, 5 mM HEPES, 50 μg/ml gentamycin, pH 7.6 with NaOH). Defolliculated oocytes were selected 2-4 hours after collagenase treatment and injected with cRNA the next day. The injected oocytes were incubated in ND96 solution for 1-5 days before recording. All oocytes were stored in an incubator at 18° C.
- The chicken Kir2.2 (residues 38 to 369) gene was sub-cloned into the pGEM vector (Promega). cRNA was prepared using T7 RNA polymerase (Promega) from NdeI-linearized plasmid DNA.
- All recordings were performed at room temperature. For two-electrode voltage-clamp experiments, oocytes were held at 0 mV and pulsed from −80 mV to +80 mV with 10 mV increment steps. Recording solution contained 98 mM KCl, 0.3 mM CaCl2, 1 mM MgCl2, and 5 mM HEPES pH 7.6. The ionic currents were recorded with an oocyte clamp amplifier (OC-725C, Warner Instrument Corp.). The recorded signal was filtered at 1 kHz and sampled at 10 kHz using an analogue-to-digital converter (Digidata 1440A, Axon Instruments, Inc) interfaced with a computer. pClamp10.1 software (Axon Instruments, Inc) was used for controlling the amplifier and data acquisition. For patch-clamp experiments, each oocyte was incubated in a hypertonic solution containing 200 mM NaCl, 130 mM KCl, 5 mM K2EDTA, 5 mM K2HPO4, 5 mM KH2PO4 pH 7.2 for 5-10 minutes and the vitelline membrane was removed before seal formation. Currents were recorded in either cell-attached or inside-out configuration with an Axopatch 200B amplifier, Digidata 1440A analogue-to-digital converter and pClamp10.1 software to control membrane voltage and record. During the current recordings, the membrane was first held at 0 mV followed by a 10-second voltage ramp from +80 mV to −80 mV .The pipette solution contained 140 mM KCl, 5 mM K2HPO4, 5 mM KH2PO4, 0.3 mM CaCl2, 1 mM MgCl2, pH 7.2 with KOH. The bath solution contained 130 mM KCl, 5 mM K2EDTA, 5 mM K2HPO4, 5 mM KH2PO4, pH 7.2 with KOH.
- For the single channel I-V curve shown in Figure S1D inset, each data point represents the current difference at a given voltage associated with the opening of a single channel.
-
- 1. J. P. Wong, E. Reboul, R. S. Molday, J. Kast, J Proteome Res 8, 2388 (May, 2009).
- 2. Z. Otwinowski, W. Minor, Methods Enzymol. 276, 307 (1997).
- 3. N. Collaborative Computational Project, Acta Cryst. D50, 60 (1994).
- 4. A. Vagin, A. Teplyakov, Acta Crystallogr. D. Biol. Crystallogr. 56 Pt 12:1622-4., 1622 (2000).
- 5. T. A. Jones, J. Y. Zola, S. W. Cowan, M. Kjeldgaard, Acta Cryst. A47, 110 (1991).
- 6. A. T. Brunger et al., Acta Cryst. D54, 905 (1998).
- 7. W. L. DeLano, DeLano Scientific, Palo Alto, Calif., USA. http://www.pymol.org, (2002).
- The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
- It is further to be understood that all values are approximate, and are provided for description.
- All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference.
-
TABLE S1 Crystallographic data and refinement statistics Data Collection Data set Native Rb+ (650 mM) Sr2+ (10 mM) Sr2+ (200 mM) Eu3+ (10 mM) Space group I4 I4 I4 I4 I4 Lattice constants (Å) a = b = 84.018, a = b = 82.714, a = b = 82.806, a = b = 83.268, a = b = 84.221, c = 196.121 c =196.142 c = 195.605 c = 197.143 c = 195.915 α = β = γ = 90° α = β = γ = 90° α = β = γ = 90° α = β = γ = 90° α = β = γ = 90° Source APS 24ID-C BNL X29 BNL X29 BNL X29 BNL X29 Wavelength (Å) 0.97949 1.0809 1.0809 1.0809 1.5222 Resolution (Å) 50-3.1 50-4.0 50-3.3 50-3.8 50-6.0 Total/unique observations 65,452/12,153 25,333/5,231 60,844/9,910 31,462/6,571 5,649/1,517 I/sigma (I) a 33.1 (23) 20.0 (1.8) 24.3 (2.4) 20.8 (2.7) 24.7 (1.6) Redundancy a 5.4 (4.6) 4.8 (4.3) 6.1 (5.9) 4.8 (4.7) 3.7 (1.4) Completeness (%) a 99.7 (99.9) 93.3 (83.8) 99.8 (100.0) 99.7 (100.0) 87.9 (49.4) Rsym (%) a,b 6.8 (73.6) 10.1 (78.3) 11.5 (89.4) 9.6 (69.3) 7.0 (35.7) Model refinement Resolution (Å) 50-3.1 50-4.0 50-3.3 50-3.8 50-6.0 Number of reflections 12,122 (609) 5,221 (272) 9,895 (504) 6,569 (346) 1,517 (76) Rwork/Rfree 24.4/27.2 29.6/35.0 24.9/28.6 25.8/30.4 36.5/39.9 R.m.s. deviation of bond length (Å) 0.010 R.m.s. deviation of bond angles (°) 1.59 Protein atoms/K+ ions 2.530/5 Mean B value 112.1 Ramachandran plot c 76.0/21.9/2.1 R.m.s., root mean-squared. a Number in the parentheses represents statistics for data in the highest resolution shell. b Rsym = Σ|Ii − <Ii>|/ΣIi, where <Ii> is the average intensity of symmetry equivalent reflections. c The three numbers represent the percentage of residues in most favored/additionally allowed/generously allowed regions.
-
SEQUENCES: 1. human Kir 1.1- variable portion of turret region PEFHPSANHTP 2. human Kir 1.2- variable portion of turret region LELDPPANHTP 3. human Kir 2.1- variable portion of turret region DASKEGKA 4. human Kir 2.2- variable portion of turret region EPAEGRGRTP 5. human Kir 2.3- variable portion of turret region EASPGVPAAGGPAAGGGGAAPVAPKP 6. human Kir 2.4- variable portion of turret region AAPPPPAP 7. human Kir 3.1- variable portion of turret region NKAHVGNYTP 8. human Kir 3.4- variable portion of turret region DHVGDQEWIP 9. human Kir 6.1- variable portion of turret region YAYMEKSGMEKSGLESTV 10. human Kir 6.2- variable portion of turret region APSEGTAEP 11. human Kir 7.1- variable portion of turret region ELDHDAPPENHTI 12. chicken Kir 2.1- variable portion of turret region ENQENNKP 13. chicken Kir 2.2- variable portion of turret region ENPGGDDTFKP 14. human Kir 1.1- amino acid sequence 1 MNASSRNVFD TLIRVLTESM FKHLRKWVVT REFGHSRQRA RLVSKDGRCN IEFGNVEAQS 61 RFIFFVDIWT TVLDLKWRYK MTIFITAFLG SWEFFGLLWY AVAYIHKDLP EFHPSANHTP 121 CVENINGLTS AFLFSLETQV TIGYGFRCVT EQCATAIFLL IFQSILGVII NSFMCGAILA 181 KISRPKKRAK TITFSKNAVI SKRGGKLCLL IRVANLRKSL LIGSHIYGKL LKTTVTPEGE 241 TIILDQININ FVVDAGNENL FFISPLTIYH VIDHNSPFFH MAAETLLQQD FELVVFLDGT 301 VESTSATCQV RTSYVPEEVL WGYRFAPLVS KTKEGKYRVD FHNFSKTVEV ETPHCAMCLY 361 NEKDVRARMK RGYDNPNFIL SEVNETDDTK M 15. human Kir 1.2- amino acid sequence 1 MTSVAKVYYS QTTQTESRPL MGPGIRRRRV LTKDGRSNVR MEHIADKRFL YLKDLWTTFI 61 DMQWRYKLLL FSATFAGTWF LFGVVWYLVA VAHGDLLELD PPANHTPCVV QVHTLTGAFL 121 FSLESQTTIG YGFRYISEEC PLAIVLLIAQ LVLTTILEIF ITGTFLAKIA RPKKRAETIR 181 FSQHAVVASH NGKFCLMIRV ANMRKSLLIG CQVTGKLLQT HQTKEGENIR LNQVNVTFQV 241 DTASDSPFLI LPLTFYHVVD ETSPLKDLPL RSGEGDFELV LILSGTVEST SATCQVRTSY 301 LPEEILWGYE FTPAISLSAS GKYIADFSLF DQVVKVASPS GLRDSTVRYG DPEKLKLEES 361 LREQAEKEGS ALSVRISNV 16. human Kir 2.1- amino acid sequence 1 MGSVRTNRYS IVSSEEDGMK LATMAVANGF GNGKSKVHTR QQCRSRFVKK DGHCNVQFIN 61 VGEKGQRYLA DTFTTCVDIR WRWMLVIFCL AFVLSWLFFG CVFWLIALLH GDLDASKFGK 121 ACVSEVNSFT AAFLFSIETQ TTIGYGFRCV TDECPIAVFM VVFQSIVGCI IDAFIIGAVM 181 AKMAKPKKRN ETLVFSHNAV IAMRDGKLCL MWRVGNLRKS HLVEAHVRAQ LLKSRITSEG 241 EYIPLDQIDI NVGFDSGIDR IFLVSPITIV HEIDED5PLY DLSKQDIDNA DFEIVVILEG 301 MVEATAMITQ CRSSYLANEI LVGHRYEPVL FEEKHYYKVD YSRFHKTYEV PNTPLCSARD 361 LAEKKYILSN ANSFCYENEV ALTSKEEDDS ENGVPESTST DTPPDIDLHN QASVPLEPRP 421 LRRESEI 17. human Kir 2.2- amino acid sequence 1 MTAASRANPY SIVSSEEDGL HLVTMSGANG FGNGKVHTRR RCRNRFVKKN GQCNIEFANM 61 DEKSQRYLAD MFTTCVDIRW RYMLLIFSLA FLASWLLEGI IFWVIAVAHG DLEPAEGRGR 121 TPCVMQVHGE MAAFLPSIET QTTIGYGLRC VTEECPVAVF MVVAQSIVGC IIDSFMIGAI 181 MAKMARPKKR AQTLLFSHNA VVALRDGKLC LMWRVGNLRK SHIVEAHVRA QLIKPRVTEE 241 GEYIPLDQID IDVGFDKGLD RIFLVSPITI LHEIDEASPL FGISRQDLET DDFEIVVILE 301 GMVEATAMTT QARSSYLANE ILWGHRFEPV LFEEKNQYKI DYSHFHKTYE VPSTPRCSAX 361 DLVENKFLLP SANSFCYENE LAFLSRDEED EADGDQDGRS RDGLSPQARH DFDRLQAGGG 421 VLEQRPYRRE SEI 18. human Kir 2.3- amino acid sequence 1 MHGHSRNGQA HVPRRKRRNR FVKKNGQCNV YFANLSNKSQ RYMADIFTTC VDTRWRYMLM 61 IFSAAFLVSW LFFGLLFWCI AFFHGDLEAS PGVPAAGGPA AGGGGAAPVA PKPCIMHVNG 121 FLCAFLFSVE TQTTIGYGFR CVTEECPLAV IAVVVQSIVG CVIDSFMIGT IMAKMARPKK 181 RAQTLLFSHH AVISVRDGKL CLMWRVGNLR KSHIVEAHVR AQLIKPYMTQ EGEYLPLDQR 241 DLNVGYDIGL DRIFLVSPII IVHEIDEDSP LYGMGKEELE SEDFEIVVIL EGMVEATAMT 301 TQARSSYLAS EILWGHRFEP VVFEEKSHYK VDYSRFHKTY EVAGTPCCSA RELQESKITV 361 LPAPPPPPSA FCYENELALM SQEEEEMEEE AAAAAAVAAG LGLEAGSKEE AGIIRMLEFG 421 SHLDLERMQA SLPLDNISYR RESAI 19. human Kir 2.4- sequence 1 MGLARALRRL SGALDSGDSR AGDEEEAGPG LCRNGWAPAP VQSPVGRRRG RFVKKDGHCN 61 VREVNLGGQG ARYLSDLFTT CVDVRWRWMC LLFSCSFLAS WLLFGLAFWL IASLHGDLAA 121 PPPPAPCFSH VASFLAAFLF ALETQTSIGY GVRSVTEECP AAVAAVVLQC IAGCVLDAFV 181 VGAVMAXMAK PKKRNEILVF SENAVVALRD HRLCLMWRVG NLRRSHLVEA HVRAQLLQPR 241 VTPEGEYIPL DHQDVDVGFD GGTDRIFLVS PITIVHEIDS ASPLYELGRA ELARADFELV 301 VILEGMVEAT AMTTQCRSSY LPGELLWGHR FEPVLFQRGS QYEVDYRHFH RTYEVPGTPV 361 CSAKELDERA EQASHSLKSS FPGSLTAFCY ENELALSCCQ EEDEDDETEE GNGVETEDGA 421 ASPRVLTPTL ALTLPP 20. human Kir 3.1- amino acid sequence 1 MSALRRKFGD DYQVVTTSSS GSGLQPQGPG QDPQQQLVPK KKRQRFVDKN GRCNVQHGNL 61 GSETSRYLSD LFTTLVDLKW RWNLFIFILT YTVAWLFMAS MNWVIAYTRG DLNKAHVGNY 121 TPCVANVYNF PSAFLEFIET EATIGYGYRY ITDKCPEGII LFLFQSILGS IVDAFLIGCM 181 FIKMSQPKKR AETLMFSEHA VISMRDGKLT LMERVGNERN SHMVSAQIRC KLLKSRQTPE 241 GEFLPLDQLE LDVGFSTGAD QLFLVSPLTI CHVIDAKSPF YDLSQRSMQT EQFEIVVILE 301 GIVETTGMTC QARTSYTEDE VLWGHRFFPV ISLEEGFFKV DYSQFHATFE VPTPPYSVKE 361 QEEMLLMSSP LIAPAITNSK ERHNSVECLD GLDDITITLP SKLQKITGRE DFPKKLLRMS 421 STTSEKAYSL GDLPMKLQRI SSVPGNSEEK LVSKTTKMLS DPMSQSVADL PPKLQKMAGG 481 AARMEGNLPA KLRKMNSDRF T 21. human Kir 3.4- amino acid sequence 1 MAGDSRNAMN QDKEIGVTPW DPKKIPKQAR DYVPIATDRT RLLAEGKKPR QRYNEKSGKC 61 NVHHGNVQET YRYLSDLFTT LVDLKWRFNL LVFTMVYTVT WLFEGFIWWL IAYIRGDLDH 121 VGDQEWIPCV ENLSGFVSAF LFSIETETTI GYGFRVITEK CPEGIILLLV QAILGSIVNA 181 FMVGCMFVKI SQPKKRAETL MESNNAVISM RDEKLCLMFR VGDLRNSHIV EASIRAKLIK 241 SRQTKEGEFI PLNQTDINVG FDTGDDRLFL VSPLIISHEI NQKSPFWEMS QAQLHQEEFE 301 VVVILEGMVE ATGMTCQARS SYMDTEVLWG HRFTPVLTLE KGFYEVDYNT FHDTYETNTP 361 SCCAKELAEM KREGRLLQYL PSPPLLGGCA EAGLDAEAEQ NEEDEPKGLG GSREARGSV 22. human Kir 4.1- amino acid sequence 1 MTSVARVYYS QTTQTESRPL MGPGIRRRRV LTKDGRSNVR MEHIADKRFL YLKDLWTTFI 61 DMQWRYKLLL FSATFAGTWF LFGVVWYLVA VAHGDLLELD PPANHTPCVV QVHTLTGAFL 121 FSLESQTTIG YGFRYISEEC PLAIVLLIAQ LVLTTILEIF ITGTFLAKIA RPKKRAETIR 181 FSQHAVVASH NGKPCLMIRV ANMRKSLLIG CQVTGKLLQT HQTKEGENIR LNQVNVTFQV 241 DTASDSPFLI LPLTFYHVVD ETSPLKDLPL RSGEGDFELV LILSGTVEST SATCQVRTSY 301 LPEEILWGYE FTPAISLSAS GKYIADFSLF DQVVKVASPS GLRDSTVRYG DPEKLKLEES 361 LREQAEKEGS ALSVRISNV 23. human Kir 4.2- amino acid sequence 1 MDAIHIGMSS TPLVKHTAGA GLKANRPRVM SKSGHSNVRI DKVDGIYLLY LQDLWTTVID 61 NKWRYKLTLF AATFVMTWFL FGVIYYAIAF IHGDLEPGEP ISNHTPCINE VDSLTGAFLF 121 SLESQTTIGY GVRSITEECP HAIFILVAQL VITTLIEIFI TGTFLAKIAR PKKRAETIKF 181 SHCAVITXQN GKLCLVIQVA NMRKSLLIQC QLSGKLLQTH VTKEGERILL NQATVKFHVD 241 SSSESPFLIL PMTFYHVLDE TSPLRDLTPQ NLKEKEFELV VLLNATVEST SAVCQSRTSY 301 IPEEIYWGFE FVPVVSLSKN GKYVADFSQF EQIRKSPDCT FYCADSEKQQ LEEKYRQEDQ 361 RERELRTLLL QQSNV 24. human Kir 5.1- amino acid sequence 1 MSYYGSSYHI INADAKYPGY PPEHIIAEKR RARRRLLHKD GSCNVYFKHI FGEWGSYVVD 61 IFTTLVDTKW RHMEVIFSLS YILSWLIFGS VFWLIAFHHG OLLNDPDITP CVDNVHSFTG 121 AFLFSLETQT TIGYGYRCVT EECSVAVLMV ILQSILSCII NTFIIGAALA KMATARKRAQ 181 TIRESYFALI GMRDGKLCLM WRIGDFRPNH VVEGTVRAQL LRYTEDSEGR MTMAFKDLKL 241 VNDQIILVTP VTIVHEIDHE SPLYALDRKA VAKDNFEILV TFIYTGDSTG TSHQSRSSYV 301 PREILWOHRF NOVLEVKRKY YKVNCLQFEG SVEVYAPFCS AKQLDWKDQQ LHIEKAPPVR 361 ESCTSDTKAR RRSFSAVAIV SSCENPEETT TSATHEYRET PYQKALLTLN RISVESQM 25. human Kir 6.1- amino acid sequence 1 MLARKSIIPE EYVLARIAAE NLRKPRIRDR LPKARFIAKS GACNLAHKNI REQGRFLQDI 61 FTTLVDLKWR HTLVIFTMSF LCSWLLFAIM WWLVAFAHGD IYAYMEKSGM EKSGLFSTVC 121 VTNVRSFTSA FLFSIEVQVT IGFGGRMMTE ECPLAITVLI LQNIVGLIIN AVMLGCIFMK 181 TAQAHRRAET LIFSRHAVIA VRNGKLCFMF RVGDLRKSMI ISASVRIQVV KKTTTPEGEV 241 VPIHQLDIPV DNPIESNNIF LVAPLIICHV IDKRSPLYDI SATDLANQDL EVIVILEGVV 301 ETTGITTQAR TSYIAEEIQW GHRFVSIVTE EEGVYSVDYS KFGNTVKVAA PRCSARELDE 361 KPSILIQTLQ KSELSHQNSL RKRNSMRRNN SMRRNNSIRR NNSSLMVPKV QFMTPEGNQN 421 TSES 26. human Kir 6.2- amino acid sequence 1 MLSRKGIIPE EYVLTRLAED PAKPRYRARQ RRARFVSKKG NCNVAHKNIR EQGRFLQDVF 61 TTLVDLKWPH TLLIFTMSFL CSWLLFAMAW WLEAFAHGDL APSEGTAEPC VTSIHSFSSA 121 FLFSIEVQVT IGFGGRMVTE ECPLAILILI VQNIVGLMIN AIMLGCIFMK TAQAHRRAET 181 LIFSKHAVIA LRHGRLCFML RVGDLRKSMI ISATIHMQVV RKTTSPEGEV VPLHQVDIPM 241 ENGVGGNSIF LVAPLIIYHV IDANSPLYDL APSDLHHHQD LEIIVILEGV VETTGITTQA 301 RTSYLADEIL WGQRFVPIVA EEDGRYSVDY SKFGNTVKVP TPLCTARQLD EDHSLLEALT 361 LASARGPLRK RSVPMAKAKP KFSISPDSLS 27. human Kir 7.1- amino acid sequence 1 mdssnckvia pllsgryrrm vtkdghstlq mdgagrglay lrdawgilmd mrwrwmmlvf 61 sasfvvhwlv favlwyvlae mngdleldhd appenhticv kyitsftaaf sfsletqlti 121 gygtmfpsgd cpsaiallai gmllglmlea fitgafvaki arpknrafsi rftdtavvah 181 mdgkpnlifq vantrpsplt svrvsavlyq erengklygt svdfhldgis sdecpffifp 241 ltyyhsitps sp1atllghe npshfelvvf lsamgegtge icgrrtsylp seimlhhcfa 301 slltrgskge ygikmenfdk typefptply skspnrtdld ihinggsidn fqisetglte 28. chicken Kir 2.1- amino acid sequence 1 MGSVRTNRYS IVSSEEDGMK LATMAVANGF GNGKSKVHTR QQCRSRFVXK DGHCNVQFIN 61 VGEKGQRYLA DIFTTCVDIR WRWMLVIFCL TEILSWLFFG CVFWLIALLH GDLENQENNK 121 PCVSQVSSFT AAFLFSIETQ TTIGYGFRCV TDECPIAVFM VVFQSIVGCI IDAFIIGAVM 181 AKMAKPKKRN ETLVFSHNAV VAMRDGKLCL MWRVGNLRKS HLVEAHVRAQ LLKSRITSEG 241 EYIPLDEIDI NVGFDSGIDR IFLVSPITIV HEIDEDSPLY DLSKQDMDNA DFEIVVILEG 301 MVEATAMTTQ CRSSYLANEI LWGHRYEPVL FEEKNYYKVD YSRFHKTYEV PNTPICSARD 361 LAEKKYILSN ANSFCYENEV ALTSKEEDEI DTGVPESTST DTHPDMDHHN QAGVPLEPRP 421 LRRESEI 29. chicken Kir 2.2- amino acid sequence 1 mtagrvnpys ivsseedglr lttmpgingf gngkihtrrk crnrfvkkng qcnveftnmd 61 dkpqryiadm fttcvdirwr ymlllfslaf lvswllfgli fwlialihgd lenpggddtf 121 kpcvlqvngf vaallfsiet qttigygfrc vteecplavf mvvvqsivgc iidsfmigai 181 makmarpkkr aqtllfshna vvamrdgklc lmwrvgnlrk shiveahvra qlikpritee 241 geyipldgid idvgfdkgld riflvspiti lheinedspl fgisrqdlet ddfeivvile 301 gmveatamtt qarssylase ilwghrfepv lfeeknqykv dyshfhktye vpstprcsak 361 dlvenkfllp stnsfcyene lafmsrdede edddsrgldd lspdnrhefd rlqatialdq 421 rsyrresei 30. human Kir 1.1- cDNA 1 atgaatgctt ccagtcggaa tgtgtttgac acgttgatca gggtgttgac agaaagtatg 61 ttcaaacatc ttcggaaatg ggtcgtcact cgcttttttg ggcattctcg gcaaagagca 121 aggctagtct ccaaagatgg aaggtgcaac atagaatttg gcaatgtgga ggcacagtca 181 aggtttatat tctttgtgga catctggaca acggtacttg acctcaagtg gagatacaaa 241 atgaccattt tcatcacagc cttcttgggg agttggtttt tctttggtct cctgtggtat 301 gcagtagcgt acattcacaa agacctcccg gaattccatc cttctgccaa tcacactccc 361 tgtgtggaga atattaatgg cttgacctca gcttttctgt tttctctgga gactcaagtg 421 accattggat atggattcag gtgtgtgaca gaacagtgtg ccactgccat ttttctgctt 481 atctttcagt ctatacttgg agttataatc aattctttca tgtgtggggc catcttagcc 541 aagatctcca ggcccaaaaa acgtgccaag accattacgt tcagcaagaa cgcagtgatc 601 agcaaacggg gagggaagct ttgcctccta atccgagcgg ctaatctcag gaagagcctt 661 cttattggca gtcacattta tggaaagctt ctgaagacca cagtcactcc tgaaggagag 721 accattattt tggaccagat caatatcaac tttgtagttg acgctgggaa tgaaaattta 781 ttcttcatct ccccattgac aatttaccat gtcattgatc acaacagccc tttcttccac 841 atggcagcgg agacccttct ccagcaggac tttgaattag tggtgttttt agatggcaca 901 gtggagtcca ccagtgctac ctgccaagtc cggacatcct atgtcccaga ggaggtgctt 961 tggggctacc gttttgctcc catagtatcc aagacaaagg aagggaaata ccgagtggat 1021 ttccataact ttagcaagac agtggaagtg gagacccctc actgtgccat gtgcctttat 1081 aatgagaaag atgttagagc caggatgaag agaggctatg acaaccccaa cttcatcttg 1141 tcagaagtca atgaaacaga tgacaccaaa atgtaa 31. human Kir 1.2- cDNA 1 cttttctgat cccagctccg ggtttaagag tcctggcacg gcccgtcgca cagctctgct 61 cctaactcct gcccgccccg tccgtccatc tgtcccgctg ccccgcggcc catccaaggg 121 gccactccac ctcggaccca agatgacgtc agttgccaag gtgtattaca gtcagaccac 181 tcagacagaa agccggcccc taatgggccc agggatacga cggcggagag tcctgacaaa 241 agatggtcgc agcaacgtga gaatggagca cattgccgac aagcgcttcc tctacctcaa 301 ggacctgtgg acaaccttca ttgacatgca gtggcgctac aagcttctgc tcttctctgc 361 gacctttgca ggcacatggt tcctctttgt cgtggtgtgg tatctggtag ctgtggcaca 421 tggggacctg ctggagctgg accccccggc caaccacacc ccctgtgtgg tacaggtgca 481 cacactcact ggagccttcc tcttctccct tgaatcccaa accaccattg gctatggctt 541 ccgctacatc agtgaggaat gtccactagc cattgtgctt cttattgccc agctggtgct 601 caccaccatc ctggaaatct tcatcacagg taccttcctg gcgaagattg cccggcccaa 661 gaagcgggct gagaccattc gtttcagcca gcatgcagtt gtggcctccc acaatggcaa 721 gccctgcctc atgatccgag ttgccaatat gcgcaaaagc ctcctcattg gctgccaggt 781 gacaggaaaa ctgcttcaga cccaccaaac caaggaaggg gagaacaccc ggctcaacca 841 ggtcaatgtg actttccaag tagacacagc ccctgacagc cccttcctta ttctacccct 901 taccttctat catgtggtag atgagaccag tcccttgaaa gatctccctc ttcgcagcgg 961 tgagggtgac tttgagctgg tgctgatcct aagtgggaca gtggagtcca ccagtgccac 1021 ctgtcaggtg cgcacttcct acctgccaga ggagatcctt tggggctacg agttcacacc 1081 tgccatctca ctgtcagcca gtggtaaata catagctgac tttagccttt ttgaccaagt 1141 tgtgaaagtg gcctctccta gtggcctccg tgacagcact gtacgctacg gagaccctga 1201 aaagctcaag ttggaggagt cattaaggga gcaagctgag aaggagggca gtgcccttag 1261 tgtgcgcatc agcaatgtct ga 32. human Kir 2.1- cDNA 1 atgggcagtg tgcgaaccaa ccgctacagc atcgtctctt cagaagaaga cggtatgaag 61 ttggccacca tggcagttgc aaatggcttt gggaacggga agagtaaagt ccacacccga 121 caacagtgca ggagccgctt tgtgaagaaa gatggccact gtaatgttca gttcatcaat 181 gtgggtgaga aggggcaacg gtacctcgca gacatcttca ccacgtgtgt ggacattcgc 241 tggcggtgga tgctggttat cttctgcctg gctttcgtcc tgtcatggct gttttttggc 301 Lgtgtgcttt ggttgatagc tctgctccat ggggacctgg atgcatccaa agagggcaaa 361 gcttgtgtgt ccgaggtcaa cagcttcacg gctgccttcc tcttctccat tgagacccag 421 acaaccatag gctatggttt cagatgtgtc acggatgaat gcccaattgc tgttttcatg 481 gtggtgttcc agtcaatcgt gggctgcatc atcgatgctt tcatcattgg cgcagtcatg 541 gccaagatgg caaagccaaa gaagagaaac gagactcttg tcttcagtca caatgccgtg 601 attgccatga gagacggcaa gctgtgtttg atgtggcgag tgggcaatct tcggaaaagc 661 cacttggtgg aagctcatgt tcgagcacag ctcctcaaat ccagaattac ttctgaaggg 721 gagtatatcc ctctggatca aatagacatc aatgttgggt ttgagagcgg aatcgatcgt 781 atatttctgg tgtccccaat cactatagtc catgaaatag atgaagacag tcctttatat 841 gatttgagta aacaggacat tgacaacgca gactttgaaa tcgtggtcat actggaaggc 901 atggtggaag ccactgccat gacgacacag tgccgtagct cttatctagc aaatgaaatc 961 ctgtggggcc accgctatga gcctgtgctc tttgaagaga agcactacta caaagtggac 1021 tattccaggt tccacaaaac ttacgaagtc cccaacactc ccctttgtag tgccagagac 1081 ttagcagaaa agaaatatat cctctcaaat gcaaattcat tttgctatga aaatgaagtt 1141 gccctcacaa gcaaagagga agacgacagt gaaaatggag ttccagaaag cactagtacg 1201 gacacgcccc ctgacataga ccttcacaac caggcaagtg tacctctaga gcccaggccc 1261 ttacggcgag agtcggagat atga 33. human Kir 2.2- cDNA 1 atgaccgcgg ccagccgggc caacccctac agcatcgtgt catcggagga ggacgggctg 61 cacctggtca ccatgtcggg cgccaacggc ttcggcaacg gcaaggtgca cacgcgccgc 121 aggtgccgca accgcttcgt caagaagaat ggccagtgca acattgagtt cgccaacatg 181 gacgagaagt cacagcgcta cctggctgac atgtccacca cctgtgcgga catccgctgg 241 cggtacatgc tgctcatctt ctcgctggcc ttccttgcct cctggctgct gttcggcatc 301 atcttctggg tcatcgcggt ggcacacggt gacctggagc cggctgaggg ccggggccgc 361 acaccctgtg tgatgcaggt gcacggcttc atggcggcct tcctcttctc catcgagacg 421 cagaccacca tcggctacgg gctgcgctgt gtgacggagg agtgcccggt ggccgtcttc 481 atggtggtgg cccagtccat cgtgggctgc atcatcgact cctccatgat tggtgccatc 541 atggccaaga tggcaaggcc caagaagcgg gcacagacgc tgctgttgag ccacaacgcc 601 gtggtggccc tgcgtgacgg caagctctgc ctcatgtggc gtgtgggtaa cctgcgcaag 661 agccacattg tggaggccca tgtgcgcgcg cagctcatca agccgcgggt caccgaggag 721 ggcgagtaca tcccgctgga ccagatcgac atcgatgtgg gcttcgacaa gggcctggac 781 cgcatctttc tggtgtcgcc catcaccatc ttgcatgaga ttgacgaggc caggccgctc 841 ttcggcatca gccggcagga cctggagacg gacgactttg agatcgtggt catcctggaa 901 ggcatggtgg aggccacagc catgaccacc caggcccgca gctcctacct ggccaatgag 961 atcttctggg gtcaccgctt tgagcccgtg ctcttcgagg agaagaacca gtacaagatt 1021 gactactcgc acttccacaa gacctatgag gtgccctcta cgccccgctg cagtgcgaag 1081 gatctggtag agaacaagtt cctgctgccc agcgccaact ccttctgcta cgagaacgag 1141 ctggccttcc tgagccgtga cgaggaggat gaggcggacg gagaccagga cggccgaagc 1201 cgggacggcc tcagccccca ggccaggcat gactttgaca gactccaggc tggcggcggg 1261 gacctggagc agcggcccta cagacgggag tcagagatct ga 34. human Kir 2.3- cDNA 1 atgcacggac acagccgcaa cggccaggcc cacgtgcccc ggcggaagcg ccgcaaccgc 61 ttcgtcaaga agaacggcca atgcaacgtg tacttcgcca acctgagcaa caagtcgcag 121 cgctacatgg cggacatctt caccacctgc gtggacacgc gctggcgcta catgctcatg 181 atcttctccg cggccttcct tgtctcctgg ctctttttcg gcctcctctt ctggtgtatc 241 gccttcttcc acggtgacct ggaggccagc ccaggggtgc ctgcggcggg gggcccggcg 301 gcgggtggtg gcggaggagc cccggtggcc cccaagccct gcatcatgca cgtgaacggc 361 ttcctgggtg ccttcctgtt ctcggtggag acgcagacga ccatcggcta tgggttccgg 421 tgcgtgacag aggagtgccc gctggcagtc atcgctgtgg tggtccagtc catcgtgggc 481 tgcgtcatcg actccttcat gattggcacc atcatggcca agatggcgcg gcccaagaag 541 cgggcgcaga cgttgctgtt cagccaccac gcggtcattt cggtgcgcga cggcaagctc 601 tgcctcatgt ggcgcgtggg caacctgcgc aagagccaca ttgtggaggc ccacgtgcgg 661 gcccagctca tcaagccata catgacccag gagggcgagt acctgcccct ggaccagcgg 721 gacctcaacg tgggctatga catcggcctg gaccgcatct tcctggtgtc gcccatcatc 781 attgtccacg agatcgacga ggacagcccg ctttatggca tgggcaagga ggagctggag 841 tcggaggact ttgagatcgt ggtcatcctg gagggcatgg tggaggccac ggccatgacc 901 acccaggccc gcagctccta cctggccagc gagatcctgt ggggccaccg ctttgagcct 961 gtggtcttcg aggagaagag ccactacaag gtggactact cacgttttca caagacctac 1021 gaggtggccg gcacgccctg ctgctcggcc cgggagctgc aggagagtaa gatcaccgtg 1081 ctgcccgccc caccgccccc tcccagtgcc ttctgctacg agaacgagct ggcccttatg 1141 agccaggagg aagaggagat ggaggaggag gcagctgcgg cggccgcggt ggccgcaggc 1201 ctgggcctgg aggcgggttc caaggaggag gcgggcatca tccggatgct ggagttcggc 1261 agccacctgg acctggagcg catgcaggct tccctcccgc tggacaacat ctcctaccgc 1321 agggagtctg ccatctga 35. human Kir 2.4- cDNA 1 atgggcctgg ccagggccct acgccgcctc agcggcgccc tggattcggg agacagccgg 61 gcgggcgatg aagaggaggc cgggcccggg ttgtgccgca acgggtgggc gccggcaccg 121 gtgcagtcac ccgtgggccg gcgccgcggt cgcttcgtca agaaagacgg gcactgcaac 181 gtgcgtttcg taaacctggg tggccagggc gcgcgctacc tgagcgacct gttcaccaca 241 tgcgtggacg tgcgctggcg ctggatgtgc ctgctcttct cctgctcctt cctcgcctcc 301 tggctgctct tcggcctggc cttctggctc attgcctcgc tgcacggcga cctggccgcc 361 ccgccaccgc ccgcgccctg cttctcacac gtggccagct tcctggccgc cttcctcttc 421 gcgctggaga cgcagacgtc catcggctac ggcgtgcgca gcgtcaccga ggagtgcccg 481 gccgctgtgg ccgccgtggt gctgcagtgc attgccggct gcgtgctcga cgccttcgtc 541 gtgggtgctg tcatggccaa gatggccaaa cccaagaagc gcaacgagac gctggtcttc 601 agcgagaacg ccgtcgtggc gctgcgcgac caccgcctct gcctcatgtg gcgcgtcggc 661 aacctgcgcc gcagccacct ggtcgagacc cacgtgcgtg cccagctgct gcagccccgt 721 gtgaccccag agggtgagta catcccgctg gaccaccagg atgtggatgt gggctttgat 781 ggaggcaccg atcgtatctt cctcgtgtcc cccatcacca tcgtccatga gatcgactct 841 gccagtcctc tgtatgagct aggacgtgcc gagctggcca gggctgactt tgagctggtg 901 gtcattctcg aggggatggt tgaggccaca gccatgacca cacagtgtcg ctcgtcctac 961 ctccctggtg aactgctctg gggccatcgt tttgagccag ttctcttcca gcgtggctcc 1021 cagtatgagg tcgactatcg ccacttccat cgcacttatg aggtcccagg gacaccggtc 1081 tgcagtgcta aggagctgga tgaacgggca gagcaggctt cccacagcct caagtctagt 1141 ttccccggct ctctgactgc attttgttat gagaatgaac ttgctctgag ctgctgccag 1201 gaggaagatg aggacgatga gactgaggaa gggaatgggg tggaaacaga agatggggct 1261 gctagccccc gagttctcac accaaccctg gcgctgaccc tgcctccatg a 36. human Kir 3.1- cDNA 1 atgtctgcac tccgaaggaa atttggggac gattatcagg tagtgaccac atcgtccagc 61 ggctcgggct tgcagcccca ggggccaggc caggaccctc aggaggagct tgtgcccaag 121 aagaagcggc agcggttcgt ggacaagaac ggccggtgca atgtacagca cggcaacctg 181 ggcagcgaga caagccgcta cctctcggac ctcttcacca cgctggtgga cctcaagtgg 241 cgctggaacc tcttcatctt cattctcacc tacaccgtgg cctggctttt catggcgtcc 301 atgtggtggg tgatcgccta cactcggggc gacctgaaca aagcccacgt cggtaactac 361 acgccttgcg tggccaatgt ctataacttc ccttctgcct tcctcttctt catcgagacg 421 gaggccacca tcggctatgg ctaccgatac atcacagaca agtgccccga gggcatcatc 481 ctcttcctct tccagtccat cctgggctcc atcgtggacg ccttcctcat cggctgcatg 541 ttcatcaaga tgtcccagcc caagaagcgc gccgagaccc tcatgttcag cgagcacgcg 601 gtgatctcca tgagggacgg aaaactcacg cttatgttcc gggtgggcaa cctgcgcaac 661 agccacatgg tctccgcgca gattcgctgc aagctgctca aatctcggca gacacctgag 721 ggtgagttcc ttccccttga ccaacttgaa ctggatgtag gttttagtac aggggcagat 781 caactttttc ttgtgtcccc cctcacaatt tgccacgtga tcgatgccaa aagccccttt 841 tatgacctat cccagcgaag catgcaaact gaacagttcg agattgtcgt catcctagaa 901 ggcattgtgg aaacaactgg gatgacttgt caagctcgaa catcatatac tgaagatgaa 961 gttctttggg gtcatcgttt ttttcctgta atttccttag aagagggatt ctttaaagtt 1021 gattactccc agttccatgc aacatttgaa gtccccaccc caccttacag tgtgaaagag 1081 caggaggaaa tgcttctcat gtcgtcccct ttaatagcac cagccataac taacagcaaa 1141 gaaagacata attctgtgga atgcttagat ggactagatg atattactac aaaactacca 1201 tctaagctgc agaaaattac tggaagagaa gactttccca aaaaactctt gaggatgagt 1261 tctacaactt cagaaaaagc ctacagcttg ggagacttgc ccatgaaact tcaacgaata 1321 agttcagttc cgggcaactc agaagaaaaa ctggtatcta aaaccaccaa gatgttatct 1381 gatcccatga gccagtctgt ggctgatttg ccaccaaagc ttcaaaagat ggctggagga 1441 gcagctagga tggaagggaa ccttccagcc aaattaagaa aaatgaactc tgatcgcttc 1501 acataa 37. human Kir 3.4- cDNA 1 atggctggcg attctaggaa tgccatgaac caggacatgg agattggagt cactccctgg 61 gaccccaaga agattccaaa acaggcccgc gattatgtcc ccattgccac agaccgtacg 121 cgcctgctgg ccgagggcaa gaagccacgc cagcgctaca tggagaagag tggcaagtgc 181 aacgtgcacc acggcaacgt ccaggagacc taccggtacc tgagtgacct cttcaccacc 241 ctggtggacc tcaagtggcg cttcaacttg ctcgtcttca ccatggttta cactgtcacc 301 tggctgttct tcggcttcat ttggtggctc attgcttata tccggggtga cctggaccat 361 gttggcgacc aagagtggat tccttgtgtt gaaaacctca gtggcttcgt gtccgctttc 421 ctgttctcca ttgagaccga aacaaccatt gggtatggct tccgagtcat cacagagaag 481 tgtccagagg ggattatact cctcttggtc caggccaLcc tgggctccat cgtcaatgcc 541 ttcatggtgg ggtgcatgtt tgtcaagatc agccagccca agaagagagc ggagaccctc 601 atgttttcca acaacgcagt catctccatg cgggacgaga agctgtgcct catgttccgg 661 gttggcgacc tccgcaactC CCacatcgtg gaggcctcca tccgggccaa gctcatcaag 721 tcccggcaga ccaaagaggg ggagttcatc cccctgaacc agacagacat caacgtgggc 781 tttgacacgg gcgacgaccg cctcttcctt gtgtctcctc tgatcatctc ccatgagatc 841 aaccagaaga gccctttctg ggagatgtct caggctcagc tgcatcagga agagtttgaa 901 gttgtggtca ttctagaagg gatggtggaa gccacaggca tgacctgcca agcccggagc 961 tcctacatgg atacagaggt gctctggggc caccgattca ccaccatcct caccttggaa 1021 aagggcttct atgaggtgga ctacaacacc ttccatgata cctatgagac caacacaccc 1081 agctgctgtg ccaaggagct ggcagaaatg aagagggaag gccggctcct ccagtacctc 1141 cccagccccc cactgctggg gggctgtgct gaggcagggc tggatgcaga ggctgagcag 1201 aatgaagaag atgagcccaa ggggctgggt gggtccaggg aggccagggg ctcggtgtga 38. human Kir 4.1- cDNA 1 atgacgtcag ttgccaaggt gtattacagt cagaccactc agacagaaag ccggccccta 61 atgggcccag ggatacgacg gcggagagtc ctgacaaaag atggtcgcag caacgtgaga 121 atggagcaca ttgccgacaa gcgcttcctc tacctcaagg acctgtggac aaccttcatt 181 gacatgcagt ggcgctacaa gcttctgctc ttctctgcga cctttgcagg cacatggttc 241 ctctttggcg tggtgtggta tctggtagct gtggcacatg gggacctgct ggagctggac 301 cccccggcca accacacccc ctgtgtggta caggtgcaca cactcactgg agccttcctc 361 ttctcccttg aatcccaaac caccattggc tatggcttcc gctacatcag tgaggaatgt 421 ccactggcca ttgtgcttct tattgcccag ctggtgctca ccaccatcct ggaaatcttc 481 atcacaggta ccttcctggc gaagattgcc cggcccaaga agcgggctga gaccattcgt 541 ttcagccagc atgcagttgt ggcctcccac aatggcaagc cctgcctcat gatccgagtt 601 gccaatatgc gcaaaagcct cctcattggc tgccaggtga caggaaaact gcttcagacc 661 caccaaacca aggaagggga gaacatccgg ctcaaccagg tcaatgtgac tttccaagta 721 gacacagcct ctgacagccc cttccttatt ctacccctta ccttctatca tgtggtagat 781 gagaccagtc ccttgaaaga tctccctctt cgcagtggtg agggtgactt tgagctggtg 841 ctgatcctaa gtgggacagt ggagtccacc agtgccacct gtcaggtgcg cacttcctac 901 ctgccagagg agatcctttg gggctacgag ttcacacctg ccatctcact gtcagccagt 961 ggtaaataca tagctgactt tagccttttt gaccaagttg tgaaagtggc ctctcctagt 1021 ggcctccgtg acagcactgt acgctacgga gaccctgaaa agctcaagtt ggaggagtca 1081 ttaagggagc aagctgagaa ggagggcagt gcccttagtg tgcgcatcag caatgtctga 39. human Kir 4.2- cDNA 1 atggatgcca ttcacatcgg catgtccagc acccccctgg tgaagcacac tgctggggct 61 gggctcaagg ccaacagacc ccgcgtcatg tccaagagtg ggcacagcaa cgtgagaatt 121 gacaaagtgg atggcatata cctactctac ctgcaagacc tgtggaccac agttatcgac 181 atgaagtgga gatacaaact caccctgttc gotgccactt ttgtgatgac ctggttcctt 241 tttggagtca tctactatgc catcgcgttt attcatgggg acttagaacc cggtgagccc 301 atttcaaatc ataccccctg catcatgaaa gtggactctc tcactggggc gtttctcttt 361 tccctggaat cccagacaac cattggctat ggagtccgtt ccatcacaga ggaatgtcct 421 catgccatct tcctgttggt tgctcagttg gtcatcacga ccttgattga gatcttcatc 481 accggaacct tcctggccaa aatcgccaga cccaaaaagc gggctgagac catcaagttc 541 agccactgtg cagtcatcac caagcagaat gggaagctgt gcttggtgat tcaggtagcc 601 aatatgagga agagcctctt gattcagtgc cagctctctg gcaagctcct gcagacccac 661 gtcaccaagg agggggagcg gattctcctc aaccaagcca ctgtcaaatt ccacgtggac 721 tcctcctctg agagcccctt cctcattctg cccatgacat tctaccatgt gctggatgag 781 acgagccccc tgagagacct cacaccccaa aacctaaagg agaaggagtt tgagcttgtg 841 gtcctcctca atgccactgt ggaatccacc agcgctgtct gccagagccg aacatcttat 901 atcccagagg aaatctactg gggttttgag tttgtgcctg tggtatctct ctccaaaaat 961 ggaaaatatg tggctgattt cagtcagttt gaacagattc ggaaaagccc agattgcaca 1021 ttttactgtg cagattctga gaaacagcaa ctcgaggaga agtacaggca ggaggatcag 1081 agggaaagag aactgaggac acttttatta caacagagca atgtctga 40. human Kir 5.1- cDNA 1 atgagctatt acggcagcag ctatcatatt atcaatgcgg acgcaaaata cccaggctac 61 ccgccagagc acattatagc tgagaagaga agagcaagaa gacgattact tcacaaagat 121 ggcagctgta atgtctactt caagcacatt tttggagaat ggggaagcta tgtggttgac 181 atcttcacca ctcttgtgga caccaagtgg cgccatatgt ttgtgatatt ttctttatct 241 tatattctct cgtggttgat atttggctct gtcttttggc tcatagcctt tcatcatggc 301 gatctattaa atgatccaga catcacacct tgtgttgaca acgtccattc tttcacaggg 361 gcctttttgt tctccctaga gacccaaacc accataggat atggttatcg ctgtgttact 421 gaagaatgtt ctgtggccgt gctcatggtg atcctccagt ccatcttaag ttgcatcata 481 aataccttta tcattggagc tgccttggcc aaaatggcaa ctgctcgaaa gagagcccaa 541 accattcgtt tcagctactt tgcacttata ggtatgagag atgggaagct ttgcctcatg 601 tggcgcattg gtgattttcg gccaaaccac gtggtagaag gaacagttag agcccaactt 661 ctccgctata cagaagacag tgaagggagg atgacgatgg catttaaaga cctcaaatta 721 gtcaacgacc aaatcatcct ggtcaccccg gtaactattg tccatgaaat tgaccatgag 781 agccctctgt atgcccttga ccgCaaagca gtagccaaag ataactttga gattttggtg 841 acatttatct atactggtga ttccactgga acatctcacc aatctagaag ctcctatgtt 901 ccccgagaaa ttctctgggg ccataggttt aatgatgtct tggaagttaa gaggaagtat 961 tacaaagtga actgcttaca gtttgaagga agtgtggaag tatatgcccc cttttgcagt 1021 gccaagcaat tggactggaa agaccagcag ctccacatag aaaaagcacc accagttcga 1081 gaatcctgca cgtcggacac caaggcgaga cgaaggtcat ttagtgcagt tgccattgtc 1141 agcagctgtg aaaaccctga ggagaccacc acttccgcca cacatgaata tagggaaaca 1201 ccttatcaga aagctctcct gactttaaac agaatctctg tagaatccca aatgtag 41. human Kir 6.1- cDNA 1 atgttggcca gaaagagtat catcccggag gagaatgtgc tggcgcgcat cgccgcagag 61 aacctgcgca agccgcgcat ccgagaccgc ctccccaaag cccgcttcat cgccaagagc 121 ggggcctgca acctggcgca taagaacatc cgtgagcaag gacgctttct acaggacatc 181 ttcaccacct tggtggacct gaaatggcgc cacacgctgg tcatctttac catgtccttc 241 ctctgcagct ggctgctctt cgctatcatg tggtggctgg tggcctttgc ccatggggac 301 atctatgctt acatggagaa aagtggaatg gagaaaagtg gtttggagtc cactgtgtgt 361 gtgactaatg tcaggtcttt cacttctgct tttctcttct ccattgaagt tcaagttacc 421 attgggtttg gagggaggat gatgacagag gaatgccctt tggccatcac ggttttgatt 481 ctccagaata ttgtgggttt gatcatcaat gcagtcatgt taggctgcat tttcatgaaa 541 acagctcagg ctcacagaag ggcagaaact ttgattttca gccgccatgc tgtgattgcc 601 gtccgaaatg gcaagctgtg cttcatgttc cgagtgggtg acctgaggaa aagcatgatc 661 attagtgcct ctgtgcgcat ccaggtggtc aagaaaacaa ctacacctga aggggaggtg 721 gttcctattc accaactgga cattcctgtt gataacccaa tcgagagcaa taacattttt 781 ctggtggccc ctttgatcat ctgccacgtg attgacaagc gcagtcccct gtatgacatc 841 tcagcaactg acctggccaa ccaagacttg gaggtcatag ttattctgga aggagtggtt 901 gaaactactg gcatcaccac acaagcacga acctcctaca ttgctgagga gatccaatgg 961 ggccaccgct ttgtgtccat tgtgactgag gaagaaggag tgtattctgt ggattactcc 1021 aaatttggca acactgttaa agtagctgct ccacggtgca gtgcccgaga gctggatgag 1081 aaaccttcca tccttattca gaccctccaa aagagtgaac tgtctcatca aaattctctg 1141 aggaagcgca actccatgag aagaaacaat tccatgagga ggaacaattc tatccgaagg 1201 aacaattctt ccctcatggt accaaaggtg caatttatga ctccagaagg aaatcaaaac 1261 acatcggaat catga 42. human Kir 6.2- cDNA 1 atgctgtccc gcaagggcat catccccgag gaatacgtgc tgacacgcct ggcagaggac 61 cctgccaagc ccaggtaccg tgcccgccag cggagggccc gctttgcgtc caagaaaggc 121 aactgcaacg tggcccacaa gaacatccgg gagcagggcc gcttcctgca ggacgtgttc 181 accacgctgg tggacctcaa gtggccacac acattgctca tcctCaccat gtccttcctg 241 tgcagctggc tgctcttcgc catggcctgg tggctcatcg ccttcgccca cggtgacctg 301 gcccccagcg agggcactgc tgagccctgt gtcaccagca tccactcctt ctcgtctgcc 361 ttccttttct ccattgaggt ccaagtgact attggctttg gggggcgcat ggtgactgag 421 gagtgcccac tggccatcct gatcctcatc gtgcagaaca tcgtggggct catgatcaac 481 gccatcatgc ttggctgcat cttcatgaag actgcccaag cccaccgcag ggctgagacc 541 ctcatcttca gcaagcatgc ggtgatcgcc ctgcgccacg gccgcctctg catcatgcta 601 cgtgtgggtg acctccgcaa gagcatgatc atcagcgcca ccatccacat gcaggtggta 661 cgcaagacca ccagccccga gggcgaggtg gtgcccctcc accaggtgga catccccatg 721 gagaacggcg tgggtggcaa cagcatcttc ctggtggccc cgctgatcat ctaccatgtc 781 attgatgcca acagcccact ctacgacctg gcacccagcg acctgcacca ccaccaggac 841 ctcgagatca tcgtcatcct ggaaggcgtg gtggaaacca cgggcatcac cacccaggcc 901 cgcacctcct acctggccga tgagatcctg tggggccagc gctttgtgcc cattgtagct 961 gaggaggacg gacgttactc tgtggactac tccaagtttg gcaacaccgt caaagtgccc 1021 acaccactct gcacggcccg ccagcttgat gaggaccaca gcctactgga agctctgacc 1081 ctcgcctcag cccgcgggcc cctgcgcaag cgcagcgtgc ccatggccaa ggccaagccc 1141 aagttcagca tctctccaga ttccctgtcc tga 43. human Kir 7.1- cDNA 1 atggacagca gtaattgcaa agttattgct cctctcctaa gtcaaagata ccggaggatg 61 gtcaccaagg atggccacag cacacttcaa atggatggcg ctcaaagagg tcttgcatat 121 cttcgagatg cttggggaat cctaatggac atgcgctggc gttggatgat gttggtcttt 181 tctgcttctt ttgttgtcca ctggcttgtc tttgcagtgc tctggtatgt tctggctgag 241 atgaatggtg atctggaact agatcatgat gccccacctg aaaaccacac tatctgtgtc 301 aagtatatca ccagtttcac agctgcattc tccttctccc tggagacaca actcacaatt 361 ggttatggta ccatgttccc cagcggcgac tgtccaagtg caatcgcctt acttgccata 421 caaatgctcc taggcctcat gctagaggct tttatcacag gtgcttttgt ggcgaagatt 481 gcccggccaa aaaatcgagc tttttcaatt cgctttactg acacagcagt agtagctcac 541 atggatggca aacctaatct tatcttccaa gtggccaaca cccgacctag ccctctaacc 601 agtgtccggg tctcagctgt actctatcag gaaagagaaa atggcaaact ctaccagacc 661 agtgtggatt tccaccttga tggcatcagt tctgacgaat gtccattctt catctttcca 721 ctaacgtact atcactccat tacaccatca agtcctctgg ctactctgct ccagcatgaa 781 aatccttctc actttgaatt agtagtattc ctttcagcaa tgcaggaggg cactggagaa 841 atatgccaaa ggaggacatc ctacctaccg tctgaaatca tgttacatca ctgttttgca 901 tctctgttga cccgaggttc caaaggtgaa tatcaaatca agatggagaa ttttgacaag 961 actgtccctg aatttccaac tcctctggtt Cctaaaagcc caaacaggac tgacctggat 1021 atccacatca atggacaaag cattgacaat tttcagatct ctgaaacagg actgacagaa 1081 taa 44. chicken Kir 2.1- cDNA 1 atgggcagcg tgcgaaccaa ccgctacagc atcgtgtctt cggaagagga cggcatgaag 61 ctggcaacca tggccgttgc caatggcttt gggaatggaa aaagtaaggt acacaccagg 121 cagcagtgca ggagccgctt tgtcaaaaaa gatggccact gcaacgtcca gtttattaat 181 gtgggtgaga agggacagcg atacctcgca gacatcttca ccacttgcgt ggacatccgc 241 tggaggtgga tgctggttat cttctgcctg acattcatcc tctcctggct tttctttggc 301 tgtgtgtttt ggttgattgc gctgttgcac ggggatctgg agaaccaaga aaataacaaa 361 ccgtgtgtct cgcaagtgag cagcttcact gcagcctttc tgttctccat tgagacccag 421 accacgatcg gctatggctt caggtgcgtc acagacgagt gccccattgc tgttttcatg 481 gtggttttcc agtctatagt aggctgcatc attgacgcct tcatcattgg tgccgtcatg 541 gcaaagatgg ctaagccaaa aaagagaaac gaaactcttg tcttcagcca caatgccgtg 601 gtggccatga gagatgggaa actgtgcctg atgtggcgtg tcggaaacct gaggaaaagc 661 cacttggttg aggcacacgt gcgagcacag ctcctcaagt ccaggatcac gtcagaaggg 721 gagtacatcc ctttggatga aatagacatc aatgtagggt ttgacagcgg gatagaccgc 781 atattcctgg tctccccaat tacaatagta cacgaaatag atgaagatag tcctttgtat 841 gacttgagca aacaagacat ggacaatgct gactttgaaa ttgtagtcat tttagagggc 901 atggtggaag ccactgccat gactacccag tgccgcagct catatctggc aaatgaaatc 961 ctctggggcc accgctatga gcccgtactc tttgaagaaa aaaactacta caaagtggac 1021 tattcaaggt tccacaaaac atacgaagtg cccaacacac ccatctgcag tgccagagac 1081 ttagcagaaa agaaatacat tctctcgaac gcaaactcct tttgctacga gaacgaagtg 1141 gccctcacca gcaaggagga ggacgagatc gacacggggg tgcccgagag cacaagcaca 1201 gacacccacc ccgacatgga ccaccacaac caggcaggag tgcccctaga gccacggccg 1261 ctgcggcgtg agtcggaaat atga 45. chicken Kir 2.2- cDNA 1 atgactgcag gcagggtcaa cccttacagc atagtgtcct ccgaggaaga cggactgagg 61 ttgaccacca tgccagggat taacggcttt ggcaatggga aaatccacac caggaggaaa 121 tgcaggaaca ggtttgtaaa gaagaacggt cagtgcaatg tggagttcac caacatggat 181 gacaagccac agaggtacat tgcagacatg ttcaccacgt gcgttgacat ccgttggagg 241 tatatgctct cgctcttctc cctggcattt ctggtatcct ggttattgtt tgggctgatt 301 ttctggctaa ttgcactcat tcatggagat ctagaaaacc caggtggaga tgataccttc 361 aagccttgcg ttctgcagga caatggcttt gtggctgctt ttctgttctc catcgagacc 421 caaacgacta ttggttatgg cttccgctgt gtgacagagg agtgcccgct cgcagtcttc 481 atggtggtgg ttcagtccat cgtggggtgt ataatcgact ctttcatgat tggtgcaata 541 atggcaaaga tggccaggcc caaaaaaagg gcccagacat tgcttttcag ccataatgca 601 gtagtggcaa tgagagatgg aaaactctgc ctgatgtgga gagttgggaa tctccggaaa 661 agccacatag tagaagccca cgtacgagct caattaatta agcccagaat cacagaagaa 721 ggggagtaca tcccactcga ccaaatagac atcgacgtgg ggtttgacaa aggcttggac 781 cgaatcttct tggtgtcccc cattaccatt ctccatgaga tcaacgaaga cagcccgctg 841 ttcgggatca gccgccagga cttggagacg gatgactttg agattgtggt catcctcgaa 901 ggcatggtag aagccaccgc gatgacgaca caagctcgga gctcctacct ggccagcgag 961 atcctgtggg gccaccgctt cgagcccgtc ttgttcgagg agaaaaacca gtacaaagta 1021 gactattccc acttccacaa aacatacgag gtcccgtcca caccccgctg cagcgccaag 1081 gacttggtgg agaacaaatt cctgctgccc agcaccaact ccttctgcta cgagaatgag 1141 ctggccttca tgagccgcga tgaggatgag gaggatgatg acagcagggg tttggacgac 1201 ctgagcccag acaacaggca cgagttcgac cggcttcagg caacgatagc gttggatcag 1261 aggtcatacc ggagggagtc agaaatatga 46. human Kir 1.1- turret region HKDLPEFHPSANHTPCVENING 47. human Kir 1.2- turret region HGDLLELDPPANHTPCVVQVHT 48. human Kir 2.1- turret region HGDLDASKEGKACVSEVNS 49. human Kir 2.2- turret region HGDLEPAEGRGRTPCVMQVHG 50. human Kir 2.3- turret region HGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG 51. human Kir 2.4- turret region HGDLAAPPPPAPCFSHVAS 52. human Kir 3.1- turret region RGDLNKAHVGNYTPCVANVYN 53. human Kir 3.4- turret region RGDLDHVGDQEWIPCVENLSG 54. human Kir 6.1- turret region HGDIYAYMEKSGMEKSGLESTVCVTNVRS 55. human Kir 6.2- turret region HGDLAPSEGTAEPCVTSIHS 56. human Kir 7.1- turret region NGDLELDHDAPPENHTICVKYITS 57. chicken Kir 2.1- turret region HGDLENQENNKPCVSQVSS 58. chicken Kir 2.2- turret region HGDLENPGGDDTFKPCVLQVNG 59. Kir Bac 1.1- turret region SPARKPPRGGRRIWSGTREVIAYGMPASVWRDLYYWALKVSWPVFFASLAALF VVNNTLFALLYQLGDAPIANQSPPGFVGAFFFSVETLATVGYGDMHPQTVYAH AIATLEIFVGMSGIALSTGLVFARFARPRAKIMFARHAIVRPFNGRMTLMVRA ANARQNVIAEARAKMRLMRREHSSEGYSLMKIHDLKLVRNEHPIFLLGWNMMH VIDESSPLFGETPESLAEGRAMLLVMIEGSDETTAQVMQARHAWEHDDIRWHH RYVDLMSDVDGMTHIDYTRFNDTEPVEPPGAAPDAQAFAAKPGE 60. KcsA- turret region MAPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERG APGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLV TAALATWFVGREQERRGH 61. rKv1.2- turret region MRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGY GDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGE
Claims (25)
1. A method for identifying a compound that modulates ion channel activity of a Kir channel comprising:
identifying a compound which binds the turret region of a Kir channel; and
determining if the compound modulates ion channel activity of the Kir channel.
2. The method of claim 1 , wherein the compound is an antibody.
3. The method of claim 2 , wherein the antibody is human, chimeric, or humanized.
4. The method of claim 2 , wherein the antibody is selected from the group consisting of polyclonal antibodies, monoclonal antibodies, an intact immunoglobulin molecule, an antibody fragment, a scFv, a Fab, a F(ab)2, a Fv, and a disulfide linked Fv.
5. The method of claim 1 , wherein the compound is a nucleic acid.
6. The method of claim 5 , wherein the nucleic acid is selected from the group consisting of DNA and RNA.
7. The method of claim 5 , wherein the identifying includes in vitro selection of the nucleic acid.
8. The method of claim 1 , wherein the compound is a protein/peptide.
9. The method of claim 8 , wherein the protein/peptide is attached to a protein scaffold.
10. The method of claim 8 , wherein the protein/peptide is displayed on the surface of a phage.
11. The method of claim 1 , wherein the compound is a small molecule.
12. The method of claim 1 , wherein the Kir channel is human.
13. The method of claim 1 , wherein the Kir channel is a chicken/human hybrid.
14. The method of claim 13 , wherein the chicken/human hybrid Kir channel comprises a human Kir channel turret region.
15. The method of claim 1 , wherein the identifying step comprises an ELISA and a Western blot to determine if the compound binds to a properly folded Kir channel but not to a denatured Kir channel.
16. The method of claim 1 , wherein the identifying step comprises determining if the compound binds to a Kir channel with a normal turret region but not a mutated turret region.
17. The method of claim 1 wherein the determining step comprises an electrophysiological assay.
18. The method of claim 17 , wherein the electrophysiological assay is selected from the group consisting of two-electrode voltage clamp, patch clamp, and planar lipid bilayer assays.
19. The method of claim 1 , wherein the determining step comprises a fluorescent assay.
20. The method of claim 19 , wherein the fluorescent assay utilizes a thallium specific fluorescent dye.
21. A method for identifying a compound that selectively modulates ion channel activity of a specific type of Kir channel comprising:
identifying a compound which binds the turret region of a specific type of Kir channel but does not bind to other types of Kir channels; and
determining if the compound modulates the activity of the Kir channel.
22. The method of claim 21 , wherein the identifying comprises deter pining if the compound binds the turret region of the specific type of Kir channel but does not bind the turret region of other type of Kir channels.
23. A method of identifying a compound to treat a condition associated with abnormal ion channel activity by a Kir channel comprising:
identifying a compound which binds the turret region of a Kir channel;
determining if said compound modulates ion channel activity of the Kir channel; and
administering said compound which modulates ion channel activity to a subject to determine if the compound is able to treat said condition.
24. The method of claim 23 , wherein the condition is selected from the group consisting of diabetes mellitus, hypertension, cardiac arrhythmia, and epilepsy.
25.-43. (canceled)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/813,396 US20150323549A1 (en) | 2009-12-01 | 2015-07-30 | Methods for Identifying Compounds That Modulate Ion Channel Activity of a Kir Channel |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US28331709P | 2009-12-01 | 2009-12-01 | |
PCT/US2010/058415 WO2011068801A2 (en) | 2009-12-01 | 2010-11-30 | Methods for identifying compounds that modulate ion channel activity of a kir channel |
US201213513105A | 2012-10-15 | 2012-10-15 | |
US14/813,396 US20150323549A1 (en) | 2009-12-01 | 2015-07-30 | Methods for Identifying Compounds That Modulate Ion Channel Activity of a Kir Channel |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/513,105 Division US9134323B2 (en) | 2009-12-01 | 2010-11-30 | Antibody that specifically binds to an epitope in the tureet region of a human Kir channel |
PCT/US2010/058415 Division WO2011068801A2 (en) | 2009-12-01 | 2010-11-30 | Methods for identifying compounds that modulate ion channel activity of a kir channel |
Publications (1)
Publication Number | Publication Date |
---|---|
US20150323549A1 true US20150323549A1 (en) | 2015-11-12 |
Family
ID=44115470
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/513,105 Active 2031-09-01 US9134323B2 (en) | 2009-12-01 | 2010-11-30 | Antibody that specifically binds to an epitope in the tureet region of a human Kir channel |
US14/813,396 Abandoned US20150323549A1 (en) | 2009-12-01 | 2015-07-30 | Methods for Identifying Compounds That Modulate Ion Channel Activity of a Kir Channel |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/513,105 Active 2031-09-01 US9134323B2 (en) | 2009-12-01 | 2010-11-30 | Antibody that specifically binds to an epitope in the tureet region of a human Kir channel |
Country Status (2)
Country | Link |
---|---|
US (2) | US9134323B2 (en) |
WO (1) | WO2011068801A2 (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015166057A1 (en) * | 2014-04-30 | 2015-11-05 | Klinikum Rechts Der Isar Der Technischen Universität München | Diagnosis of multiple sclerosis |
JOP20210067A1 (en) * | 2018-10-10 | 2023-01-30 | Wisconsin Alumni Res Found | Kir 7.1 gene therapy vectors and methods of using the same |
Family Cites Families (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6030776A (en) | 1990-06-11 | 2000-02-29 | Nexstar Pharmaceuticals, Inc. | Parallel SELEX |
US5496938A (en) | 1990-06-11 | 1996-03-05 | Nexstar Pharmaceuticals, Inc. | Nucleic acid ligands to HIV-RT and HIV-1 rev |
US5637459A (en) | 1990-06-11 | 1997-06-10 | Nexstar Pharmaceuticals, Inc. | Systematic evolution of ligands by exponential enrichment: chimeric selex |
AU6267194A (en) * | 1993-02-19 | 1994-09-14 | Upjohn Company, The | Human dna sequence encoding a kidney atp-dependent potassium channel |
US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
US6130364A (en) | 1995-03-29 | 2000-10-10 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
EP0846128B1 (en) | 1995-08-23 | 2008-10-29 | University Of British Columbia | Antimicrobial cationic peptides and methods of screening for the same |
US6051698A (en) | 1997-06-06 | 2000-04-18 | Janjic; Nebojsa | Vascular endothelial growth factor (VEGF) nucleic acid ligand complexes |
US20020137890A1 (en) | 1997-03-31 | 2002-09-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
EP1062508A1 (en) | 1998-03-20 | 2000-12-27 | The Rockefeller University | Assays for screening compounds which interact with cation channel proteins, mutant prokaryotic cation channel proteins, and uses thereof |
US6979572B1 (en) | 1998-07-07 | 2005-12-27 | Trustees Of The University Of Pennsylvania | Compositions and methods for inhibiting inward-rectifier potassium channels |
US6818611B1 (en) | 1998-10-13 | 2004-11-16 | University Of Georgia Research Foundation, Inc. | Stabilized bioactive peptides and methods of identification, synthesis and use |
US6680377B1 (en) | 1999-05-14 | 2004-01-20 | Brandeis University | Nucleic acid-based detection |
JP3874593B2 (en) * | 2000-06-12 | 2007-01-31 | 株式会社日立製作所 | Computer identification device |
AU2002215350B2 (en) | 2000-10-13 | 2006-12-07 | Bristol-Myers Squibb Company | Methods for detecting modulators of ion channels using thallium (I) sensitive assays |
US20030171275A1 (en) * | 2000-12-20 | 2003-09-11 | Baughn Mariah R. | Transporters and ion channels |
AU2002253981B2 (en) | 2001-02-20 | 2008-02-21 | Abeome Corporation | Rapid production of monoclonal antibodies |
US20040048369A1 (en) | 2002-09-04 | 2004-03-11 | Zhe Lu | Control of inward-rectifier K+ ion channels |
AU2004294933B2 (en) | 2003-11-21 | 2011-11-17 | Johns Hopkins University | Biomolecule partition motifs and uses thereof |
CA2501422C (en) | 2004-04-29 | 2014-08-12 | University Of Rochester | Lymphoid chemokines in the diagnosis, monitoring and treatment of autoimmune disease |
US20060263805A1 (en) * | 2005-03-16 | 2006-11-23 | Andre Terzic | Diagnosing and treating potassium channel defects |
AU2006261343A1 (en) | 2005-06-15 | 2006-12-28 | The Ohio State University Research Foundation | Aptamers that bind to prion protein |
-
2010
- 2010-11-30 WO PCT/US2010/058415 patent/WO2011068801A2/en active Application Filing
- 2010-11-30 US US13/513,105 patent/US9134323B2/en active Active
-
2015
- 2015-07-30 US US14/813,396 patent/US20150323549A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
WO2011068801A3 (en) | 2011-07-28 |
WO2011068801A2 (en) | 2011-06-09 |
US9134323B2 (en) | 2015-09-15 |
US20130035475A1 (en) | 2013-02-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8097422B2 (en) | Kir channel modulators | |
Zhou et al. | Architecture of the synaptotagmin–SNARE machinery for neuronal exocytosis | |
US7452675B2 (en) | Methods of screening for TRPM4b modulators | |
Gao et al. | Voltage-gated sodium channels in taste bud cells | |
Buxton et al. | Identification and characterization of Snapin as a ubiquitously expressed SNARE-binding protein that interacts with SNAP23 in non-neuronal cells | |
JP5940541B2 (en) | Neuropeptide Q as modulator of GPCR GALR2 and use thereof | |
WO2007073687A1 (en) | A g protein-coupled receptor antagonist and its use for preventing and treating alzheimer’s disease | |
US20150323549A1 (en) | Methods for Identifying Compounds That Modulate Ion Channel Activity of a Kir Channel | |
US7601883B2 (en) | Mammalian sour/acid taste and CSF receptor genes, polypeptides and assays | |
EP2483696B1 (en) | Natural peptide and derivatives as modulators of GPCR GPR1 and uses thereof | |
CN109891247A (en) | Multi-protease process | |
EP2480891B1 (en) | Fkbp52-tau interaction as a novel therapeutical target for treating the neurological disorders involving tau dysfunction | |
US20060247418A1 (en) | Gfp fusion proteins and their use | |
US20070009912A1 (en) | Novel ion channel preferentially expressed in mammalian taste receptor cells | |
Dryn et al. | Species-related differences in the properties of TRPC4 channels in intestinal myocytes of rodents | |
US12044675B2 (en) | Genetically encoded calcium indicators (GECIs) and methods of making and using | |
Madziva et al. | Effects of synaptotagmin reveal two distinct mechanisms of agonist-stimulated internalization of the M4 muscarinic acetylcholine receptor | |
Chokvithaya | Functional studies of p. N258K and p. G279D variants in the KCNQ2 gene | |
Tsuzuki et al. | An Epithelial Ca 2+-Sensor Protein is an Alternative to Calmodulin to Compose Functional KCNQ1 Channels. | |
Toulmé et al. | Neurotransmitter receptor complexes in the brain: biochemical characterization and functional analysis of receptor-receptor interactions | |
Clark | RGS protein modulation of neuronal Galpha (q)-mediated signaling | |
CA2614382A1 (en) | Homo and heterodimer proteins of the abcg family, methods for detection and screening modulators thereof | |
Posokhova | Molecular mechanisms regulating G protein signaling in brain and heart: Role of R7 RGS proteins and their binding partners | |
Hannan | Identification of novel protein constituents of the dopamine D2 receptor signalplex: A study of TRPC1/D2R interaction and its role in signalplex trafficking | |
Tian | G Protein Coupling and Regulation of Metabotropic Glutamate Receptor 6 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |