US20150099738A1 - Isoxazolines as inhibitors of fatty acid amide hydrolase - Google Patents

Isoxazolines as inhibitors of fatty acid amide hydrolase Download PDF

Info

Publication number
US20150099738A1
US20150099738A1 US14/320,435 US201414320435A US2015099738A1 US 20150099738 A1 US20150099738 A1 US 20150099738A1 US 201414320435 A US201414320435 A US 201414320435A US 2015099738 A1 US2015099738 A1 US 2015099738A1
Authority
US
United States
Prior art keywords
alkyl
certain embodiments
aryl
groups
independently
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US14/320,435
Inventor
Mark L. Behnke
Alfredo C. Castro
Lawrence K. Chan
Catherine A. Evans
Louis Grenier
Michael J. Grogan
Yves LeBlanc
Tao Liu
Stephane Peluso
Daniel A. Snyder
Thomas T. Tibbitts
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Infinity Pharmaceuticals Inc
Original Assignee
Infinity Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Infinity Pharmaceuticals Inc filed Critical Infinity Pharmaceuticals Inc
Priority to US14/320,435 priority Critical patent/US20150099738A1/en
Assigned to INFINITY PHARMACEUTICALS, INC. reassignment INFINITY PHARMACEUTICALS, INC. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: TIBBITTS, THOMAS T., CHAN, LAWRENCE K., SNYDER, DANIEL A., Castro, Alfredo C., EVANS, CATHERINE A., GRENIER, LOUIS, GROGAN, MICHAEL J., LEBLANC, YVES, LIU, TAO, PELUSO, STEPHANE, BEHNKE, MARK L.
Publication of US20150099738A1 publication Critical patent/US20150099738A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D498/00Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D498/02Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
    • C07D498/10Spiro-condensed systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/42Oxazoles
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/438The ring being spiro-condensed with carbocyclic or heterocyclic ring systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/08Drugs for disorders of the alimentary tract or the digestive system for nausea, cinetosis or vertigo; Antiemetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/20Hypnotics; Sedatives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/30Drugs for disorders of the nervous system for treating abuse or dependence
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D261/00Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings
    • C07D261/20Heterocyclic compounds containing 1,2-oxazole or hydrogenated 1,2-oxazole rings condensed with carbocyclic rings or ring systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D498/00Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D498/02Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
    • C07D498/04Ortho-condensed systems

Definitions

  • Fatty acid amide hydrolase also referred to as oleamide hydrolase and anandamide amidohydrolase
  • FAAs include anadamide, oleoylethanolamide and palmitoylethanolamide, and is intimately involved in their regulation. Because these FAAs interact with cannabinoid and vanilliod receptors, they are often referred to as “endocannabinoids” or “endovanilliods”.
  • endovanilliods endovanilliods
  • FAAH inhibitors through interactions of the FAAs with unique extracellular and intracellular receptors, can be used to treat a variety of conditions that include, but are not limited to, inflammation, metabolic disorders (e.g., obesity-related conditions and wasting conditions such as cachexias and anorexia), disorders of the central nervous system (e.g., disorders associated with neurotoxicity and/or neurotrauma, stroke, multiple sclerosis, spinal cord injury, movement disorders such as basal ganglia disorders, amylotrophic lateral sclerosis, Alzheimer's disease, epilepsy, mental disorders such as anxiety, depression, learning disorders and Schizophrenia, sleep disorders such as insomnia, nausea and/or emesis, and drug addiction), cardiac disorders (e.g., hypertention, circulatory shock, myocardial reperfusion injury and atherosclerosis) and glaucoma (Pacher et al., “The Endocannabinoid System as an Emerging Target of Pharmacotherapy” Pharmacological Reviews (2006) 58:389-462
  • the present invention provides isoxazoline FAAH inhibitor compounds of the formula (I):
  • R a and R d are joined to form a C 1-10 carbocycyl or 3-14 membered heterocyclyl fused ring, and R b and R c are independently selected from —H, C 1-10 alkyl and C 1-10 perhaloalkyl; or
  • R c and R d are joined to form a C 3-10 carbocycyl or 3-14 membered heterocyclyl spiro-fused ring, and R a and R b are independently selected from —H, C 1-10 alkyl and C 1-10 perhaloalkyl;
  • L is a covalent bond or a divalent C 1-6 hydrocarbon group, wherein one, two or three methylene units of L are optionally and independently replaced with one or more oxygen, sulfur or nitrogen atoms;
  • G is selected from —CN, —NO 2 , —S( ⁇ O)R e , —SO 2 R e , —SO 2 NR f R e , —PO 2 R e , —PO 2 OR e , —PO 2 NR f R e , —(C ⁇ O)R e , —(C ⁇ O)OR e , —(C ⁇ O)NR f R e , —Br, —I, —F, —Cl, —OR e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —SR e , —OSO 2 R e , —NR f SO 2 R e , —OPO 2 R e , —OPO 2 OR
  • each R e is selected from C 1-10 alkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocycyl, C 6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl; each R f attached to a nitrogen atom is, independently, selected from —H, C 1-10 alkyl, or an amino protecting group; or R e and R f are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • the present invention also provides pharmaceutical compositions comprising a compound of formula (I), or a pharmaceutically acceptable form thereof, and a pharmaceutically acceptable excipient.
  • the present invention also provides methods for treating an FAAH-mediated condition in a subject comprising administering a therapeutically effective amount of a compound of formula (I), or a pharmaceutically acceptable form thereof, to a subject in need thereof.
  • Certain compounds of the present invention can comprise one or more asymmetric centers, and thus can exist in various isomeric forms, e.g., enantiomers and/or diastereomers.
  • the compounds provided herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
  • the compounds of the invention are enantiopure compounds.
  • mixtures of stereoisomers are provided.
  • certain compounds, as described herein may have one or more double bonds that can exist as either the cis or trans, or the E or Z isomer, unless otherwise indicated.
  • the invention additionally encompasses the compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers, e.g., racemic mixtures of E/Z isomers or mixtures enriched in one E/Z isomer.
  • an enantiomerically enriched preparation of the (S)-enantiomer means a preparation of the compound having greater than 50% by weight of the (S)-enantiomer relative to the (R)-enantiomer, more preferably at least 75% by weight, and even more preferably at least 80% by weight.
  • the enrichment can be much greater than 80% by weight, providing a “substantially enantiomerically enriched,” “substantially enantiomerically pure” or a “substantially non-racemic” preparation, which refers to preparations of compositions which have at least 85% by weight of one enantiomer relative to other enantiomer, more preferably at least 90% by weight, and even more preferably at least 95% by weight.
  • the enantiomerically enriched composition has a higher potency with respect to therapeutic utility per unit mass than does the racemic mixture of that composition.
  • Enantiomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred enantiomers can be prepared by asymmetric syntheses. See, for example, Jacques, et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen, S. H., et al., Tetrahedron 33:2725 (1977); Eliel, E. L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, S. H. Tables of Resolving Agents and Optical Resolutions p. 268 (E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, Ind. 1972).
  • C 1-6 alkyl is intended to encompass, C 1 , C 2 , C 3 , C 4 , C 5 , C 6 , C 1-6 , C 1-5 , C 1-4 , C 1-3 , C 1-2 , C 2-6 , C 2-5 , C 2-4 , C 2-3 , C 3-6 , C 3-5 , C 3-4 , C 4-6 , C 4-5 , and C 5-6 alkyl.
  • a “direct bond” or “covalent bond” refers to a single bond joining two groups.
  • halo and halogen refer to fluorine (fluoro, —F), chlorine (chloro, —Cl), bromine (bromo, —Br), or iodine (iodo, —I).
  • alkyl refers to a monoradical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (“C 1-10 alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C 1-9 alkyl”). In some embodiments, an alkyl group has 1 to 8 carbon atoms (“C 1-8 alkyl”). In some embodiments, an alkyl group has 1 to 7 carbon atoms (“C 1-7 alkyl”). In some embodiments, an alkyl group has 1 to 6 carbon atoms (“C 1-6 alkyl”). In some embodiments, an alkyl group has 1 to 5 carbon atoms (“C 1-5 alkyl”).
  • an alkyl group has 1 to 4 carbon atoms (“C 1-4 alkyl”). In some embodiments, an alkyl group has 1 to 3 carbon atoms (“C 1-3 alkyl”). In some embodiments, an alkyl group has 1 to 2 carbon atoms (“C 1-2 alkyl”). In some embodiments, an alkyl group has 1 carbon atom (“C 1 alkyl”). In some embodiments, an alkyl group has 2 to 6 carbon atoms (“C 2-6 alkyl”).
  • C 1-6 alkyl groups include methyl (C 1 ), ethyl (C 2 ), n-propyl (C 3 ), isopropyl (C 3 ), n-butyl (C 4 ), tert-butyl (C 4 ), sec-butyl (C 4 ), iso-butyl (C 4 ), n-pentyl (C 5 ), 3-pentanyl (C 5 ), amyl (C 5 ), neopentyl (C 5 ), 3-methyl-2-butanyl (C 5 ), tertiary amyl (C 5 ), and n-hexyl (C 6 ).
  • alkyl groups include n-heptyl (C 7 ), n-octyl (C 5 ) and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an “unsubstituted alkyl”) or substituted (a “substituted alkyl”) are substituted with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the alkyl group is an unsubstituted C 1-10 alkyl (e.g., —CH 3 ). In certain embodiments, the alkyl group is a substituted C 1-10 alkyl.
  • Perhaloalkyl refers to an alkyl group having from 1 to 10 carbon atoms wherein all of the hydrogen atoms are each independently replaced halogen, e.g., selected from fluoro, bromo, chloro or iodo (“C 1-10 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 8 carbon atoms (“C 1-8 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 6 carbon atoms (“C 1-6 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 4 carbon atoms (“C 1-4 perhaloalkyl”).
  • the alkyl moiety has 1 to 3 carbon atoms (“C 1-3 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 2 carbon atoms (“C 1-2 perhaloalkyl”). In some embodiments, all of the hydrogen atoms are each replaced with fluoro. In some embodiments, all of the hydrogen atoms are each replaced with chloro. Examples of perhaloalkyl groups include —CF 3 , —CF 2 CF 3 , —CF 2 CF 2 CF 3 , —CCl 3 , —CFCl 2 , —CF 2 Cl and the like.
  • alkenyl refers to a monoradical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms and one or more carbon-carbon double bonds (“C 2-10 alkenyl”). In some embodiments, an alkenyl group has 2 to 9 carbon atoms (“C 2-9 alkenyl”). In some embodiments, an alkenyl group has 2 to 8 carbon atoms (“C 2-8 alkenyl”). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (“C 2-7 alkenyl”). In some embodiments, an alkenyl group has 2 to 6 carbon atoms (“C 2-6 alkenyl”).
  • an alkenyl group has 2 to 5 carbon atoms (“C 2-5 alkenyl”). In some embodiments, an alkenyl group has 2 to 4 carbon atoms (“C 2-4 alkenyl”). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (“C 2-3 alkenyl”). In some embodiments, an alkenyl group has 2 carbon atoms (“C 2 alkenyl”).
  • the one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl).
  • Examples of C 2-4 alkenyl groups include ethenyl (C 2 ), 1-propenyl (C 3 ), 2-propenyl (C 3 ), 1-butenyl (C 4 ), 2-butenyl (C 4 ), butadienyl (C 4 ) and the like.
  • Examples of C 2-6 alkenyl groups include the aforementioned C 2-4 alkenyl groups as well as pentenyl (C 5 ), pentadienyl (C 5 ), hexenyl (C 6 ) and the like. Additional examples of alkenyl include heptenyl (C 7 ), octenyl (C 5 ), octatrienyl (C 5 ) and the like.
  • each instance of an alkenyl group is independently unsubstituted (an “unsubstituted alkenyl”) or substituted (a “substituted alkenyl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the alkenyl group is an unsubstituted C 2-10 alkenyl.
  • the alkenyl group is a substituted C 2-10 alkenyl.
  • alkynyl refers to a monoradical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms and one or more carbon-carbon triple bonds (“C 2-10 alkynyl”). In some embodiments, an alkynyl group has 2 to 9 carbon atoms (“C 2-9 alkynyl”). In some embodiments, an alkynyl group has 2 to 8 carbon atoms (“C 2-8 alkynyl”). In some embodiments, an alkynyl group has 2 to 7 carbon atoms (“C 2-7 alkynyl”). In some embodiments, an alkynyl group has 2 to 6 carbon atoms (“C 2-6 alkynyl”).
  • an alkynyl group has 2 to 5 carbon atoms (“C 2-5 alkynyl”). In some embodiments, an alkynyl group has 2 to 4 carbon atoms (“C 2-4 alkynyl”). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (“C 2-3 alkynyl”). In some embodiments, an alkynyl group has 2 carbon atom (“C 2 alkynyl”).
  • the one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl).
  • Examples of C 2-4 alkynyl groups include, without limitation, ethynyl (C 2 ), 1-propynyl (C 3 ), 2-propynyl (C 3 ), 1-butynyl (C 4 ), 2-butynyl (C 4 ) and the like.
  • Examples of C 2-6 alkenyl groups include the aforementioned C 2-4 alkynyl groups as well as pentynyl (C 5 ), hexynyl (C 6 ) and the like. Additional examples of alkynyl include heptynyl (C 7 ), octynyl (C 5 ) and the like.
  • each instance of an alkynyl group is independently unsubstituted (an “unsubstituted alkynyl”) or substituted (a “substituted alkynyl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the alkynyl group is an unsubstituted C 2-10 alkynyl.
  • the alkynyl group is a substituted C 2-10 alkynyl.
  • a “divalent C 1-6 hydrocarbon group” is a divalent C 1-6 alkyl group, divalent C 1-6 alkenyl group or divalent C 1-6 alkynyl group wherein one, two or three methylene units (—CH 2 —) of the hydrocarbon chain are optionally and independently replaced with one or more oxygen, sulfur or nitrogen atoms.
  • the divalent C 1-6 hydrocarbon group is a divalent C 1-6 alkyl group.
  • the divalent C 1-6 hydrocarbon group is an unsubstituted divalent C 1-6 hydrocarbon group (e.g., an unsubstituted divalent C 1-6 alkyl group).
  • alkoxy refers to an alkyl group, as defined herein, substituted with an oxygen atom, wherein the point of attachment is the oxygen atom.
  • the alkyl group has 1 to 10 carbon atoms (“C 1-10 alkoxy”).
  • the alkyl group has 1 to 8 carbon atoms (“C 1-8 alkoxy”).
  • the alkyl group has 1 to 6 carbon atoms (“C 1-6 alkoxy”).
  • the alkyl group has 1 to 4 carbon atoms (“C 1-4 alkoxy”).
  • C 1-4 alkoxy groups include methoxy (C 1 ), ethoxy (C 2 ), propoxy (C 3 ), isopropoxy (C 3 ), butoxy (C 4 ), tert-butoxy (C 5 ) and the like.
  • C 1-6 alkoxy groups include the aforementioned C 1-4 alkoxy groups as well as pentyloxy (C 5 ), isopentyloxy (C 5 ), neopentyloxy (C 5 ), hexyloxy (C 6 ) and the like.
  • Additional examples of alkoxy groups include heptyloxy (C 7 ), octyloxy (C 5 ) and the like.
  • each instance of the alkyl moiety of the alkoxy group is independently unsubstituted (an “unsubstituted alkoxy”) or substituted (a “substituted alkoxy”) are substituted with 1, 2, 3, 4, or 5 substituents as described herein.
  • the alkoxy group is an unsubstituted C 2-10 alkoxy (e.g., —OCH 3 ).
  • the alkoxy group is a substituted C 2-10 alkoxy (e.g., perhaloalkoxy as defined herein).
  • Perhaloalkoxy refers to an alkoxy group wherein the all the hydrogen atoms of the alkyl moiety are each independently replaced with halogen atoms selected from fluoro, chloro, bromo and iodo.
  • the alkyl moiety has 1 to 10 carbon atoms (“C 1-10 perhaloalkoxy”).
  • the alkyl moiety has 1 to 8 carbon atoms (“C 1-8 perhaloalkoxy”).
  • the alkyl moiety has 1 to 6 carbon atoms (“C 1-6 perhaloalkoxy”).
  • the alkyl moiety has 1 to 4 carbon atoms (“C 1-4 perhaloalkoxy”).
  • the alkyl moiety has 1 to 3 carbon atoms (“C 1-3 perhaloalkoxy”). In some embodiments, the alkyl moiety has 1 to 2 carbon atoms (“C 1-2 perhaloalkoxy”). In some embodiments, all of the hydrogen atoms are each replaced with fluoro.
  • all of the hydrogen atoms are each replaced with chloro.
  • perhaloalkoxy groups include, but are not limited to, —OCF 3 , —OCF 2 CF 3 , —OCF 2 CF 2 CF 3 , —OCCl 3 , —OCFCl 2 , —OCF 2 Cl and the like.
  • “carbocyclyl” refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms (“C 3-10 carbocyclyl”) and zero heteroatoms in the non-aromatic ring system.
  • a carbocyclyl group has 3 to 8 ring carbon atoms (“C 3-4 carbocyclyl”).
  • a carbocyclyl group has 3 to 6 ring carbon atoms (“C 3-6 carbocyclyl”).
  • a carbocyclyl group has 3 to 6 ring carbon atoms (“C 3-6 carbocyclyl”).
  • a carbocyclyl group has 5 to 10 ring carbon atoms (“C 5-10 carbocyclyl”).
  • C 3 carbocyclyl groups include, without limitation, cyclopropyl (C 3 ), cyclobutyl (C 4 ), cyclopentyl (C 5 ), cyclopentenyl (C 5 ), cyclohexyl (C 6 ), cyclohexenyl (C 6 ), cyclohexadienyl (C 6 ) and the like.
  • C 3-8 carbocyclyl groups include the aforementioned C 3-6 carbocyclyl groups as well as cycloheptyl (C 7 ), cycloheptadienyl (C 7 ), cycloheptatrienyl (C 7 ), cyclooctyl (C 5 ), bicyclo[2.2.1]heptanyl, bicyclo[2.2.2]octanyl, and the like.
  • Examples of C 1-10 carbocyclyl groups include the aforementioned C 3-8 carbocyclyl groups as well as octahydro-1H-indenyl, decahydronaphthalenyl, spiro[4.5]decanyl and the like.
  • the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) or tricyclic system (“tricyclic carbocyclyl”)) and can be saturated or can contain one or more carbon-carbon double or triple bonds.
  • “Carbocyclyl” also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring.
  • each instance of a carbocyclyl group is independently unsubstituted (an “unsubstituted carbocyclyl”) or substituted (a “substituted carbocyclyl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the carbocyclyl group is an unsubstituted C 3-10 carbocyclyl.
  • the carbocyclyl group is a substituted C 3-10 carbocyclyl.
  • “carbocyclyl” is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms (“C 3-10 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms (“C 3-8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms (“C 3-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (“C 5-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (“C 5-10 cycloalkyl”).
  • C 5-6 cycloalkyl groups include cyclopentyl (C 5 ) and cyclohexyl (C 5 ).
  • Examples of C 3-6 cycloalkyl groups include the aforementioned C 5-6 cycloalkyl groups as well as cyclopropyl (C 3 ) and cyclobutyl (C 4 ).
  • Examples of C 3-8 cycloalkyl groups include the aforementioned C 3-6 cycloalkyl groups as well as cycloheptyl (C 7 ) and cyclooctyl (C 5 ).
  • each instance of a cycloalkyl group is independently unsubstituted (an “unsubstituted cycloalkyl”) or substituted (a “substituted cycloalkyl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the cycloalkyl group is an unsubstituted C 3-10 cycloalkyl.
  • the cycloalkyl group is a substituted C 3-10 cycloalkyl.
  • heterocyclyl refers to a radical of a 3- to 14-membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“3-14 membered heterocyclyl”).
  • heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits.
  • a heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic heterocyclyl”) or tricyclic system (“tricyclic heterocyclyl”)), and can be saturated or can contain one or more carbon-carbon double or triple bonds.
  • Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings.
  • Heterocyclyl also includes ring systems wherein the heterocycyl ring, as defined above, is fused with one or more carbocycyl groups wherein the point of attachment is either on the carbocycyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring.
  • a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-10 membered heterocyclyl”).
  • a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-8 membered heterocyclyl”).
  • a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-6 membered heterocyclyl”).
  • the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen and sulfur.
  • the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen and sulfur.
  • Exemplary 3-membered heterocyclyls containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, thiorenyl.
  • Exemplary 4-membered heterocyclyls containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl.
  • Exemplary 5-membered heterocyclyls containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl and pyrrolyl-2,5-dione.
  • Exemplary 5-membered heterocyclyls containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl.
  • Exemplary 5-membered heterocyclyls containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl.
  • Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl.
  • Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, dioxanyl.
  • Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl.
  • Exemplary 7-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl.
  • Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl.
  • Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrol
  • each instance of heterocyclyl is independently unsubstituted (an “unsubstituted heterocyclyl”) or substituted (a “substituted heterocyclyl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl.
  • the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
  • aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) aromatic ring system (e.g., having 6, 10 or 14 ⁇ electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system (“C 6-14 aryl”).
  • an aryl group has 6 ring carbon atoms (“C 6 aryl”; e.g., phenyl).
  • an aryl group has 10 ring carbon atoms (“C 10 aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl).
  • an aryl group has 14 ring carbon atoms (“C 14 aryl”; e.g., anthracyl).
  • Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring.
  • each instance of an aryl group is independently unsubstituted (an “unsubstituted aryl”) or substituted (a “substituted aryl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the aryl group is an unsubstituted C 6-14 aryl.
  • the aryl group is a substituted C 6-14 aryl.
  • Alkyl is a subset of “alkyl” and refers to an alkyl group, as defined herein, substituted by an aryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
  • heteroaryl refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic or tricyclic) aromatic ring system (e.g., having 6, 10 or 14 ⁇ electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-14 membered heteroaryl”).
  • the point of attachment can be a carbon or nitrogen atom, as valency permits.
  • Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings.
  • Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or on the heteroaryl ring, or wherein the heteroaryl ring, as defined above, is fused with one or more carbocycyl or heterocycyl groups wherein the point of attachment is on the heteroaryl ring.
  • a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-10 membered heteroaryl”).
  • a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-8 membered heteroaryl”).
  • a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-6 membered heteroaryl”).
  • the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen and sulfur.
  • the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen and sulfur.
  • Exemplary 5-membered heteroaryls containing 1 heteroatom include, without limitation, pyrrolyl, furanyl and thiophenyl.
  • Exemplary 5-membered heteroaryls containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl.
  • Exemplary 5-membered heteroaryls containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, thiadiazolyl.
  • Exemplary 5-membered heteroaryls containing 4 heteroatoms include, without limitation, tetrazolyl.
  • Exemplary 6-membered heteroaryls containing 1 heteroatom include, without limitation, pyridinyl.
  • Exemplary 6-membered heteroaryls containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl and pyrazinyl.
  • Exemplary 6-membered heteroaryls containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively.
  • Exemplary 7 membered heteroaryls containing 1 heteroatom include, without limitation, azepinyl, oxepinyl and thiepinyl.
  • Exemplary 5,6-bicyclic heteroaryls include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl.
  • Exemplary 6,6-bicyclic heteroaryls include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl and quinazolinyl.
  • Exemplary tricyclic heteroaryls include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
  • each instance of a heteroaryl group is independently unsubstituted (an “unsubstituted heteroaryl”) or substituted (a “substituted heteroaryl”) with 1, 2, 3, 4, or 5 substituents as described herein.
  • the heteroaryl group is an unsubstituted 5-14 membered heteroaryl.
  • the heteroaryl group is a substituted 5-14 membered heteroaryl.
  • Heteroaralkyl is a subset of “alkyl” and refers to an alkyl group, as defined herein, substituted by a heteroaryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
  • partially unsaturated refers to a ring moiety that includes at least one double or triple bond.
  • partially unsaturated is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl moieties) as herein defined.
  • Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl and heteroaryl groups, as defined herein, are optionally substituted (e.g., “substituted” or “unsubstituted” alkyl, “substituted” or “unsubstituted” alkenyl, “substituted” or “unsubstituted” alkynyl, “substituted” or “unsubstituted” carbocyclyl, “substituted” or “unsubstituted” heterocyclyl, “substituted” or “unsubstituted” aryl or “substituted” or “unsubstituted” heteroaryl group).
  • substituted means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom etc.) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction.
  • a “substituted” group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
  • Exemplary carbon atom substituents include, but are not limited to, halogen (i.e., fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I)), —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR aa , —ON(R bb ) 2 , —N(R bb ) 2 , —N(R bb ) 3 + X ⁇ , —N(OR cc )R bb , —SH, —SR aa , —SSR cc , —C( ⁇ O)R aa , —CO 2 H, —CHO, —C(OR cc ) 2 , —CO 2 R aa , —OC( ⁇ O)R aa , —OCO 2 R aa , —C( ⁇
  • each instance of R aa is, independently, selected from C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R dd groups;
  • each instance of R bb is, independently, selected from hydrogen, —OH, —OR aa , —N(R cc ) 2 , —CN, —C( ⁇ O)R aa , —C( ⁇ O)N(R cc ) 2 , —CO 2 R aa , —SO 2 R aa , C( ⁇ NR cc )OR aa , —C( ⁇ NR cc )N(R cc ) 2 , —SO 2 N(R cc ) 2 , —SO 2 R cc , —SO 2 OR cc , —SOR aa , —C( ⁇ S)N(R cc ) 2 , —C( ⁇ O)SR cc , —C( ⁇ S)SR cc , —P( ⁇ O) 2 R aa , —P( ⁇ O)(R aa ) 2 , —P
  • each instance of R cc is, independently, selected from hydrogen, C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, or two R cc groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R dd groups;
  • each instance of R dd is, independently, selected from halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR ee , —ON(R ff ) 2 , —N(R ff ) 2 , —N(R ff ) 3 + X ⁇ , —N(OR ee )R ff , —SH, —SR ee , —SSR ee , —C( ⁇ O)R ee , —CO 2 H, —CO 2 R ee , —OC( ⁇ O)R ee , —OCO 2 R ee , —C( ⁇ O)N(R ff ) 2 , —OC( ⁇ O)N(R ff ) 2 , —NR ff C( ⁇ O)R ee , —NR ff CO 2 R
  • each instance of R ee is, independently, selected from C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-10 carbocyclyl, C 6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups;
  • each instance of R ff is, independently, selected from hydrogen, C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-10 carbocyclyl, 3-10 membered heterocyclyl, C 6-10 aryl and 5-10 membered heteroaryl, or two R ff groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups; and
  • each instance of R gg is, independently, halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OC 1-6 alkyl, —ON(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 3 X, —NH(C 1-6 alkyl) 2 X, —NH 2 (C 1-6 alkyl)X, —NH 3 X, —N(OC 1-6 alkyl)(C 1-6 alkyl), —N(OH)(C 1-6 alkyl), —NH(OH), —SH, —SC 1-6 alkyl, —SS(C 1-6 alkyl), —C( ⁇ O)(C 1-6 alkyl), —CO 2 H, —CO 2 (C 1-6 alkyl), —OC( ⁇ O)(C 1-6 alkyl), —OCO 2 (C 1-6
  • a “counterion” is a negatively charged group associated with a positively charged quarternary amine in order to maintain electronic neutrality.
  • exemplary counterions include halide ions (e.g., F ⁇ , Cl ⁇ , Br ⁇ , I ⁇ ), NO 3 ⁇ , ClO 4 ⁇ , OH ⁇ , H 2 PO 4 ⁇ , HSO 4 ⁇ , sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate, ethan-1-sulfonic acid-2-sulfonate, and the like) and carboxylate ions (e.g., acetate, ethanoate, prop
  • Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary and quarternary nitrogen atoms.
  • Exemplary nitrogen atom substitutents include, but are not limited to, hydrogen, —OH, —OR aa , —N(R cc ) 2 , —CN, —C( ⁇ O)R aa , —C( ⁇ O)N(R cc ) 2 , —CO 2 R aa , —SO 2 R aa , —C( ⁇ NR bb )R aa , —C( ⁇ NR cc )OR aa , —C( ⁇ NR cc )N(R cc ) 2 , —SO 2 N(R cc ) 2 , —SO 2 R cc , —SO 2 OR cc , —SOR aa , —C( ⁇ S)N(R
  • the substituent present on the nitrogen atom is an amino protecting group.
  • Amino protecting groups include, but are not limited to, —OH, —OR aa , —N(R cc ) 2 , —C( ⁇ O)R aa , —C( ⁇ O)N(R cc ) 2 , —CO 2 R aa , —SO 2 R aa , —C( ⁇ NR cc )R aa , —C( ⁇ NR cc )OR aa , —C( ⁇ NR cc )N(R cc ) 2 , —SO 2 N(R cc ) 2 , —SO 2 R cc , —SO 2 OR cc , —SOR aa , —C( ⁇ S)N(R cc ) 2 , —C( ⁇ O)SR cc , —C( ⁇ S)SR cc , C 1
  • Amino protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis , T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
  • amino protecting groups such as amide groups (e.g., —C( ⁇ O)R aa ) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, p-phenylbenzamide, o-nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N′-dithiobenzyloxycarbonylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o-
  • Amino protecting groups such as carbamate groups include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-(1-adamantyl)-1-methylethyl carbamante, 9-fluorenylmethyl carbamate (Fmo
  • Amino protecting groups such as sulfonamide groups include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulf
  • amino protecting groups include, but are not limited to, phenothiazinyl-(10)-carbonyl derivative, N′-p-toluenesulfonylaminocarbonyl derivative, N′-phenylaminothiocarbonyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted 3,5-d
  • a “leaving group” is an art-understood term referring to a molecular fragment that departs with a pair of electrons in heterolytic bond cleavage, wherein the molecular fragment is an anion or neutral molecule. See, for example, Smith, March Advanced Organic Chemistry 6th ed. (501-502).
  • a “pharmaceutically acceptable form thereof” includes pharmaceutically acceptable salts, hydrates, solvates, prodrugs, tautomers, isomers, and/or polymorphs of a compound of the present invention, as defined below and herein.
  • the term “pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et al., describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19.
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases.
  • Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid
  • organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate,
  • Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N + (C 1-4 alkyl) 4 salts.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
  • the pharmaceutically acceptable form thereof is an isomer.
  • the term “isomer” includes any and all geometric isomers and stereoisomers.
  • “isomers” include cis- and trans-isomers, E- and Z-isomers, R- and S-enantiomers, diastereomers, (D)-isomers, (L)-isomers, racemic mixtures thereof, and other mixtures thereof, as falling within the scope of the invention.
  • the pharmaceutically acceptable form thereof is a tautomer.
  • the term “tautomer” includes two or more interconvertable compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base.
  • Exemplary tautomerizations include keto-to-enol; amide-to-imide; lactam-to-lactim; enamine-to-imine; and enamine-to-(a different) enamine tautomerizations.
  • the pharmaceutically acceptable form thereof is a hydrate or solvate.
  • hydrate refers to a compound non-covalently associated with one or more molecules of water.
  • solvate refers to a compound non-covalently associated with one or more molecules of an organic solvent.
  • the pharmaceutically acceptable form thereof is a prodrug.
  • prodrug refers to a derivative of a parent compound that requires transformation within the body in order to release the parent compound.
  • a prodrug has improved physical and/or delivery properties over the parent compound.
  • Prodrugs are typically designed to enhance pharmaceutically and/or pharmacokinetically based properties associated with the parent compound. The advantage of a prodrug can lie in its physical properties, such as enhanced water solubility for parenteral administration at physiological pH compared to the parent compound, or it enhances absorption from the digestive tract, or it may enhance drug stability for long-term storage.
  • the pharmaceutically acceptable form thereof is a polymorph.
  • polymorph refers to a compound having more than one crystal structure, e.g., resulting from differences in molecular packing and/or molecular conformation of the compound in the solid state.
  • SEQ. ID. NO. Homo sapiens FAAH amino acid sequence:
  • the present invention provides isoxazoline FAAH inhibitor compounds of the formula (I):
  • R a and R d are joined to form a C 3-10 carbocycyl or 3-14 membered heterocyclyl fused ring, and R b and R c are independently selected from —H, C 1-10 alkyl and C 1-10 perhaloalkyl; or
  • R c and R d are joined to form a C 3-10 carbocycyl or 3-14 membered heterocyclyl spiro-fused ring, and R a and R b are independently selected from —H, C 1-10 alkyl and C 1-10 perhaloalkyl;
  • L is a covalent bond or a divalent C 1-6 hydrocarbon group, wherein one, two or three methylene units of L are optionally and independently replaced with one or more oxygen, sulfur or nitrogen atoms;
  • G is selected from —CN, —NO 2 , —S( ⁇ O)R e , —SO 2 R e , —SO 2 NR f R e , —PO 2 R e , —PO 2 OR e , —PO 2 NR f R e , —(C ⁇ O)R e , —(C ⁇ O)OR e , —(C ⁇ O)NR f R e , —Br, —I, —F, —Cl, —OR e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —SR e , —OSO 2 R e , —NR f SO 2 R e , —OPO 2 R e , —OPO 2 OR
  • each R e is selected from C 1-10 alkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocycyl, C 6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl; each R f attached to a nitrogen atom is, independently, selected from —H, C 1-10 alkyl, or an amino protecting group; or R e and R f are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • G is selected from —CN, —NO 2 , —S( ⁇ O)R e , —SO 2 R e , —SO 2 NR f R e , —PO 2 R e , —PO 2 OR e , —PO 2 NR f R e , —(C ⁇ O)R e , —(C ⁇ O)OR e , —(C ⁇ O)NR f R e , —Br, —I, —F, —Cl, —OR e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —SR e , —OSO 2 R e , —NR f SO 2 R e , —OPO 2 R e , —OPO 2 R
  • R e is selected from C 1-10 alkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocycyl, C 6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl; each R f attached to a nitrogen atom is, independently, selected from —H, C 1-10 alkyl, or an amino protecting group; or R e and R f are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • G is not a leaving group, e.g., for example, G is selected from —F, —CN, —NO 2 , —S( ⁇ O)R e , —SO 2 R e , —SO 2 NR f R e , —PO 2 R e , —PO 2 OR e , —PO 2 NR f R e , —(C ⁇ O)R e , —(C ⁇ O)OR e , and —(C ⁇ O)NR f R e .
  • G is selected from —CN and —NO 2 . In certain embodiments, G is —CN. In certain embodiments, G is —NO 2 .
  • G is selected from —S( ⁇ O)R e , —SO 2 R e , and —SO 2 NR f R e . In certain embodiments, G is —S( ⁇ O)R e . In certain embodiments, G is —SO 2 R e . In certain embodiments, G is —SO 2 NR f R e .
  • G is selected from —PO 2 R e , —PO 2 OR e and —PO 2 NR f R e . In certain embodiments, G is —PO 2 R e . In certain embodiments, G is —PO 2 OR e . In certain embodiments, G is —PO 2 NR f R e .
  • G is selected from —(C ⁇ O)R e , —(C ⁇ O)OR e and —(C ⁇ O)NR f R e . In certain embodiments, G is —(C ⁇ O)R e . In certain embodiments, G is —(C ⁇ O)OR e . In certain embodiments, G is —(C ⁇ O)NR f R e .
  • G is a leaving group, e.g., for example, G is selected from —Cl, —Br, —I, —OR e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —SR e , —OSO 2 R e , —NR f SO 2 R e , —OPO 2 R e , —OPO 2 OR e , —NR f PO 2 R e , —NR f PO 2 OR e , —OPO 2 NR f R e , —O(C ⁇ O)R e , —O(C ⁇ O)OR e , —NR f R e , —NR f (C ⁇ O)R e , —NR f (C ⁇ O
  • G is a halogen; i.e., selected from —F, —Cl, —Br and —I.
  • G is —F.
  • G is —Br.
  • G is —I.
  • G is —Cl.
  • G is not a halogen.
  • G is not —Br.
  • G is not —I.
  • G is not —F.
  • G is not —Cl.
  • G is selected from —OR e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —OSO 2 R e , —OPO 2 R e , —OPO 2 OR e , —OPO 2 NR f R e , —O(C ⁇ O)R e , —O(C ⁇ O)OR e , —O(C ⁇ O)NR f R e and —O(C ⁇ NR f )NR f R e .
  • G is selected from —OR e , —O(C ⁇ O)R e , —O(C ⁇ O)OR e , —O(C ⁇ O)NR f R e and —O(C ⁇ NR f )NR f R e .
  • G is selected from —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —OPO 2 NR f R e , —O(C ⁇ O)NR f R e and —O(C ⁇ NR f )NR f R e .
  • G is —OR e .
  • G is —ONR f R e .
  • G is —ONR f (C ⁇ O)R e .
  • G is —ONR f SO 2 R e . In certain embodiments, G is —ONR f PO 2 R e . In certain embodiments, G is —ONR f PO 2 OR e . In certain embodiments, G is —OSO 2 R e . In certain embodiments, G is —OPO 2 R e . In certain embodiments, G is —OPO 2 OR e . In certain embodiments, G is —OPO 2 NR f R e . In certain embodiments, G is —O(C ⁇ O)R e . In certain embodiments, G is —O(C ⁇ O)OR e . In certain embodiments, G is —O(C ⁇ O)NR f R e . In certain embodiments, G is —O(C ⁇ NR f )NR f R e . In certain embodiments, G is —O(C ⁇ NR f )NR f R e . In certain embodiments, G is —O(C
  • G is selected from —OR e and —SR e . In certain embodiments, G is selected from —OR e . In certain embodiments, G is —SR e .
  • G is selected from —NR f SO 2 R e , —NR f PO 2 R e , —NR f PO 2 OR e , —NR f R e , —NR f (C ⁇ O)R e , —NR f (C ⁇ O)OR e , —NR f (C ⁇ NR f )NR f R e , —NR f (C ⁇ NR f )OR e and —[N(R f ) 2 R e ]X ⁇ wherein X ⁇ is a counterion.
  • G is selected from —NR f SO 2 R e , —NR f PO 2 R e , —NR f PO 2 OR e , —NR f R e , —NR f (C ⁇ O)R e and —NR f (C ⁇ O)OR e .
  • G is selected from —NR f SO 2 R e , —NR f R e , —NR f (C ⁇ O)R e and —NR f (C ⁇ O)OR e .
  • G is —NR f SO 2 R e .
  • G is —NR f PO 2 R e .
  • G is —NR f PO 2 OR e . In certain embodiments, G is —NR f R e . In certain embodiments, G is —NR f (C ⁇ O)R e . In certain embodiments, G is —NR f (C ⁇ O)OR e . In certain embodiments, G is —NR f (C ⁇ NR f )NR f R e . In certain embodiments, G is —NR f (C ⁇ NR f )OR e . In certain embodiments, G is —[N(R f ) 2 R e ] + X ⁇ wherein X ⁇ is a counterion.
  • G is selected from —S( ⁇ O)R e , —SO 2 R e , —SO 2 NR f R e , —PO 2 R e , —PO 2 OR e , —PO 2 NR f R e , —(C ⁇ O)R e , —(C ⁇ O)OR e , —(C ⁇ O)NR f R e , —OR e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —SR e , —OSO 2 R e , —NR f SO 2 R e , —OPO 2 R e , —OPO 2 OR e , —NR f PO 2 R e ,
  • R e is selected from C 1-10 alkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocycyl, C 6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl, wherein the alkyl, alkenyl, alkynyl, carbocycyl, aryl, heterocyclyl, and heteroaryl groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups, as defined below and herein.
  • R e is C 1-10 alkyl. In certain embodiments, R e is C 1-6 alkyl. In certain embodiments, R e is C 1-6 alkyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a C 1-5 alkyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a C 1-4 alkyl substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e is a C 1-3 alkyl substituted with 0, 1, 2 or 3 R h groups. In certain embodiments, R e is a C 1-2 alkyl substituted with 0, 1 or 2 R h groups.
  • Exemplary alkyl groups include, but are not limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, neopentyl, and hexyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is a C 1-6 perhaloalkyl. In certain embodiments, R e is a C 1-5 perhaloalkyl. In certain embodiments, R e is a C 1-4 perhaloalkyl. In certain embodiments, R e is a C 1-3 perhaloalkyl. In certain embodiments, R e is a C 1-2 perhaloalkyl.
  • Exemplary R e perhaloalkyl groups include, but are not limited to, —CF 3 , —CF 2 CF 3 , —CF 2 CF 2 CF 3 , —CCl 3 , —CFCl 2 , and —CF 2 Cl.
  • R e is C 2-10 alkenyl. In certain embodiments, R e is C 2-6 alkenyl. In certain embodiments, R e is a C 2-6 alkenyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a C 2-5 alkenyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a C 2-3 alkenyl substituted with 0, 1, 2, or 3 R h groups.
  • alkenyl groups include, but are not limited to, ethenyl, 1-propenyl, 2-propenyl, 1-butenyl, 2-butenyl, butadienyl, pentenyl, pentadienyl and hexenyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is C 2-10 alkynyl. In certain embodiments, R e is C 2-6 alkynyl. In certain embodiments, R e is C 2-6 alkynyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is C 2-5 alkynyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is C 2-4 alkynyl substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e is C 2-3 alkynyl substituted with 0, 1, 2 or 3 R h groups.
  • R e alkynyl groups include, but are not limited to, ethynyl, 1-propynyl, 2-propynyl, 1-butynyl, 2-butynyl, pentynyl and hexynyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is not C 1-6 alkyl (e.g., methyl, ethyl, propyl, isopropyl, aralkyl). In certain embodiments, wherein G is —OR e , then R e is not C 2-6 alkenyl (e.g., allyl).
  • R e is not then R e is not C 1-6 alkyl (e.g., methyl, ethyl, propyl, isopropyl, aralkyl).
  • R e is not C 1-6 alkyl.
  • R e is C 6-14 aryl. In certain embodiments, R e is C 6-10 aryl. In certain embodiments, R e is C 6-10 aryl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is C 6 aryl (e.g., phenyl) substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a C 1-10 aryl (e.g., naphthyl) substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is phenyl. In certain embodiments, R e is phenyl substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e is phenyl substituted with 0, 1, 2 or 3 R h groups. In certain embodiments, R e is phenyl substituted with 0, 1 or 2 R h groups. In certain embodiments, R e is phenyl substituted with 0 or 1 R h groups. In certain embodiments, R e is a disubstituted phenyl (i.e., substituted with 2 R h groups). In certain embodiments, R e is a monosubstituted phenyl (i.e., substituted with 1 R h group). In certain embodiments, R e is an unsubstituted phenyl (i.e., substituted with 0 R h groups).
  • R e is phenyl substituted with at least one ortho R h group. In certain embodiments, R e is phenyl substituted with at least one meta R h group. In certain embodiments, R e is phenyl substituted with at least one para R h group.
  • R e is a phenyl group of the formula:
  • x is 0, 1, 2, 3, 4 or 5, and R h is as defined below and herein.
  • x is 0, 1, 2, 3 or 4.
  • x is 0, 1, 2 or 3.
  • x is 0, 1 or 2.
  • x is 0 or 1.
  • x is 3.
  • R e is a disubstituted phenyl group (i.e., wherein x is 2).
  • R e is a monosubstituted phenyl group (i.e., wherein x is 1).
  • R e is an unsubstituted phenyl group (i.e., wherein x is 0).
  • R e is a substituted or unsubstituted phenyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a naphthyl. In certain embodiments, R e is a naphthyl group of any one of the formulae:
  • R h is as defined below and herein.
  • x is 0, 1, 2, 3 or 4.
  • x is 0, 1, 2 or 3.
  • x is 0, 1 or 2.
  • x is 0 or 1.
  • R e is a trisubstituted naphthyl group (i.e., wherein x is 3).
  • R e is a disubstituted naphthyl group (i.e., wherein x is 2).
  • R e is a monosubstituted naphthyl group (i.e., wherein x is 1).
  • R e is an unsubstituted naphthyl group (i.e., wherein x is 0).
  • R e is a substituted or unsubstituted 1-naphthyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a substituted or unsubstituted 2-naphthyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is not C 10 aryl (e.g., 1-naphthyl, 2-naphthyl).
  • R e is 5-14 membered heteroaryl. In certain embodiments, R e is a 5-10 membered heteroaryl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 5-8 membered heteroaryl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 5-6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e is a 9-10 membered heteroaryl substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e heteroaryl groups include, but are not limited to, pyrrolyl, furanyl and thiophenyl, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl, tetrazolyl, pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl), pyridazinyl (e.g., 3-pyridazinyl, 4-pyridazinyl), pyrimidinyl (e.g.
  • R e is a 5-membered heteroaryl. In certain embodiments, R e is a 5-membered heteroaryl substituted with 0, 1, 2 or 3 R h groups. In certain embodiments, R e is a 5-membered heteroaryl selected pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl and tetrazolyl, wherein such groups are substituted with 0, 1, 2 or 3 R h groups.
  • R e is a 5-membered heteroaryl of the formula:
  • Y a , Y b , Y c and Y d are, independently, selected from CH, CR h , O, S, N, or NR k , with the proviso that at least one of Y a , Y b , Y c and Y d is O, S, N or NR k , and wherein R h and R k are defined below and herein.
  • Y a is O, S, N, or NR k and Y b , Y c and Y d are, independently, selected from CH, CR h , NR k or N.
  • Y a is O, S, N, or NR k and Y b , Y c and Y d are, independently, selected from CH or CR h .
  • Y a is O, S, or NR k
  • Y c is N and Y b and Y d are, independently, selected from CH or CR h .
  • Y b is O, S, or NR k and Y a , Y c and Y d are, independently, selected from CH, CR h or N. In certain embodiments of the above formula (i-d), Y b is O, S, or NR k and Y a , Y c and Y d are, independently, selected from CH or CR h . In certain embodiments of the above formula (i-d), Y b is O, S, or or NR k , Y d is N and Y a and Y c are, independently, selected from CH or CR h .
  • R e is a substituted or unsubstituted 5-membered heteroaryl of any one of the formulae:
  • R e is an unsubstituted 5-membered heteroaryl (i.e., wherein x is 0).
  • R e is a substituted 5-membered heteroaryl (e.g., wherein x is 1 or 2).
  • R e is a monosubstituted 5-membered heteroaryl (i.e., wherein x is 1).
  • R e is a disubstituted 5-membered heteroaryl (i.e., wherein x is 2).
  • x is 0, 1 or 2.
  • x is 0 or 1.
  • R e is not thiazolyl, e.g., of the formula:
  • R h and R k are as defined below and herein.
  • R e is a 6-membered heteroaryl. In certain embodiments, R e is a 6-membered heteroaryl substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e is a 6-membered heteroaryl selected from the group consisting of pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl), pyridazinyl (e.g., 3-pyridazinyl, 4-pyridazinyl), pyrimidinyl (e.g. 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl), pyrazinyl, triazinyl and tetrazinyl, wherein such groups are substituted with 0, 1, 2, 3 or 4 R h groups.
  • pyridinyl e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl
  • pyridazinyl e
  • R e is a 6-membered heteroaryl group of the formula:
  • W a , W b , W c , W d and W e are, independently, selected from CH, CR h or N, with the proviso that at least one of W a , W b , W c , W d , and W e is N, and wherein R h is as defined below and herein.
  • R e is a pyrindinyl group. In certain embodiments, R e is a pyrindinyl group substituted with 0, 1, 2, 3 or 4 R h groups. For example, in certain embodiments, R e is a pyrindinyl group of the formula:
  • R e is an unsubstituted pyrindinyl (i.e., wherein x is 0).
  • R e is a substituted pyrindinyl (e.g., wherein x is 1, 2, 3 or 4).
  • R e is a monosubstituted pyrindinyl (i.e., wherein x is 1).
  • R e is a disubstituted pyrindinyl (i.e., wherein x is 2).
  • R e is a trisubstituted pyrindinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 2-pyrindinyl group, e.g., of the formula (i-e) wherein W a is N and W b , W c , W d and W e are, independently, CH or CR h .
  • R e is a 3-pyrindinyl group, e.g., of the formula (i-e) wherein W b is N and W a , W c , W d and W e are, independently, CH or CR h .
  • R e is a 4-pyrindinyl group, e.g., of the formula (i-e) wherein W c is N and W a , W b , W d and W e are, independently, CH or CR h .
  • R e is a substituted or unsubstituted 2-pyridinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a substituted or unsubstituted 3-pyridinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a substituted or unsubstituted 4-pyridinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a pyridazinyl group. In certain embodiments, R e is a pyridazinyl group substituted with 0, 1, 2 or 3 R h groups. For example, in certain embodiments, R e is a pyridazinyl group of the formula:
  • R e is an unsubstituted pyridazinyl (i.e., wherein x is 0). In certain embodiments, R e is a substituted pyridazinyl (e.g., wherein x is 1, 2 or 3). In certain embodiments, R e is a monosubstituted pyridazinyl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted pyridazinyl (i.e., wherein x is 2).
  • R e is a trisubstituted pyridazinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 3-pyridazinyl group, e.g., of the formula (I-e) wherein W a and W b are N and W c , W d and W e are, independently, CH or CR h .
  • R e is a 4-pyridazinyl group, e.g., of the formula (I-e) wherein W b and W c are N and W a , W d and W e are, independently, CH or CR h .
  • R e is a substituted or unsubstituted 3-pyridazinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a substituted or unsubstituted 4-pyridazinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a pyrimidinyl group. In certain embodiments, R e is a pyrimidinyl group substituted with 0, 1, 2 or 3 R h groups. For example, in certain embodiments, R e is a pyrimidinyl group of the formula:
  • R e is an unsubstituted pyrimidinyl (i.e., wherein x is 0).
  • R e is a substituted pyrimidinyl (e.g., wherein x is 1, 2 or 3).
  • R e is a monosubstituted pyrimidinyl (i.e., wherein x is 1).
  • R e is a disubstituted pyridazinyl (i.e., wherein x is 2).
  • R e is a trisubstituted pyrimidinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 2-pyrimidinyl group, e.g., of the formula (i-e) wherein W a and W e are N and W b , W c and W d are, independently, CH or CR h .
  • R e is a 4-pyrimidinyl group, e.g., of the formula (i-e) wherein W a and W c are N and W b , W d and W e are, independently, CH or CR h .
  • R e is a 5-pyrimidinyl group, e.g., of the formula (i-e) wherein W b and W d are N and W a , W c and W e are, independently, CH or CR h .
  • R e is a substituted or unsubstituted 2-pyrimidinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a substituted or unsubstituted 4-pyrimidinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a substituted or unsubstituted 5-pyrimidinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a pyrazinyl group. In certain embodiments, R e is a pyrazinyl group substituted with 0, 1, 2 or 3 R h groups. For example, in certain embodiments, R e is a pyrazinyl group of the formula:
  • R e is an unsubstituted pyrazinyl (i.e., wherein x is 0).
  • R e is a substituted pyrazinyl (e.g., wherein x is 1, 2 or 3).
  • R e is a monosubstituted pyrazinyl (i.e., wherein x is 1).
  • R e is a disubstituted pyrazinyl (i.e., wherein x is 2).
  • R e is a trisubstituted pyrazinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a substituted or unsubstituted pyrazinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a triazinyl group. In certain embodiments R e is a triazinyl group substituted with 0, 1 or 2 R h groups. For example, in certain embodiments, R e is a triazinyl group of the formula:
  • R e is an unsubstituted pyrazinyl (i.e., wherein x is 0).
  • R e is a substituted pyrazinyl (e.g., wherein x is 1 or 2).
  • R e is a monosubstituted pyrazinyl (i.e., wherein x is 1).
  • R e is a disubstituted pyrazinyl (i.e., wherein x is 2).
  • x is 0, 1 or 2.
  • x is 0 or 1.
  • R e is a substituted or unsubstituted triazinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a tetrazinyl group. In certain embodiments R e is a tetrazinyl group substituted with 0 or 1 R h groups. For example, in certain embodiments, R e is a tetrazinyl group of the formula:
  • R e is an unsubstituted pyrazinyl (i.e., wherein x is 0). In certain embodiments, R e is a substituted pyrazinyl (e.g., wherein x is 1). In certain embodiments, x is 0 or 1.
  • R e is a substituted or unsubstituted tetrazinyl group of any one of the formulae:
  • R h is as defined below and herein.
  • R e is a 9-membered heteroaryl (e.g., a 5,6-bicyclic heteroaryl). In certain embodiments, R e is a 5,6-bicyclic heteroaryl substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is a 5,6-bicyclic heteroaryl selected from indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is a 5,6-bicyclic heteroaryl of the formula:
  • Y e , Y f , Y g , Y i , Y j , Y k and Y m are, independently, C, CH, CR h , O, S, N, or NR k and Y n is C or N, with the proviso that at least one of Y e Y f , Y g is selected from O, S, N or NR k wherein R h and R k are as defined below and herein.
  • R e is a 5,6-bicyclic heteroaryl group of the formula (i-f), wherein Y e is selected from O, S, or NR k , y is C, and Y f , Y g , Y i , Y k and Y m are, independently, C, CH, or CR h .
  • R e is a 5,6-bicyclic heteroaryl group of the formulae:
  • R e is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, R e is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2).
  • R e is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 5,6-bicyclic heteroaryl wherein Y e is selected from O, S, or NR k ; Y g is N; Y n is C; Y f is C, CH, or CR h or N, and Y i , Y j , Y k and Y m are, independently, C, CH, or CR h .
  • R e is a 5,6-bicyclic heteroaryl group of the formulae:
  • R e is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, R e is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2).
  • R e is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 5,6-bicyclic heteroaryl wherein Y e is NR k , S or O; Y m is N; Y n is C; and Y f , Y g , Y i , Y j , and Y k are, independently, C, CH, or CR h .
  • R e is a 5,6-bicyclic heteroaryl group of the formulae:
  • R e is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, R e is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2).
  • R e is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 5,6-bicyclic heteroaryl wherein Y 8 is O, S, or NR k ; Y m is N; Y n is C; and Y e , Y f , Y i , Y j and Y k are, independently, C, CH, or CR h .
  • R e is a 5,6-bicyclic heteroaryl group of the formulae:
  • R e is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, R e is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2).
  • R e is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 5,6-bicyclic heteroaryl wherein Y e is selected from N; Y n is N; and Y f , Y i , Y j , Y k and Y m are, independently, C, CH, or CR h .
  • R e is a 5,6-bicyclic heteroaryl group of the formula:
  • R e is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, R e is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2).
  • R e is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 10-membered heteroaryl (e.g., a 6,6-bicyclic heteroaryl). In certain embodiments, R e is a 6,6-bicyclic heteroaryl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 6,6-bicyclic heteroaryl selected from naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl and quinazolinyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is a 6,6-bicyclic heteroaryl of the formula:
  • W f , W g , W h , W i , W j , W k , W m and W n are, independently, selected from C, CH, CR h or N, with the proviso that at least one of W f , W g , W h , W i , W j , W k , W m and W a is N, and wherein R h is as defined below and herein.
  • R e is a quinolinyl group; e.g., of the formula (i-g) wherein W i is N and W g , W h , W f , W j , W k , W m and W a are, independently, C, CH, or CR h .
  • R e is a quinolinyl group of the formulae:
  • R e is an unsubstituted quinolinyl (i.e., wherein x is 0). In certain embodiments, R e is a substituted quinolinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted quinolinyl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted quinolinyl (i.e., wherein x is 2).
  • R e is a trisubstituted quinolinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is an isoquinolinyl group; e.g., of the formula (i-g) wherein W h is N and W f , W g , W i , W k , W m and W n are, independently, C, CH, or CR h .
  • R e is an isoquinolinyl group of the formulae:
  • R e is an unsubstituted isoquinolinyl (i.e., wherein x is 0).
  • R e is a substituted isoquinolinyl (e.g., wherein x is 1, 2, 3, 4 or 5).
  • R e is a monosubstituted isoquinolinyl (i.e., wherein x is 1).
  • R e is a disubstituted isoquinolinyl (i.e., wherein x is 2).
  • R e is a trisubstituted isoquinolinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a quinoxalinyl group; e.g., of the formula (i-g) wherein W f and W i are N and W g , W h , W j , W k , W m and W n are, independently, C, CH, or CR h .
  • R e is a quinoxalinyl group of the formulae:
  • R e is an unsubstituted quinoxalinyl (i.e., wherein x is 0).
  • R e is a substituted quinoxalinyl (e.g., wherein x is 1, 2, 3, 4 or 5).
  • R e is a monosubstituted quinoxalinyl (i.e., wherein x is 1).
  • R e is a disubstituted quinoxalinyl (i.e., wherein x is 2).
  • R e is a trisubstituted quinoxalinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 3-14 membered heterocyclyl. In certain embodiments, R e is a 3-14 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 5-10 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 5-8 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 5-6 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, R e is a 9-10 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • heterocyclyl R e groups include, but are not limited to, azirdinyl, oxiranyl, thiorenyl, azetidinyl, oxetanyl, thietanyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, pyrrolyl-2,5-dione, dioxolanyl, oxathiolanyl, dithiolanyl, triazolinyl, oxadiazolinyl, thiadiazolinyl, piperidinyl, tetrahydropyranyl, dihydropyridinyl, thianyl, piperazinyl, morpholinyl, dithianyl, dioxanyl, triazinanyl, azepanyl, oxepanyl, thiepan
  • R e is a 6-membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is a 6-membered heterocyclyl selected from piperidinyl, tetrahydropyranyl, dihydropyridinyl, thianyl, piperazinyl, morpholinyl, dithianyl, dioxanyl, and triazinanyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R h groups.
  • R e is a 6-membered heterocyclyl of the formula:
  • W o , W p , W q , W r , and W s are, independently, selected from CH 2 , CHR h , C(R h ) 2 , NR k , O or S, and W t is N, CH, CR h , with the proviso that at least one of W o , W p , W q , W r and W s is selected from N, NR k , O or S, and wherein R h and R k are defined below and herein.
  • R e is a piperidinyl group. In certain embodiments, R e is a piperidinyl group substituted with 0, 1, 2, 3, 4 or 5 R h groups, e.g., of the formulae:
  • R e is an unsubstituted piperidinyl (i.e., wherein x is 0).
  • R e is a substituted piperidinyl (e.g., wherein x is 1, 2, 3, 4 or 5).
  • R e is a monosubstituted piperidinyl (i.e., wherein x is 1).
  • R e is a disubstituted piperidinyl (i.e., wherein x is 2).
  • R e is a trisubstituted piperidinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 1-piperidinyl group, e.g., of the formula (i-h) wherein W t is N and W o , W p , W q , W r , and W s are, independently, selected from CH 2 , CHR h , C(R h ) 2 .
  • R e is a 2-piperidinyl group, e.g., of the formula (i-h) wherein W o is NR k ; W p , W q , W r , and W s are, independently, CHR h , C(R h ) 2 , or CH 2 ; and W t is CH or CR h .
  • R e is a 3-piperidinyl group, e.g., of the formula (i-h) wherein W p is NR k ; W o , W q , W r , and W s are, independently, CHR h , C(R h ) 2 , or CH 2 ; and W t is CH or CR h .
  • R e is a 4-piperidinyl group, e.g., of the formula (i-h) wherein W q is NR k ; W o , W p , W r , and W s are, independently, CHR h , C(R h ) 2 , or CH 2 ; and W t is CH or CR h .
  • R e is a piperazinyl group. In certain embodiments, R e is a piperazinyl group substituted with 0, 1, 2, 3 or 4 R h groups, e.g., of the formulae:
  • R e is an unsubstituted piperazinyl (i.e., wherein x is 0).
  • R e is a substituted piperazinyl (e.g., wherein x is 1, 2, 3, 4 or 5).
  • R e is a monosubstituted piperazinyl (i.e., wherein x is 1).
  • R e is a disubstituted piperazinyl (i.e., wherein x is 2).
  • R e is a trisubstituted piperazinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a 1-piperazinyl group, e.g., of the formula (i-h) wherein W t is N, W q is NR k and W o , W p , W r , and W s are, independently, selected from CH 2 , CHR h , C(R h ) 2 .
  • R e is a 2-piperazinyl group, e.g., of the formula (i-h) wherein W o and W r are independently NR k and W p , W q , W r , and W s are, independently, CHR h , C(R h ) 2 , or CH 2 ; and W t is CH or CR h .
  • R e is a morpholinyl group. In certain embodiments, R e is a morpholinyl group substituted with 0, 1, 2, 3 or 4 R h groups, e.g., of the formulae:
  • R e is an unsubstituted morpholinyl (i.e., wherein x is 0).
  • R e is a substituted morpholinyl (e.g., wherein x is 1, 2, 3, 4 or 5).
  • R e is a monosubstituted morpholinyl (i.e., wherein x is 1).
  • R e is a disubstituted morpholinyl (i.e., wherein x is 2).
  • R e is a trisubstituted morpholinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a morpholinyl group of the formula (i-h) wherein W t is N, W q is O and W o , W p , W r , and W s are, independently, selected from CH 2 , CHR h , C(R h ) 2 .
  • R e is a dioxanyl group. In certain embodiments, R e is a dioxanyl group substituted with 0, 1, 2, 3 or 4 R h groups, e.g., of the formulae:
  • R e is an unsubstituted dioxanyl (i.e., wherein x is 0). In certain embodiments, R e is a substituted dioxanyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, R e is a monosubstituted dioxanyl (i.e., wherein x is 1). In certain embodiments, R e is a disubstituted dioxanyl (i.e., wherein x is 2).
  • R e is a trisubstituted dioxanyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • R e is a dioxanyl group, e.g., of the formula (i-h) wherein W ° and W r are O and W p , W q , W r , and W s are, independently, CHR h , C(R h ) 2 , or CH 2 ; and W t is CH or CR h .
  • 6-membered heterocycyl R e groups encompassed by formula (i-h) include monosaccharide sugars, e.g., for example, pyranosides selected from ribose, arabinose, xylose, lyxose, allose, altrose, glucose, mannose, gulose, iodose, galactose and talose.
  • monosaccharide sugars e.g., for example, pyranosides selected from ribose, arabinose, xylose, lyxose, allose, altrose, glucose, mannose, gulose, iodose, galactose and talose.
  • R e is a C 3-10 carbocycyl. In certain embodiments, R e is a C 3-10 carbocycyl substituted with 0, 1, 2, 3, 4, or 5 R h groups. In certain embodiments, R e is a C 5-8 carbocycyl substituted with 0, 1, 2, 3, 4, or 5 R h groups. In certain embodiments, R e is a C 5-6 carbocycyl substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e is a C g-10 carbocycyl substituted with 0, 1, 2, 3, 4, or 5 R h groups.
  • R e C 3-10 carbocycyl groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cyclohexadienyl, cycloheptyl, and cycloheptadienyl, wherein such groups are substituted with 0, 1, 2, 3, 4, or 5 R h groups.
  • G is selected from —SO 2 NR f R e , —PO 2 NR f R e , —(C ⁇ O)NR f R e , —ONR f R e , —ONR f (C ⁇ O)R e , —ONR f SO 2 R e , —ONR f PO 2 R e , —ONR f PO 2 OR e , —NR f SO 2 R e , —NR f PO 2 R e , —NR f PO 2 OR e , —OPO 2 NR f R e , —NR f R e , —NR f (C ⁇ O)R e , —NR f (C ⁇ O)OR e , —O(C ⁇ O)NR f R e , —NR f (C ⁇ NR f )NR f R e , —O(C(C ⁇ O)NR f R e
  • R f is H or a C 1-10 alkyl group.
  • R f is H
  • R f is a C 1-10 alkyl group. In certain embodiments, R f is C 1-10 alkyl substituted with 0, 1, 2, 3, 4, or 5 R h groups. Exemplary R f alkyl groups include, but are not limited to, methyl, ethyl, propyl, allyl, and benzyl. In certain embodiments, R f an unsubstituted methyl, i.e., —CH 3 . In certain embodiments, R f an unsubstituted ethyl, i.e., —CH 2 CH 3 .
  • R f is an amino protecting group.
  • R f is selected from —OH, —OR i , —N(R k ) 2 , —C( ⁇ O)R i , —C( ⁇ O)N(R k ) 2 , —CO 2 R i , —SO 2 R i , —C( ⁇ NR k )R i , —C( ⁇ NR k )OR i , —C( ⁇ NR k )N(R k ) 2 , —SO 2 N(R k ) 2 , —SO 2 R i , —SO 2 OR i , —SOR i , —C( ⁇ S)N(R k ) 2 , —C( ⁇ O)SR i , —C( ⁇ S)SR i , C 1-10 alkyl (e.g., aralkyl), C 2-10 alkenyl,
  • G is —NR e R f and R f is —H or C 1-3 alkyl, then R e is not C 1-6 alkyl or thiazolyl.
  • R e and R f are not both —CH 3 .
  • R e and R f are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring; e.g., for example, when G is —SO 2 NR f R e , —PO 2 NR f R e , —(C ⁇ O)NR f R e , —ONR f R e , —OPO 2 NR f R e , —NR f R e , —O(C ⁇ O)NR f R e , —NR f (C ⁇ NR f )NR f R e , —O(C ⁇ NR f )NR f R e , and —[N(R f ) 2 R e ] + X ⁇ wherein X ⁇ is a counterion.
  • heterocyclyl ring or heteroaryl ring are substituted with 0, 1, 2, 3, 4 or 5 R h groups, as defined below and herein.
  • R e and R f are joined to form an 3-14 membered heterocyclyl ring. In certain embodiments, R e and R f are joined to form a 3-14 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4 or 5 R h groups. In certain embodiments, and R f are joined to form a 5-10 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4, or 5 R h groups. In certain embodiments, R e and R f are joined to form a 5-8 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4, or 5 R h groups.
  • R e and R f are joined to form a 5-6 membered heterocyclyl ring substituted with 0, 1, 2 or 3 R h groups. In certain embodiments, R e and R f are joined to form a 9-10 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4, or 5 R h groups.
  • R e and R f are joined to form a heterocyclyl group selected from azirdinyl, azetidinyl, pyrrolidinyl, dihydropyrrolyl, pyrrolyl-2,5-dione, triazolinyl, oxadiazolinyl, thiadiazolinyl, piperidinyl, dihydropyridinyl, thianyl, piperazinyl, morpholinyl, triazinanyl, azepanyl, oxepanyl, thiepanyl, azocanyl, indolinyl, isoindolinyl, tetrahydrobenzothienyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, indolinyl, and phthal
  • R e and R f are joined to form a 5-membered heterocyclyl ring selected from the group:
  • R e and R f are joined to form a 6-membered heterocyclyl ring selected from the group:
  • R e and R f are not joined to form a pyrrolidinyl, piperidinyl or azepanyl ring.
  • R e and R f are joined to form a 5-14 membered heteroaryl ring. In certain embodiments, R e and R f are joined to form a 5-14 membered heteroaryl ring substituted with 0, 1, 2, 3, 4, or 5 R h groups. In certain embodiments, R e and R f are joined to form a 5-10 membered heteroaryl ring substituted with 0, 1, 2, 3, 4, or 5 R h groups. In certain embodiments, R e and R f are joined to form a 5-8 membered heteroaryl ring substituted with 0, 1, 2, 3 or 4 R h groups.
  • R e and R f are joined to form a 5-6 membered heteroaryl ring substituted with 0, 1, 2, 3 or 4 R h groups. In certain embodiments, R e and R f are joined to form a 9-10 membered heteroaryl ring substituted with 0, 1, 2, 3, 4, or 5 R h groups.
  • R e and R f are joined to form a 5-membered heteroaryl ring selected from:
  • R h and R k are as defined below and herein.
  • G is —NR f R e , R e and R f are not joined to form a 1,2,4-triazolyl ring, e.g. of the formula:
  • x is 0 or 1
  • R h is as defined below and herein.
  • R e and R f are joined to form a 9-membered heteroaryl (“5,6-bicyclic heteroaryl”) ring selected from:
  • R h and R k are as defined below and herein.
  • each instance of R h is, independently, selected from halogen (fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I)), —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR i , —ON(R k ) 2 , —N(R k ) 2 , —N(R k ) 3 + X ⁇ , —N(OR i )R k , —SH, —SR i , —SSR j , —C( ⁇ O)R i , —CO 2 H, —CHO, —CO 2 R i , —OC( ⁇ O)R i , —OCO 2 R i , —C( ⁇ O)N(R k ) 2 , —OC( ⁇ O)N(R k ) 2 , —OC( ⁇
  • each instance of R i is, independently, selected from C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 1-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R m groups;
  • each instance of R k is, independently, selected from hydrogen, —OH, —OR i , —N(R j ) 2 , —CN, —C( ⁇ O)R i , —C( ⁇ O)N(R j ) 2 , —CO 2 R i , —SO 2 R i , —C( ⁇ NR j )OR i , —C( ⁇ NR j )N(R j ) 2 , —SO 2 N(R j ) 2 , —SO 2 R j , —SO 2 OR j , —SOR j , —C( ⁇ S)N(R h ) 2 , —C( ⁇ O)SR j , —C( ⁇ S)SR j , —P( ⁇ O) 2 R i , —P( ⁇ O)(R i ) 2 , —P( ⁇ O) 2 N(R j ) 2 , —P
  • each instance of R j is, independently, selected from hydrogen, C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, or two Rj groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R m groups;
  • each instance of R m is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —ORo, —ON(R n ) 2 , —N(R n ) 2 , —N(R n ) 3 + X ⁇ , —N(ORo)Rn, —SH, —SR o , —SSR o , —C( ⁇ O)R o , —CO 2 H, —CO 2 R o , —OC( ⁇ O)R o , —OCO 2 R o , —C( ⁇ O)N(R o ) 2 , —OC( ⁇ O)N(R n ) 2 , —NR n C( ⁇ O)R o , —NR n
  • each instance of R o is, independently, selected from C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-10 carbocyclyl, C 6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R p groups;
  • each instance of R n is, independently, selected from hydrogen, C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-10 carbocyclyl, 3-10 membered heterocyclyl, C 6-10 aryl and 5-10 membered heteroaryl, or two R e groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R p groups; and
  • each instance of R p is, independently, fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OC 1-6 alkyl, —ON(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 3 X, —NH(C 1-6 alkyl) 2 X, —NH 2 (C 1-6 alkyl)X, —NH 3 X, —N(OC 1-6 alkyl)(C 1-6 alkyl), —N(OH)(C 1-6 alkyl), —NH(OH), —SH, —SC 1-6 alkyl, —SS(C 1-6 alkyl), —C( ⁇ O)(C 1-6 alkyl), —CO 2 H, —CO 2 (C 1-6
  • R h is selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO 2 , —OH, —OR i , —SR i , —SO 2 H, —SO 3 H, —N(R k ) 2 , —N(R k ) 3 + X ⁇ , —C( ⁇ O)R i , —CO 2 H, —CHO, —CO 2 R i , —OC( ⁇ O)R i , —OCO 2 R i , —C( ⁇ O)N(R k ) 2 , —OC( ⁇ O)N(R k ) 2 , —NR k C( ⁇ O)R i , —NR k CO 2 R i , —NR k C( ⁇ O)N(R k ) 2 , —C( ⁇ NR k
  • R h is selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO 2 , —OH, —OR i , —SR i , —N(R k ) 2 , —N(R k ) 3 + X ⁇ , —C( ⁇ O)R i , —CO 2 R i , —CO 2 H, —OC( ⁇ O)R i , —OCO 2 R i , —C( ⁇ O)N(R k ) 2 , —OC( ⁇ O)N(R k ) 2 , —NR k C( ⁇ O)R i , —NR k CO 2 R i , —NR k C( ⁇ O)N(R k ) 2 , —C( ⁇ O)NR k SO 2 R i , —NR k SO 2 R i ,
  • R h is —OR i , e.g., selected from —OCH 3 , —OCF 3 , —OCH 2 CH 3 , —OCH 2 CF 3 , —OiPr and —OnBu.
  • R h is —SR i , e.g., selected from —SCH 3 .
  • R h is —N(R k ) 2 or —N(R k ) 3 + X ⁇ , e.g., selected from —NH 2 and —NH 3 + X ⁇ .
  • R h is —C( ⁇ O)R i , e.g., selected from —C( ⁇ O)CH 3 .
  • R h is —CO 2 R i , e.g., selected from —CO 2 CH 3
  • R h is —C( ⁇ O)N(R k ) 2 , e.g., selected from —C( ⁇ O)NHOH, —C( ⁇ O)NH 2 , —C( ⁇ O)NHCH 3 , —C( ⁇ O)N(CH 3 ) 2 , —C( ⁇ O)NHCH 2 CH 3 , —C( ⁇ O)NHCH 2 CF 3 —C( ⁇ O)NH(CH 2 ) 1-6 NH 3 + X, —C( ⁇ O)NHCH 2 C( ⁇ O)OCH 3 , —C( ⁇ O)NHCH 2 C( ⁇ O)OH and —C( ⁇ O)NHCH 2 CH 2 OH.
  • R h is —OC( ⁇ O)R i , e.g., selected from —OC( ⁇ O)CH 3 .
  • R h is —OCO 2 R i , e.g., selected from —OCO 2 CH 3 .
  • R h is —OC( ⁇ O)N(R k ) 2 , e.g., selected from —OC( ⁇ O)NH 2 .
  • R h is —NR k C( ⁇ O)R i , e.g., selected from —NHC( ⁇ O)CH 3 .
  • R h is —NR k CO 2 R i , e.g., selected from —NHC( ⁇ O)OCH 3 and —NHC( ⁇ O)OtBu.
  • R h is —NR k C( ⁇ O)N(R k ) 2 , e.g., selected from —NHC( ⁇ O)NH 2 .
  • R h is —C( ⁇ O)NR k SO 2 R i , e.g., selected from —C( ⁇ O)NHSO 2 CH 3 , —C( ⁇ O)NHSO 2 CH 2 CH 3 , —C( ⁇ O)NHSO 2 CH 9 and —C( ⁇ O)NHSO 2 iBu.
  • R h is —NR k SO 2 R i , e.g., selected from —NHSO 2 CH 3 .
  • R h is —SO 2 N(R k ) 2 , e.g., selected from —SO 2 NH 2 , —SO 2 N(CH 3 ) 2 .
  • R h is —SO 2 R i , e.g., selected from —SO 2 CH 3 , —SO 2 CH 2 CH 3 , —SO 2 C 5 H 9 and —SO 2 iBu.
  • R h is C 1-10 alkyl, e.g., selected from —CH 3 , —CH 2 CH 3 , -iPr, -nBu, —CF 3 , —CH 2 CH 2 CO 2 Me, —CH 2 CH 2 CO 2 H and —CH 2 CH 2 CO 2 NH 2 .
  • R h is selected from —C( ⁇ O)R i , —CO 2 H, and —SO 2 R i . In certain embodiments, R h is —C( ⁇ O)R i . In certain embodiments, R h is —SO 2 R i . In certain embodiments, R h is —CO 2 H or —SO 2 CH 3 . In certain embodiments, R h is —CO 2 H. In certain embodiments, R h is —SO 2 CH 3 .
  • each instance of R h is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), iodo (—I), —NH 2 , —NH 3 + X ⁇ , —CN, —NO 2 , —SO 2 CH 3 , —SO 2 CH 2 CH 3 , —SO 2 C 5 H 9 , —SO 2 iBu, —SO 2 NH 2 , —SO 2 N(CH 3 ) 2 , —C(O)NHSO 2 CH 3 , —C( ⁇ O)NHSO 2 CH 2 CH 3 , —C(O)NHSO 2 C 5 H 9 , —C(O)NHSO 2 iBu, —C(O)CH 3 , —CO 2 H, —CO 2 CH 3 , —OC( ⁇ O)CH 3 , —OCO 2 CH 3 , —C( ⁇ O)NHOH, —C( ⁇ O)NH 2 ,
  • R h is a C 6 aryl (e.g., phenyl) substituted with 0, 1, or 2 R m groups. In certain embodiments, R h is a C 6 aryl (e.g., phenyl) substituted with 1 R m group, and R m is —CO 2 H, —CO 2 CH 3 , —CO 2 CH 2 CH 3 , and —C( ⁇ O)NH 2 .
  • R h is a 5-6 membered heteroaryl substituted with 0, 1, or 2 R m groups. In certain embodiments, R h is a 5 membered heteroaryl substituted with 0, 1, or 2 R m groups.
  • Exemplary 5 membered heteroaryl R h groups include, but are not limited to, pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl, and tetrazolyl, wherein such groups are substituted with 0 or 1 R m groups.
  • the R h 5 membered heteroaryl group is selected from pyrazolyl and oxadiazolyl, wherein such groups are substituted with 0 or 1 R m groups.
  • each instance of R i is, independently, selected from C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 1-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is unsubstituted.
  • R i is unsubstituted C 1-10 alkyl. In certain embodiments, R i is C 1-10 perhaloalkyl. In certain embodiments, R i is unsubstituted C 2-10 alkenyl. In certain embodiments, R i is unsubstituted C 2-10 alkynyl. In certain embodiments, R i is unsubstituted C 3-10 carbocyclyl. In certain embodiments, R i is unsubstituted 3-14 membered heterocyclyl. In certain embodiments, R i is unsubstituted C 6-14 aryl. In certain embodiments, R i is unsubstituted 5-14 membered heteroaryl.
  • each instance of R m is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO 2 , —SO 2 H, —SO 3 H, —OH, —OR o , —ON(R n ) 2 , —N(R n ) 2 , —N(R n ) 3 + X ⁇ , —N(OR o )R n , —SH, —SR o , —SSR o , —C( ⁇ O)R o , —CO 2 H, —CO 2 R o , —OC( ⁇ O)R o , —OCO 2 R o , —C( ⁇ O)N(R n ) 2 , —OC( ⁇ O)N(R n ) 2 , —NR n C( ⁇ O)R o ,
  • each instance of R m is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO 2 , —SO 2 H, —SO 3 H, —OH, —OR o , —ON(R n ) 2 , —N(R n ) 2 , —N(R n ) 3 X ⁇ , —N(OR o )R n , —SH, —SR o , —SSR o , —C( ⁇ O)R o , —CO 2 H, —CO 2 R o , —OC( ⁇ O)R o , —OCO 2 R o , —C( ⁇ O)N(R n ) 2 , —OC( ⁇ O)N(R n ) 2 , —NR n C( ⁇ O)R o , —
  • R m is selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —NH 2 , —NH 3 + X ⁇ , —CN, —NO 2 , —SO 2 CH 3 , —SO 2 CH 2 CH 3 , —SO 2 CH 9 , —SO 2 iBu, —SO 2 NH 2 , —SO 2 N(CH 3 ) 2 —C( ⁇ O)NHSO 2 CH 3 , —C( ⁇ O)NHSO 2 CH 2 CH 3 , —C( ⁇ O)NHSO 2 C 5 H 9 , —C( ⁇ O)NHSO 2 iBu, —C( ⁇ O)CH 3 , —CO 2 H, —CO 2 CH 3 , —OC( ⁇ O)CH 3 , —OCO 2 CH 3 , —C( ⁇ O)NHOH, —C( ⁇ O)NH 2 , —C( ⁇ O)NH 2
  • each instance of R k is, independently, selected from —H, —OH, —OR i , —N(R k ) 2 , —C( ⁇ O)R i , —C( ⁇ O)N(R k ) 2 , —CO 2 R i , —SO 2 R i , —C( ⁇ NR k )R i , —C( ⁇ NR k )OR i , —C( ⁇ NR k )N(R k ) 2 , —SO 2 N(R k ) 2 , —SO 2 R i , —SO 2 OR i , —SOR i , —C( ⁇ S)N(R k ) 2 , —C( ⁇ O)SR i , —C( ⁇ S)SR i , C 1-10 alkyl (e.g., aralkyl), C 2-10 alkenyl, C 2-10 alkyn
  • each instance of R k is, independently, selected from —H, —C( ⁇ O)R i , —C( ⁇ O)OR i , —SO 2 R i , or C 1-6 alkyl. In certain embodiments, each instance of R k is, independently, selected from —H or C 1-6 alkyl. In certain embodiments, each instance of R k is, independently, selected from —H and —CH 3 . In certain embodiments, each instance of R k is, independently, selected from —H. In certain embodiments, each instance of R k is, independently, selected from —CH 3 .
  • R a and R d are joined to form a C 3-10 carbocycyl or 3-14 membered heterocyclyl fused ring, and R b and R c are independently selected from —H, C 1-10 alkyl and C 1-10 perhaloalkyl.
  • each of R b and R c independently is selected from —H, C 1-6 alkyl and C 1-6 perhaloalkyl. In certain embodiments, each of R b and R c independently is selected from —H, C 1-3 alkyl and C 1-3 perhaloalkyl. In certain embodiments, each of R b and R c independently is selected from —H, C 1 alkyl and C 1 perhaloalkyl. In certain embodiments, each of R b and R c independently is selected from —H, —CH 3 and —CF 3 . In certain embodiments, each of R b and R c independently is selected from —H and —CH 3 . In certain embodiments, each of R b and R c independently is selected from —H and —CF 3 . In certain embodiments, R b and R c are both —H.
  • R a and R d are joined to form a C 5-7 carbocycyl or 5-7 membered heterocyclyl fused ring. In certain embodiments, R c and R d are joined to form a C 5-7 carbocycyl or 5-7 membered heterocyclyl fused ring of the formula:
  • W 20 , W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , R 15 and R 18 are as defined below and herein, s is 0, 1 or 2, and the dashed line indicates ring fusion.
  • R a and R d are joined to form a C 5-7 carbocycyl fused ring.
  • W 20 , W 21 , W 22 and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • Exemplary C 5-7 carbocycyl groups which R a and R d can be joined to form include, but are not limited to, cyclopentyl, cyclohexyl and cycloheptyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R 15 groups.
  • R a and R d are joined to form a 5-7 membered heterocyclyl fused ring.
  • W 20 is NR 18
  • W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 21 is NR 18
  • W 20 , W 22 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 22 is NR 15
  • W 2 , W 21 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • Exemplary 5-7 membered heterocyclyl groups which R a and R d can be joined to form include, but are not limited to, pyrrolidinyl, pyrazolidinyl, imidazolidinyl, piperidinyl, piperazinyl and azepanyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R 15 groups.
  • R a and R d are joined to form a C 5 carbocycyl or 5-membered heterocyclyl fused ring of the formula:
  • W 20 , W 21 and W 22 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , R 15 and R 18 are as defined below and herein, and the dashed line indicates ring fusion.
  • R a and R d are joined to form a C 5 carbocycyl fused ring (i.e., cyclopentyl) e.g., wherein W 20 , W 21 and W 22 , are, independently, CH 2 , CHR 15 , C(R 15 ) 2 .
  • R a and R d are joined to form a 5-membered heterocycyl fused ring (e.g., pyrrolidinyl), e.g., wherein W 21 is NR 18 , and W 20 , W 22 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • a 5-membered heterocycyl fused ring e.g., pyrrolidinyl
  • R a and R d are joined to form a 5-membered heterocycyl fused ring (e.g., pyrrolidinyl), e.g., wherein W 20 is NR 18 , and W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • a 5-membered heterocycyl fused ring e.g., pyrrolidinyl
  • R a and R d are joined to form a C 6 carbocycyl or 6-membered heterocyclyl fused ring of the formula:
  • W 20 , W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , R 15 and R 18 are as defined below and herein, and the dashed line indicates ring fusion.
  • R a and R d are joined to form a C 6 carbocycyl fused ring (i.e., cyclohexyl) e.g., wherein W 20 , W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 .
  • R a and R d are joined to form a 6-membered heterocycyl fused ring (e.g., piperidinyl), e.g., wherein W 21 is NR 18 , and W 20 , W 22 , and W 2 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • a 6-membered heterocycyl fused ring e.g., piperidinyl
  • R a and R d are joined to form a 6-membered heterocycyl fused ring (e.g., piperidinyl), e.g., wherein W 20 is NR 18 , and W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • a 6-membered heterocycyl fused ring e.g., piperidinyl
  • R a and R d are joined to form a C 7 carbocycyl or 7-membered heterocyclyl ring of the formula:
  • W 20 , W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , R 15 and R 18 are as defined below and herein, and the dashed line indicates ring fusion.
  • R a and R d are joined to form a C 7 carbocycyl ring (i.e., cycloheptyl) e.g., wherein W 20 , W 21 , W 22 , and W 23 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 .
  • R a and R d are joined to form a 7-membered heterocycyl ring (e.g., azepanyl), e.g., wherein W 21 is NR 18 , and W 20 , W 22 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R a and R d are joined to form a 7-membered heterocycyl ring (e.g., azepanyl), e.g., wherein W 22 is NR 18 , and W 20 , W 21 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a C 3-10 carbocycyl or 3-14 membered heterocyclyl spiro-fused ring, and R a and R b are independently selected from —H, C 1-10 alkyl and C 1-10 perhaloalkyl.
  • each of R a and R b independently is selected from —H, C 1-6 alkyl and C 1-6 perhaloalkyl. In certain embodiments, each of R a and R b independently is selected from —H, C 1-3 alkyl and C 1-3 perhaloalkyl. In certain embodiments, each of R a and R b independently is selected from —H, C 1 alkyl and C 1 perhaloalkyl. In certain embodiments, each of R a and R b independently is selected from —H, —CH 3 and —CF 3 . In certain embodiments, each of R a and R b independently is selected from —H and —CH 3 . In certain embodiments, each of R a and R b independently is selected from —H and —CF 3 . In certain embodiments, R e and R b are both —H.
  • R c and R d are joined to form a C 5-7 carbocycyl, a 5-7 membered heterocyclyl, a 5,6-bicyclic carbocycyl, a 6,6-bicyclic carbocycyl, a 5,6-bicyclic heterocyclyl or a 6,6-bicyclic heterocyclyl spiro-fused ring.
  • R c and R d are joined to form a C 5-7 carbocycyl, a 5-7 membered heterocyclyl, a 5,6-bicyclic carbocycyl or 5,6-bicyclic heterocyclyl spiro-fused ring of the formula:
  • W 24 , W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , optionally wherein W 25 and W 26 are substituted with a fused C 6 aryl ring or fused 6-membered heteroaryl ring; t and v are, independently, 0 or 1; and R 15 and R 18 are as defined below and herein.
  • t is 0 and v is 0.
  • t is 0 and v is 1.
  • t is 1 and v is 0.
  • t is 1 and v is 1.
  • R c and R d are joined to form a C 5-7 carbocycyl spiro-fused ring.
  • W 24 , W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , or C(R 15 ) 2 .
  • Exemplary C 5-7 carbocycyl groups which R c and R d can be joined to form include, but are not limited to, cyclopentyl, cyclohexyl and cycloheptyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R 15 groups.
  • R c and R d are joined to form a 5-7 membered heterocyclyl, spiro-fused ring.
  • W 25 is NR 18 and W 26
  • W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 .
  • W 26 is NR 18 and W 24
  • W 25 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 .
  • W 27 is NR 18 and W 24 , W 25 , W 26 , W 28 and W 29 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 .
  • Exemplary 5-7 membered heterocyclyl groups which R c and R d can be joined to form include, but are not limited to, pyrrolidinyl, pyrazolidinyl, imidazolidinyl, piperidinyl, piperazinyl and azepanyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R 15 groups.
  • R c and R d are joined to form a C 5 carbocycyl or 5-membered heterocyclyl spiro-fused ring of the formula:
  • W 25 , W 26 , W 27 and W 28 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 r NR 18 , and R 15 and R 18 are as defined below and herein.
  • R c and R d are joined to form a C 5 carbocycyl spiro-fused ring (e.g., cyclopentyl); e.g., of formula (iii-b) wherein W 25 is NR 18 and W 26 , W 27 and W 28 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 5-membered heterocyclyl spiro-fused ring; e.g., of formula (iii-b) wherein W 26 is NR 18 and W 25 , W 27 and W 28 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a C 6 carbocycyl or 6-membered heterocyclyl spiro-fused ring of the formula:
  • W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , and R 15 and R 18 are as defined below and herein.
  • R c and R d are joined to form a C 6 carbocycyl spiro-fused ring (e.g., cyclohexyl); e.g., of formula (ii-c) wherein W 25 , W 2 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 5-membered heterocyclyl spiro-fused ring; e.g., of formula (ii-c) wherein W 26 is NR 18 and W 25 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 5-membered heterocyclyl spiro-fused ring of formula (ii-c) wherein W 27 is NR 18 and W 25 , W 26 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a C 7 carbocycyl or 7-membered heterocyclyl spiro-fused ring of the formula:
  • W 24 , W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , and R 15 and R 18 are as defined below and herein.
  • R c and R d are joined to form a C 7 carbocycyl spiro-fused ring (e.g., cycloheptyl); e.g., of formula (iii-d) wherein W 24 , W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 7-membered heterocyclyl spiro-fused ring; e.g., of formula (iii-d) wherein W 25 is NR 18 and W 24 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 7-membered heterocyclyl spiro-fused ring wherein W 26 is NR 18 and W 24 , W 25 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 7-membered heterocyclyl spiro-fused ring wherein W 27 is NR 18 and W 24 , W 25 , W 26 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring or a 5,6-bicyclic heterocycyl spiro-fused ring.
  • t and v are both 0, W 25 and W 26 are substituted with a fused C 6 aryl ring or fused 6-membered heteroaryl ring, and W 27 is CH 2 , CHR 15 , C(R 15 ) 2 , and NR 18 , and W 28 is CH 2 , CHR 15 or C(R 15 ) 2 .
  • R c and R d are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring, e.g., wherein t and v are both 0, W 25 and W 26 are substituted with a fused C 6 aryl ring or fused 6-membered heteroaryl ring, and W 27 and W 28 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 . In certain embodiments, W 25 and W 26 are substituted with a fused C 6 aryl ring.
  • R c and R d are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring of the formula:
  • W 27 and W 28 are, independently, CH 2 , CHR 15 , and C(R 15 ) 2 , z is 0, 1, 2, 3 or 4; and R 15 and is defined below and herein.
  • W 27 and W 28 are both CH 2 groups.
  • z is 0, 1, 2, 3 or 4.
  • z is 0, 1, 2 or 3.
  • z is 0, 1 or 2.
  • z is 2.
  • z is 1.
  • z is 0.
  • R c and R d are joined to form a 6,6-bicyclic carbocycyl spiro-fused ring or a 6,6-bicyclic heterocycyl spiro-fused ring.
  • t is 0 and v is 1
  • W 25 and W 26 are substituted with a fused C 6 aryl ring or fused 6-membered heteroaryl ring
  • W 27 and W 28 are independently CH 2 , CHR 15 , C(R 15 ) 2 , and NR 18
  • W 29 is CH 2 , CHR 15 , C(R 15 ) 2 .
  • R c and R d are joined to form a 6,6-bicyclic carbocycyl spiro-fused ring, e.g., wherein t is 0 and v is 1, W 25 and W 26 are substituted with a fused C 6 aryl ring or fused 6-membered heteroaryl ring, and W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 . In certain embodiments, W 25 and W 26 are substituted with a fused C 6 aryl ring.
  • R c and R d are joined to form a 6,6-bicyclic carbocycyl spiro-fused ring of the formula:
  • W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 , and C(R 15 ) 2 , z is 0, 1, 2, 3 or 4, and R 15 is as defined below and herein.
  • W 27 , W 28 and W 29 are each CH 2 groups.
  • z is 0, 1, 2, 3 or 4.
  • z is 0, 1, 2 or 3.
  • z is 0, 1 or 2.
  • z is 2.
  • z is 1.
  • z is 0.
  • R c and R d are joined to form a bridged carbocycyl or bridged heterocycyl spiro-fused ring of the formula:
  • W 30 , W 31 , W 32 , W 33 and W 33 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 ; and W 34 and W 35 are, independently, CH or CR 15 , and and R 15 and R 18 are as defined below and herein.
  • W 30 , W 31 , W 32 , W 33 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 ; W 36 is NR 18 ; and W 34 and W 35 are, independently, CH or CR 15 .
  • W 30 , W 31 , W 32 , W 33 and W 36 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 ; and W 34 and W 35 are, independently, CH or CR 15 .
  • W 34 and W 15 are CH.
  • each instance of R 15 is, independently, selected from halogen (i.e., fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I)), —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR 16 , —ON(R 18 ) 2 , —N(R 18 ) 2 , —N(R 18 ) 3 + X ⁇ , —N(OR 17 )R 18 , —SH, —SR 16 , —SSR 17 , —C( ⁇ O)R 16 , —CO 2 H, —CHO, —CO 2 R 16 , —OC( ⁇ O)R 16 , —OCO 2 R 16 , —C( ⁇ O)N(R 18 ) 2 , —OC( ⁇ O)N(R 18 ) 2 , —NR 18 C( ⁇ O)R 16
  • each instance of R 16 is, independently, selected from C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 19 groups;
  • each instance of R 18 is, independently, selected from hydrogen, —OH, —OR 16 , —N(R 17 ) 2 , —CN, —C( ⁇ O)R 16 , —C( ⁇ O)N(R 17 ) 2 , —CO 2 R 16 , —SO 2 R 16 , —C( ⁇ NR 7 )OR 16 , —C( ⁇ NR 17 )N(R 7 ) 2 , —SO 2 N(R 17 ) 2 , —SO 2 R 17 , —SO 2 OR 17 , —SOR 16 , —C( ⁇ S)N(R 17 ) 2 , —C( ⁇ O)SR 17 , —C( ⁇ S)SR 17 , —P( ⁇ O) 2 R 16 , —P( ⁇ O)(R 16 ) 2 , —P( ⁇ O) 2 N(R 17 ) 2 , —P( ⁇ O)(NR 7 ) 2 , C 1-10 alkyl, C 1
  • each instance of R 17 is, independently, selected from hydrogen, C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl, C 6-14 aryl, and 5-14 membered heteroaryl, or two R 17 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 19 groups;
  • each instance of R 19 is, independently, selected from halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OR 20 , —ON(R 21 ) 2 , —N(R 21 ) 2 , —N(R 21 ) 3 X ⁇ , —N(OR 20 )R 21 , —SH, —SR 20 , —SSR 20 , C( ⁇ O)R 20 , —CO 2 H, —CO 2 R 20 , —OC( ⁇ O)R 20 , —OC 2 R 20 , —C( ⁇ O)N(R 21 ) 2 , —OC( ⁇ O)N(R 21 ) 2 , —NR 21 C( ⁇ O)R 20 , —NR 21 CO 2 R 20 , —NR 21 C( ⁇ O)N(R 21 ) 2 , —C( ⁇ NR 21 )OR 20 , —OC( ⁇ NR 21
  • each instance of R 20 is, independently, selected from C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-10 carbocyclyl, C 6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 22 groups;
  • each instance of R 21 is, independently, selected from hydrogen, C 1-6 alkyl, C 1-6 perhaloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 1-10 carbocyclyl, 3-10 membered heterocyclyl, C 6-10 aryl and 5-10 membered heteroaryl, or two R21 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 22 groups; and
  • each instance of R 22 is, independently, halogen, —CN, —NO 2 , —N 3 , —SO 2 H, —SO 3 H, —OH, —OC 1-6 alkyl, —ON(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 2 , —N(C 1-6 alkyl) 3 X, —NH(C 1-6 alkyl) 2 X, —NH 2 (C 1-6 alkyl)X, —NH 3 X, —N(OC 1-6 alkyl)(C 1-6 alkyl), —N(OH)(C 1-6 alkyl), —NH(OH), —SH, —SC 1-6 alkyl, —SS(C 1-6 alkyl), —C( ⁇ O)(C 1-6 alkyl), —CO 2 H, —CO 2 (C 1-6 alkyl), —OC( ⁇ O)C 1-6 alkyl), —OCO 2 (C 1-6 alky
  • each instance of R 15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —OR 16 , —C( ⁇ O)N(R 18 ) 2 , —SO 2 N(R 18 ) 2 , C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 19 groups.
  • R 15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —OR 16 and C 1-10 perhaloalkyl. In certain embodiments, R 15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I) and —OR 16 . In certain embodiments, R 15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I) and C 1-10 perhaloalkyl.
  • R 15 is selected from —OR 16 and C 1-10 perhaloalkyl.
  • R 15 is —OR 6 .
  • R 16 is selected from C 1-10 alkyl, C 1-10 perhaloalkyl, C 2-10 alkenyl, C 2-10 alkynyl, C 6-10 aryl, and 5-6 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R 19 groups.
  • R 15 is —OR 16 , and R 16 is selected from C 1-10 alkyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 1-6 alkyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 1-4 alkyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 1-2 alkyl. In certain embodiments, R 15 is —OR 16 and R 16 is —CH 3 , -Et, -iPr, -nBu, -n-pentyl. In certain embodiments, R 15 is —OR 16 and R 16 is —CH 3 .
  • R 15 is —OR 16 , and R 16 is selected from C 1-10 perhaloalkyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 1-6 perhaloalkyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 1-4 perhaloalkyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 1-2 perhaloalkyl. In certain embodiments, R 15 is —OR 16 and R 16 is —CF 3 , —CF 2 CF 3 , —CF 2 CF 2 CF 3 , —CCl 3 , —CFCl 2 , or —CF 2 Cl. In certain embodiments, R 15 is —OR 16 and R 16 is —CF 3 .
  • R 15 is —OR 16 , and R 16 is selected from C 2-10 alkenyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 2-6 alkenyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 2-4 alkenyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from —CH 2 CHCH 2 (i.e., allyl).
  • R 15 is —OR 16 , and R 16 is selected from C 2-10 alkynyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 2-6 alkynyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from C 2-4 alkynyl. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from —CH 2 CCH (i.e., propargyl).
  • R 15 is —OR 16 , and R 16 is selected from C 6 aryl (e.g., phenyl) substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is —OR 16 , and R 16 is phenyl substituted with 0, 1 or 2 R 19 groups. In certain embodiments, R 15 is —OR 16 , and R 16 is phenyl substituted with 1 R 19 groups. In certain embodiments, R 15 is —OR 16 , and R 16 is phenyl substituted with 0 R 19 groups (i.e., —C 6 H 5 ).
  • R 15 is —OR 16 , and R 16 is selected from 5-6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from a 6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is —OR 16 , and R 16 is selected from pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl) substituted with 0, 1, 2, 3 or 4 R 19 groups.
  • pyridinyl e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl
  • R 15 is —OR 16
  • R 16 is selected from pyrimidinyl (e.g., 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl) substituted with 0, 1, 2 or 3 R 19 groups.
  • R 15 is —C( ⁇ O)N(R 18 ) 2 .
  • R 15 is —SO 2 N(R 18 ) 2 .
  • R 15 is C 1-10 perhaloalkyl. In certain embodiments, R 15 is C 1-6 perhaloalkyl. In certain embodiments, R 15 is C 1-4 perhaloalkyl. In certain embodiments, R 15 is C 1-2 perhaloalkyl. In certain embodiments, R 15 is selected from —CF 3 , —CF 2 CF 3 , —CF 2 CF 2 CF 3 , —CCl 3 , —CFCl 2 , and —CF 2 Cl. In certain embodiments, R 15 is selected from —CF 3 .
  • R 15 is C 1-10 alkyl substituted with 0, 1, 2, 3, 4, or 5 R 19 groups. In certain embodiments, R 15 is C 1-6 alkyl substituted with 0, 1, 2, 3, 4, or 5 R 19 groups.
  • R 15 is C 1-4 alkyl substituted with 0, 1, 2, 3, 4, or 5 R 19 groups. In certain embodiments, the R 15 alkyl group is unsubstituted (0 R 19 groups). In certain embodiments, R 15 is —CH 3 , -Et, -iPr, -nBu, -n-pentyl.
  • R 15 is C 2-10 alkenyl substituted with 0, 1, 2, 3, 4, or 5 R 19 groups. In certain embodiments, R 15 is C 2-6 alkenyl substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is C 2-4 alkenyl substituted with 0, 1, 2 or 3 R 19 groups. In certain embodiments, the R 15 alkenyl group is unsubstituted (0 R 19 groups). In certain embodiments, R 15 is —CH 2 CHCH 2 (i.e., allyl),
  • R 15 is C 2-10 alkynyl substituted with 0, 1, 2, 3, 4, or 5 R 19 groups. In certain embodiments, R 15 is C 2-6 alkynyl substituted with 0, 1, 2 or 3 R 19 groups. In certain embodiments, R 15 is C 2-4 alkynyl substituted with 0, 1 or 2 R 19 groups. In certain embodiments, the R 15 alkynyl group is unsubstituted (0 R 19 groups). In certain embodiments, R 15 is —CH 2 CCH (i.e., propargyl).
  • R 15 is C 6-14 aryl. In certain embodiments, R 15 is selected from C 6 aryl (e.g., phenyl) substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is an unsubstituted phenyl. In certain embodiments, R 15 is a monosubstituted phenyl (i.e., substituted with 1 R 19 group).
  • R 15 is 5-14 membered heteroaryl substituted with 0, 1, 2, 3, 4, or 5 R 19 groups. In certain embodiments, R 15 is 5-6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is a 6-membered heteroaryl substituted with 0, 1, 2, 3 or 4 R 19 groups. In certain embodiments, R 15 is pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl) substituted with 0, 1, 2, 3 or 4 R 19 groups.
  • pyridinyl e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl
  • R 15 is pyrimidinyl (e.g., 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl) substituted with 0, 1, 2 or 3 R 19 groups.
  • the R 15 heteroaryl group is unsubstituted (0 R 19 groups).
  • each instance of R 18 is, independently, selected from —H, —OH, —OR 16 , —N(R 17 ) 2 , —C( ⁇ O)R 16 , —C( ⁇ O)N(R 17 ) 2 , —CO 2 R 16 , —SO 2 R 16 , —C( ⁇ NR 7 )R 16 , —C( ⁇ NR 17 )OR 16 , —C( ⁇ NR 17 )N(R 17 ) 2 , —SO 2 N(R 17 ) 2 , —SO 2 R 16 , —SO 2 OR 16 , —SOR 16 , —C( ⁇ S)N(R 7 ) 2 , —C( ⁇ O)SR16, —C( ⁇ S)SR 16 , C 1-10 alkyl (e.g., aralkyl), C 2-10 alkenyl, C 2-10 alkynyl, C 3-10 carbocyclyl, 3-14 membered heterocyclyl,
  • each instance of R 17 is, independently, selected from —H, —C( ⁇ O)R 16 , —C( ⁇ O)OR 16 , —SO 2 R 16 , or C 1-6 alkyl. In certain embodiments, each instance of R 17 is, independently, selected from —H or C 1-6 alkyl. In certain embodiments, each instance of R 17 is, independently, selected from —H and —CH 3 . In certain embodiments, each instance of R 17 is, independently, selected from —H. In certain embodiments, each instance of R 17 is, independently, selected from —CH 3 .
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 21 is NR 18
  • W 20 , W 22 , and W 23 are, independently, CH 2 , CHR 1S or C(R 15 ) 2
  • the present invention provides compounds of the formula (IV-b):
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 21 is NR 18
  • W 20 , W 22 , and W 23 are, independently, CH 2 , CHR 1S or C(R 15 ) 2
  • the present invention provides compounds of the formula (IV-d):
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 22 is NR 18
  • W 20 , W 21 , and W 23 are, independently, CH 2 , CHR 1S or C(R 15 ) 2
  • the present invention provides compounds of the formula (IV-e):
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 22 is NR 18
  • W 20 , W 21 , and W 23 are, independently, CH 2 , CHR 15 or C(R 15 ) 2
  • the present invention provides compounds of the formula (IV-g):
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 24 , W 26 , W 27 , W 28 and W 30 are, independently, CH 2 , CHR 15 , C(R 15 ) 2 or NR 18 , optionally wherein W 25 and W 26 are substituted with a fused C 6 aryl ring or fused 6-membered heteroaryl ring; t and v are, independently, 0 or 1; wherein G, R a , R b , R 15 and R 18 are as defined above and herein.
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • t is 0 and v is 0.
  • t is 0 and v is 1.
  • t is 1 and v is 0.
  • t is 1 and v is 1.
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 27 is NR 18 and W 25 , W 26 and W 28 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 25 , W 26 , W 27 and W 28 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 26 is NR 18 and W 25 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 27 is NR 18 and W 25 , W 26 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 . In certain embodiments, W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 25 is NR 18 and W 24 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 26 is NR 18 and W 24 , W 25 , W 27 , W 28 and W Z are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 27 is NR 18 and W 24 , W 25 , W 26 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • W 24 , W 25 , W 26 , W 27 , W 28 and W 29 are, independently, CH 2 , CHR 15 or C(R 15 ) 2 .
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • W 27 and W 28 are, independently, CH 2 , CHR 15 and C(R 15 ) 2 , and W 25 and W 26 are substituted with a fused C 6 aryl ring, R c and R d are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring of the formula (V-g):
  • G, R a , R b and R 15 are as defined above and herein.
  • R a and R b are —H.
  • z is 1.
  • G is —OR e .
  • G is —Br.
  • G is not halogen (e.g., —Br, —Cl, —I).
  • R 15 is selected from —OR 16 and C 1-10 perhaloalkyl.
  • the compound is any one of the compounds provided in Table 1a, or a pharmaceutically acceptable form thereof:
  • the compound is any one of the compounds provided in Table 1b, or a pharmaceutically acceptable form thereof:
  • the compound is any one of the compounds provided in Table 1c, or a pharmaceutically acceptable form thereof:
  • the compound is any one of the compounds provided in Table 1d, or a pharmaceutically acceptable form thereof:
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising a compound of the formula (I) or a pharmaceutically acceptable form thereof, and a pharmaceutically acceptable excipient.
  • compositions agents include any and all solvents, diluents or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • General considerations in the formulation and/or manufacture of pharmaceutical compositions agents can be found, for example, in Remington's Pharmaceutical Sciences , Sixteenth Edition, E. W. Martin (Mack Publishing Co., Easton, Pa., 1980), and Remington: The Science and Practice of Pharmacy, 21 st Edition (Lippincott Williams & Wilkins, 2005).
  • compositions described herein can be prepared by any method known in the art of pharmacology. In general, such preparatory methods include the steps of bringing the active ingredient into association with a carrier and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
  • compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
  • a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
  • the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
  • Relative amounts of the active ingredient, the pharmaceutically acceptable carrier, and/or any additional ingredients in a pharmaceutical composition of the invention will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
  • the composition may comprise between 0.1% and 100% (w/w) active ingredient.
  • compositions used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
  • Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and combinations thereof.
  • Exemplary granulating and/or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, etc., and combinations thereof.
  • cross-linked poly(vinyl-pyrrolidone) crospovidone
  • sodium carboxymethyl starch sodium starch glycolate
  • Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and Veegum [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g.
  • stearyl alcohol cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g. carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g.
  • Cremophor polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [Brij 30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic F 68, Poloxamer 188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and/or combinations thereof.
  • polyoxyethylene ethers e.g. polyoxyethylene lauryl ether [Brij 30]
  • poly(vinyl-pyrrolidone) diethylene glycol monolaurate
  • triethanolamine oleate sodium oleate
  • potassium oleate ethyl oleate
  • oleic acid ethyl laurate
  • Exemplary binding agents include starch (e.g. cornstarch and starch paste), gelatin, sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g.
  • acacia sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, etc., and/or combinations thereof.
  • Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and other preservatives.
  • antioxidants include alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
  • Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof.
  • EDTA ethylenediaminetetraacetic acid
  • salts and hydrates thereof e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like
  • citric acid and salts and hydrates thereof e.g., citric acid mono
  • antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
  • antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
  • Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
  • Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
  • preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant Plus, Phenonip, methylparaben, Germall 115, Germaben II, Neolone, Kathon, and Euxyl.
  • the preservative is an anti-oxidant.
  • the preservative is a chelating agent.
  • Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer
  • Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.
  • oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn,
  • oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and combinations thereof.
  • Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs.
  • the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • inert diluents commonly used in the art such as, for example, water or other solvents, so
  • the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
  • adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents.
  • the conjugates of the invention are mixed with solubilizing agents such as Cremophor, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and combinations thereof.
  • sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents.
  • the sterile injectable preparation can be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
  • acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P. and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil can be employed including synthetic mono- or diglycerides.
  • fatty acids such as oleic acid are used in the preparation of injectables.
  • the injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
  • compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing the conjugates of this invention with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
  • the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol mono
  • Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
  • the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes.
  • Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polethylene glycols and the like.
  • the active ingredients can be in micro-encapsulated form with one or more excipients as noted above.
  • the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings and other coatings well known in the pharmaceutical formulating art.
  • the active ingredient can be admixed with at least one inert diluent such as sucrose, lactose or starch.
  • Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose.
  • the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
  • opacifying agents include polymeric substances and waxes.
  • Dosage forms for topical and/or transdermal administration of a compound of this invention may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants and/or patches.
  • the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier and/or any needed preservatives and/or buffers as can be required.
  • the present invention contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body.
  • Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium.
  • the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.
  • Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices such as those described in U.S. Pat. Nos. 4,886,499; 5,190,521; 5,328,483; 5,527,288; 4,270,537; 5,015,235; 5,141,496; and 5,417,662.
  • Intradermal compositions can be administered by devices which limit the effective penetration length of a needle into the skin, such as those described in PCT publication WO 99/34850 and functional equivalents thereof.
  • Jet injection devices which deliver liquid vaccines to the dermis via a liquid jet injector and/or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable.
  • Jet injection devices are described, for example, in U.S. Pat. Nos. 5,480,381; 5,599,302; 5,334,144; 5,993,412; 5,649,912; 5,569,189; 5,704,911; 5,383,851; 5,893,397; 5,466,220; 5,339,163; 5,312,335; 5,503,627; 5,064,413; 5,520,639; 4,596,556; 4,790,824; 4,941,880; 4,940,460; and PCT publications WO 97/37705 and WO 97/13537.
  • Ballistic powder/particle delivery devices which use compressed gas to accelerate vaccine in powder form through the outer layers of the skin to the dermis are suitable.
  • conventional syringes can be used in the classical mantoux method of intradermal administration.
  • Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions.
  • Topically-administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent.
  • Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition of the invention can be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity.
  • a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers or from about 1 to about 6 nanometers.
  • Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and/or using a self propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container.
  • Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers.
  • Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
  • Low boiling propellants generally include liquid propellants having a boiling point of below 65° F. at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition.
  • the propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
  • compositions of the invention formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension.
  • Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device.
  • Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate.
  • the droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.
  • formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition of the invention.
  • Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered, by rapid inhalation through the nasal passage from a container of the powder held close to the nares.
  • Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition of the invention can be prepared, packaged, and/or sold in a formulation suitable for buccal administration.
  • Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
  • formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient.
  • Such powdered, aerosolized, and/or aerosolized formulations when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
  • a pharmaceutical composition of the invention can be prepared, packaged, and/or sold in a formulation suitable for ophthalmic administration.
  • Such formulations may, for example, be in the form of eye drops including, for example, a 0.1/1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid carrier.
  • Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein.
  • Other opthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are contemplated as being within the scope of this invention.
  • compositions are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation. General considerations in the formulation and/or manufacture of pharmaceutical compositions can be found, for example, in Remington: The Science and Practice of Pharmacy 21 st ed., Lippincott Williams & Wilkins, 2005.
  • compositions and/or kits may comprise a provided composition and a container (e.g., a vial, ampoule, bottle, syringe, and/or dispenser package, or other suitable container).
  • a container e.g., a vial, ampoule, bottle, syringe, and/or dispenser package, or other suitable container.
  • provided kits may optionally further include a second container comprising a suitable aqueous carrier for dilution or suspension of the provided composition for preparation of administration to a subject.
  • contents of provided formulation container and solvent container combine to form at least one unit dosage form.
  • a provided composition of the invention can be useful in conjunction with subject controlled analgesia (PCA) devices, wherein a subject can administer, for example, opioid analgesia as required for pain management.
  • PCA subject controlled analgesia
  • a single container may comprise one or more compartments for containing a provided composition, and/or appropriate aqueous carrier for suspension or dilution.
  • a single container can be appropriate for modification such that the container may receive a physical modification so as to allow combination of compartments and/or components of individual compartments.
  • a foil or plastic bag may comprise two or more compartments separated by a perforated seal which can be broken so as to allow combination of contents of two individual compartments once the signal to break the seal is generated.
  • a pharmaceutical pack or kit may thus comprise such multi-compartment containers including a provided composition and appropriate solvent and/or appropriate aqueous carrier for suspension.
  • instructions for use are additionally provided in such kits of the invention.
  • Such instructions may provide, generally, for example, instructions for dosage and administration.
  • instructions may further provide additional detail relating to specialized instructions for particular containers and/or systems for administration.
  • instructions may provide specialized instructions for use in conjunction and/or in combination with additional therapy.
  • the formulations of the invention can be used in conjunction with opioid analgesia administration, which may, optionally, comprise use of a subject controlled analgesia (PCA) device.
  • PCA subject controlled analgesia
  • instructions for use of provided formulations may comprise instructions for use in conjunction with PCA administration devices.
  • the present invention provides methods for treating a FAAH-mediated condition comprising administering to a subject in need thereof a therapeutically effective amount of a compound of formula (I) or a pharmaceutically acceptable form thereof.
  • the present invention also provides methods for inhibiting FAAH in a subject comprising administering to a subject in need thereof a therapeutically effective amount of a compound of formula (I) or a pharmaceutically acceptable form thereof.
  • the present invention also provides a method of inhibiting activation of the FAAH pathway in vitro or ex vivo, comprising contacting a FAAH protein with a compound of formula (I) in an amount sufficient to reduce the activation of the FAAH pathway.
  • the present invention also provides use of a compound of formula (I) for the treatment of a FAAH-mediated condition in a subject.
  • the present invention also provides use of a compound of formula (I) in the manufacture of a medicament.
  • the medicament is useful for treating a FAAH-mediated condition.
  • a “subject” to which administration is contemplated includes, but is not limited to, humans (i.e., a male or female of any age group, e.g., a pediatric subject (e.g, infant, child, adolescent) or adult subject (e.g., young adult, middle-aged adult or senior adult)) and/or other primates (e.g., cynomolgus monkeys, rhesus monkeys); mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, goats, cats, and/or dogs; and/or birds, including commercially relevant birds such as chickens, ducks, geese, and/or turkeys.
  • humans i.e., a male or female of any age group, e.g., a pediatric subject (e.g, infant, child, adolescent) or adult subject (e.g., young adult, middle-aged adult or senior adult)) and/or other primates (e.g., cy
  • the terms “treat,” “treating” and “treatment” contemplate an action that occurs while a subject is suffering from the specified disease, disorder or condition, which reduces the severity of the disease, disorder or condition, or retards or slows the progression of the disease, disorder or condition.
  • the terms “prevent,” “preventing” and “prevention” contemplate an action that occurs before a subject begins to suffer from the specified disease, disorder or condition, which inhibits or reduces the severity of the disease, disorder or condition.
  • the terms “manage,” “managing” and “management” encompass preventing the recurrence of the specified disease, disorder or condition in a subject who has already suffered from the disease, disorder or condition, and/or lengthening the time that a subject who has suffered from the disease, disorder or condition remains in remission.
  • the terms encompass modulating the threshold, development and/or duration of the disease, disorder or condition, or changing the way that a subject responds to the disease, disorder or condition.
  • a “therapeutically effective amount” of a compound is an amount sufficient to provide a therapeutic benefit in the treatment or management of a disease, disorder or condition, or to delay or minimize one or more symptoms associated with the disease, disorder or condition.
  • a therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment or management of the disease, disorder or condition.
  • the term “therapeutically effective amount” can encompass an amount that improves overall therapy, reduces or avoids symptoms or causes of disease or condition, or enhances the therapeutic efficacy of another therapeutic agent.
  • a “prophylactically effective amount” of a compound is an amount sufficient to prevent a disease, disorder or condition, or one or more symptoms associated with the disease, disorder or condition, or prevent its recurrence.
  • a prophylactically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other agents, which provides a prophylactic benefit in the prevention of the disease, disorder or condition.
  • the term “prophylactically effective amount” can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
  • inhibitor refers to the ability of a compound to reduce, slow, halt or prevent activity of a particular biological process (e.g., FAAH activity) in a cell relative to vehicle.
  • a particular biological process e.g., FAAH activity
  • FAAH-mediated condition refers to a disease, disorder or condition which is treatable by inhibition of FAAH activity. “Disease”, “disorder” or “condition” are terms used interchangeably herein. FAAH-mediated conditions include, but are not limited to, painful conditions, inflammatory conditions, immune disorders, disorders of the central nervous system, metabolic disorders, cardiac disorders and glaucoma.
  • the FAAH-mediated condition is a painful condition.
  • a “painful condition” includes, but is not limited to, neuropathic pain (e.g., peripheral neuropathic pain), central pain, deafferentiation pain, chronic pain (e.g., chronic nociceptive pain, and other forms of chronic pain such as post-operative pain, e.g., pain arising after hip, knee, or other replacement surgery), pre-operative pain, stimulus of nociceptive receptors (nociceptive pain), acute pain (e.g., phantom and transient acute pain), non-inflammatory pain, inflammatory pain, pain associated with cancer, wound pain, burn pain, post-operative pain, pain associated with medical procedures, pain resulting from pruritus, painful bladder syndrome, pain associated with premenstrual dysphoric disorder and/or premenstrual syndrome, pain associated with chronic fatigue syndrome, pain associated with pre-term labor, pain associated with withdrawl symptoms from drug addiction, joint pain, arthritic pain (e.g., neuropathic pain (e
  • One or more of the painful conditions contemplated herein can comprise mixtures of various types of pain provided above and herein (e.g. nociceptive pain, inflammatory pain, neuropathic pain, etc.). In some embodiments, a particular pain can dominate. In other embodiments, the painful condition comprises two or more types of pains without one dominating. A skilled clinician can determine the dosage to achieve a therapeutically effective amount for a particular subject based on the painful condition.
  • the painful condition is neuropathic pain.
  • neuropathic pain refers to pain resulting from injury to a nerve.
  • Neuropathic pain is distinguished from nociceptive pain, which is the pain caused by acute tissue injury involving small cutaneous nerves or small nerves in muscle or connective tissue.
  • Neuropathic pain typically is long-lasting or chronic and often develops days or months following an initial acute tissue injury.
  • Neuropathic pain can involve persistent, spontaneous pain as well as allodynia, which is a painful response to a stimulus that normally is not painful.
  • Neuropathic pain also can be characterized by hyperalgesia, in which there is an accentuated response to a painful stimulus that usually is trivial, such as a pin prick.
  • Neuropathic pain conditions can develop following neuronal injury and the resulting pain may persist for months or years, even after the original injury has healed. Neuronal injury may occur in the peripheral nerves, dorsal roots, spinal cord or certain regions in the brain.
  • Neuropathic pain conditions include, but are not limited to, diabetic neuropathy (e.g., peripheral diabetic neuropathy); sciatica; non-specific lower back pain; multiple sclerosis pain; carpal tunnel syndrome, fibromyalgia; HIV-related neuropathy; neuralgia (e.g., post-herpetic neuralgia, trigeminal neuralgia); pain resulting from physical trauma (e.g., amputation; surgery, invasive medical procedures, toxins, burns, infection), pain resulting from cancer or chemotherapy (e.g., chemotherapy-induced pain such as chemotherapy-induced peripheral neuropathy), and pain resulting from an inflammatory condition (e.g., a chronic inflammatory condition).
  • diabetic neuropathy e.g., peripheral diabetic neuropathy
  • Neuropathic pain can result from a peripheral nerve disorder such as neuroma; nerve compression; nerve crush, nerve stretch or incomplete nerve transsection; mononeuropathy or polyneuropathy.
  • Neuropathic pain can also result from a disorder such as dorsal root ganglion compression; inflammation of the spinal cord; contusion, tumor or hemisection of the spinal cord; tumors of the brainstem, thalamus or cortex; or trauma to the brainstem, thalamus or cortex.
  • neuropathic pain The symptoms of neuropathic pain are heterogeneous and are often described as spontaneous shooting and lancinating pain, or ongoing, burning pain.
  • pain associated with normally non-painful sensations such as “pins and needles” (paraesthesias and dysesthesias), increased sensitivity to touch (hyperesthesia), painful sensation following innocuous stimulation (dynamic, static or thermal allodynia), increased sensitivity to noxious stimuli (thermal, cold, mechanical hyperalgesia), continuing pain sensation after removal of the stimulation (hyperpathia) or an absence of or deficit in selective sensory pathways (hypoalgesia).
  • the painful condition is non-inflammatory pain.
  • the types of non-inflammatory pain include, without limitation, peripheral neuropathic pain (e.g., pain caused by a lesion or dysfunction in the peripheral nervous system), central pain (e.g., pain caused by a lesion or dysfunction of the central nervous system), deafferentation pain (e.g., pain due to loss of sensory input to the central nervous system), chronic nociceptive pain (e.g., certain types of cancer pain), noxious stimulus of nociceptive receptors (e.g., pain felt in response to tissue damage or impending tissue damage), phantom pain (e.g., pain felt in a part of the body that no longer exists, such as a limb that has been amputated), pain felt by psychiatric subjects (e.g., pain where no physical cause may exist), and wandering pain (e.g., wherein the pain repeatedly changes location in the body).
  • peripheral neuropathic pain e.g., pain caused by a lesion or dysfunction in the peripheral
  • the painful condition is inflammatory pain.
  • the painful condition e.g., inflammatory pain
  • the painful condition is associated with an inflammatory condition and/or an immune disorder.
  • the FAAH-mediated condition is an inflammatory condition.
  • the term “inflammatory condition” refers to those diseases, disorders or conditions that are characterized by signs of pain (dolor, from the generation of noxious substances and the stimulation of nerves), heat (calor, from vasodilatation), redness (rubor, from vasodilatation and increased blood flow), swelling (tumor, from excessive inflow or restricted outflow of fluid), and/or loss of function (functio laesa, which can be partial or complete, temporary or permanent.
  • Inflammation takes on many forms and includes, but is not limited to, acute, adhesive, atrophic, catarrhal, chronic, cirrhotic, diffuse, disseminated, exudative, fibrinous, fibrosing, focal, granulomatous, hyperplastic, hypertrophic, interstitial, metastatic, necrotic, obliterative, parenchymatous, plastic, productive, proliferous, pseudomembranous, purulent, sclerosing, seroplastic, serous, simple, specific, subacute, suppurative, toxic, traumatic, and/or ulcerative inflammation.
  • Exemplary inflammatory conditions include, but are not limited to, inflammation associated with acne, anemia (e.g., aplastic anemia, haemolytic autoimmune anaemia), asthma, arteritis (e.g., polyarteritis, temporal arteritis, periarteritis nodosa, Takayasu's arteritis), arthritis (e.g., crystalline arthritis, osteoarthritis, psoriatic arthritis, gouty arthritis, reactive arthritis, rheumatoid arthritis and Reiter's arthritis), ankylosing spondylitis, amylosis, amyotrophic lateral sclerosis, autoimmune diseases, allergies or allergic reactions, atherosclerosis, bronchitis, bursitis, chronic prostatitis, conjunctivitis, Chagas disease, chronic obstructive pulmonary disease, cermatomyositis, diverticulitis, diabetes (e.g., type I diabetes mellitus, type 2 diabetes mell
  • the inflammatory disorder is selected from arthritis (e.g., rheumatoid arthritis), inflammatory bowel disease, inflammatory bowel syndrome, asthma, psoriasis, endometriosis, interstitial cystitis and prostatistis.
  • the inflammatory condition is an acute inflammatory condition (e.g., for example, inflammation resulting from infection).
  • the inflammatory condition is a chronic inflammatory condition (e.g., conditions resulting from asthma, arthritis and inflammatory bowel disease).
  • the compounds may also be useful in treating inflammation associated with trauma and non-inflammatory myalgia.
  • the compounds may also be useful in treating inflammation associated with cancer.
  • the FAAH-mediated condition is an immune disorder.
  • Immune disorders include, but are not limited to, arthritis (including rheumatoid arthritis, spondyloarthopathies, gouty arthritis, degenerative joint diseases such as osteoarthritis, systemic lupus erythematosus, Sjogren's syndrome, ankylosing spondylitis, undifferentiated spondylitis, Behcet's disease, haemolytic autoimmune anaemias, multiple sclerosis, amyotrophic lateral sclerosis, amylosis, acute painful shoulder, psoriatic, and juvenile arthritis), asthma, atherosclerosis, osteoporosis, bronchitis, tendonitis, bursitis, skin condition (e.g., psoriasis, eczema, burns, dermatitis, pruritus (itch)), enuresis, eosinophilic disease,
  • arthritis including rheumatoid arthritis
  • the inflammatory disorder and/or the immune disorder is a gastrointestinal disorder.
  • the gastrointestinal disorder is selected from gastrointestinal disorder (e.g., selected from peptic ulcers, regional enteritis, diverticulitis, gastrointestinal bleeding, eosinophilic gastrointestinal disorders (e.g., eosinophilic esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis, eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux disease (GORD, or its synonym GERD), inflammatory bowel disease (IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's syndrome, indeterminate colitis) and inflammatory bowel syndrome (IBS)).
  • the gastrointestinal disorder is inflammatory bowel disease (IBD).
  • the inflammatory condition and/or immune disorder is a skin condition.
  • the skin condition is pruritus (itch), psoriasis, eczema, burns or dermatitis.
  • the skin condition is psoriasis.
  • the skin condition is pruritis.
  • the FAAH-mediated condition is a disorder of the central nervous system (CNS) (“CNS disorder”).
  • CNS disorders include, but are not limited to, neurotoxicity and/or neurotrauma, stroke, multiple sclerosis, spinal cord injury, epilepsy, a mental disorder, a sleep condition, a movement disorder, nausea and/or emesis, amyotrophic lateral sclerosis, Alzheimer's disease and drug addiction.
  • the CNS disorder is neurotoxicity and/or neurotrauma, e.g., for example, as a result of acute neuronal injury (e.g., tramatic brain injury (TBI), stroke, epilepsy) or a chronic neurodegenerative disorder (e.g., multiple sclerosis, Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis, Alzheimer's disease).
  • acute neuronal injury e.g., tramatic brain injury (TBI), stroke, epilepsy
  • a chronic neurodegenerative disorder e.g., multiple sclerosis, Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis, Alzheimer's disease.
  • the compound of the present invention provides a neuroprotective effect, e.g., against an acute neuronal injury or a chronic neurodegenerative disorder.
  • the CNS disorder is stroke (e.g., ischemic stroke).
  • the CNS disorder is multiple sclerosis.
  • the CNS disorder is spinal cord injury.
  • the CNS disorder is epilepsy.
  • the CNS disorder is a mental disorder, e.g., for example, depression, anxiety or anxiety-related conditions, a learning disability or schizophrenia.
  • the CNS disorder is depression.
  • “Depression,” as used herein, includes, but is not limited to, depressive disorders or conditions, such as, for example, major depressive disorders (e.g., unipolar depression), dysthymic disorders (e.g., chronic, mild depression), bipolar disorders (e.g., manic-depression), seasonal affective disorder, and/or depression associated with drug addiction (e.g., withdrawal).
  • the depression can be clinical or subclinical depression.
  • the depression can be associated with or prementrual syndrome and/or premenstrual dysphoric disorder.
  • the CNS disorder is anxiety.
  • “Anxiety,” as used herein, includes, but is not limited to anxiety and anxiety-related conditions, such as, for example, clinical anxiety, panic disorder, agoraphobia, generalized anxiety disorder, specific phobia, social phobia, obsessive-compulsive disorder, acute stress disorder, post-traumatic stress disorder, adjustment disorders with anxious features, anxiety disorder associated with depression, anxiety disorder due to general medical conditions, and substance-induced anxiety disorders, anxiety associated with drug addiction (e.g., withdrawal, dependence, reinstatement) and anxiety associated with nausea and/or emesis.
  • This treatment may also be to induce or promote sleep in a subject (e.g., for example, a subject with anxiety).
  • the CNS disorder is a learning disorder (e.g., attention deficit disorder (ADD)).
  • ADD attention deficit disorder
  • the CNS disorder is Schizophrenia.
  • the CNS disorder is a sleep condition.
  • sleep conditions include, but are not limited to, insomia, narcolepsy, sleep apnea, restless legs syndrome (RLS), delayed sleep phase syndrome (DSPS), periodic limb movement disorder (PLMD), hypopnea syndrome, rapid eye movement behavior disorder (RBD), shift work sleep condition (SWSD), and sleep problems (e.g., parasomnias) such as nightmares, night terrors, sleep talking, head banging, snoring, and clenched jaw and/or grinding of teeth (bruxism).
  • the CNS disorder is a movement disorder, e.g., basal ganglia disorders, such as, for example, Parkinson's disease, levodopa-induced dyskinesia, Huntington's disease, Gilles de la Tourette's syndrome, tardive diskinesia and dystonia.
  • basal ganglia disorders such as, for example, Parkinson's disease, levodopa-induced dyskinesia, Huntington's disease, Gilles de la Tourette's syndrome, tardive diskinesia and dystonia.
  • the CNS disorder is Alzheimer's disease.
  • the CNS disorder is amyotrophic lateral sclerosis (ALS).
  • ALS amyotrophic lateral sclerosis
  • the CNS disorder is nausea and/or emesis.
  • the CNS disorder is drug addiction (e.g., for instance, addiction to opiates, nicotine, cocaine, psychostimulants or alcohol).
  • drug addiction e.g., for instance, addiction to opiates, nicotine, cocaine, psychostimulants or alcohol.
  • the FAAH-mediated condition is a cardiac disorder, e.g., for example, selected from hypertension, circulatory shock, myocardial reperfusion injury and atherosclerosis.
  • the FAAH-mediated condition is a metabolic disorder (e.g., a wasting condition, an obesity-related condition or complication thereof).
  • the metabolic disorder is a wasting condition.
  • the metabolic disorder is an obesity-related condition or a complication thereof.
  • An “obesity-related condition” as used herein includes, but is not limited to, obesity, undesired weight gain (e.g., from medication-induced weight gain, from cessation of smoking) and an over-eating disorder (e.g., binge eating, bulimia, compulsive eating, or a lack of appetite control each of which can optionally lead to undesired weight gain or obesity).
  • “Obesity” and “obese” as used herein refers to class I obesity, class II obesity, class III obesity and pre-obesity (e.g., being “over-weight”) as defined by the World Health Organization.
  • Reduction of storage fat is expected to provide various primary and/or secondary benefits in a subject (e.g., in a subject diagnosed with a complication associated with obesity) such as, for example, an increased insulin responsiveness (e.g., in a subject diagnosed with Type II diabetes mellitus); a reduction in elevated blood pressure; a reduction in elevated cholesterol levels; and/or a reduction (or a reduced risk or progression) of ischemic heart disease, arterial vascular disease, angina, myocardial infarction, stroke, migraines, congestive heart failure, deep vein thrombosis, pulmonary embolism, gall stones, gastroesophagael reflux disease, obstructive sleep apnea, obesity hypoventilation syndrome, asthma, gout, poor mobility, back pain, erectile dysfunction, urinary incontinence, liver injury (e.g., fatty liver disease, liver cirrhosis, alcoholic cirrhosis, endotoxin mediated liver injury) or chronic renal failure.
  • treatment of an obesity-related condition or complication thereof involves reduction of body weight in the subject. In some embodiments, treatment of an obesity-related condition or complication thereof involves appetite control in the subject.
  • the FAAH-mediated condition is glaucoma.
  • Provided compounds can be administered using any amount and any route of administration effective for treatment.
  • the exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the infection, the particular composition, its mode of administration, its mode of activity, and the like.
  • compositions of the present invention are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions of the present invention will be decided by the attending physician within the scope of sound medical judgment.
  • the specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the disease, disorder, or condition being treated and the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex and diet of the subject; the time of administration, route of administration, and rate of excretion of the specific active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.
  • the compounds and compositions provided herein can be administered by any route, including oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, enteral, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
  • Specifically contemplated routes are systemic intravenous injection, regional administration via blood and/or lymph supply, and/or direct administration to an affected site. In general the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), the condition of the subject (e.g., whether the subject is able to tolerate oral administration), etc.
  • the exact amount of a compound required to achieve a therapeutically effective amount will vary from subject to subject, depending, for example, on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound(s), mode of administration, and the like.
  • the desired dosage can be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks.
  • the desired dosage can be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
  • a therapeutically effective amount of a compound for administration one or more times a day to a 70 kg adult human may comprise about 0.0001 mg to about 3000 mg, about 0.0001 mg to about 2000 mg, about 0.0001 mg to about 1000 mg, about 0.001 mg to about 1000 mg, about 0.01 mg to about 1000 mg, about 0.1 mg to about 1000 mg, about 1 mg to about 1000 mg, about 1 mg to about 100 mg, about 10 mg to about 1000 mg, or about 100 mg to about 1000 mg, of an inventive compound per unit dosage form.
  • dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult.
  • the amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.
  • a compound or composition, as described herein, can be administered in combination with one or more additional therapeutically active agents.
  • the compound or composition can be administered concurrently with, prior to, or subsequent to, one or more additional therapeutically active agents.
  • each agent will be administered at a dose and/or on a time schedule determined for that agent.
  • the additional therapeutically active agent utilized in this combination can be administered together in a single composition or administered separately in different compositions.
  • the particular combination to employ in a regimen will take into account compatibility of the inventive compound with the additional therapeutically active agent and/or the desired therapeutic effect to be achieved.
  • it is expected that additional therapeutically active agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
  • the compounds or compositions can be administered in combination with agents that improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body. It will also be appreciated that therapy employed may achieve a desired effect for the same disorder (for example, a compound can be administered in combination with an anti-inflammatory, anti-anxiety and/or anti-depressive agent, etc.), and/or it may achieve different effects (e.g., control of adverse side-effects).
  • Exemplary active agents include, but are not limited to, anti-cancer agents, antibiotics, anti-viral agents, anesthetics, anti-coagulants, inhibitors of an enzyme, steroidal agents, steroidal or non-steroidal anti-inflammatory agents, antihistamine, immunosuppressant agents, anti-neoplastic agents, antigens, vaccines, antibodies, decongestant,s sedatives, opioids, pain-relieving agents, analgesics, anti-pyretics, hormones, prostaglandins, progestational agents, anti-glaucoma agents, ophthalmic agents, anti-cholinergics, anti-depressants, anti-psychotics, hypnotics, tranquilizers, anti-convulsants/anti-epileptics (e.g., Neurontin, Lyrica, valproates (e.g., Depacon), and other neurostabilizing agents), muscle relaxants, anti-spasmodics, muscle contractants, channel blockers, miotic agents
  • Active agents include small organic molecules such as drug compounds (e.g., compounds approved by the Food and Drugs Administration as provided in the Code of Federal Regulations (CFR)), peptides, proteins, carbohydrates, monosaccharides, oligosaccharides, polysaccharides, nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides or proteins, small molecules linked to proteins, glycoproteins, steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides, oligonucleotides, antisense oligonucleotides, lipids, hormones, vitamins and cells.
  • drug compounds e.g., compounds approved by the Food and Drugs Administration as provided in the Code of Federal Regulations (CFR)
  • CFR Code of Federal Regulations
  • peptides proteins
  • carbohydrates monosaccharides, oligosaccharides, polysaccharides, nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides or proteins
  • the additional therapeutically active agent is a pain-relieving agent.
  • pain relieving agents include, but are not limited to, analgesics such as non-narcotic analgesics [e.g., salicylates such as aspirin, ibuprofen (MOTRIN®, ADVIL®), ketoprofen (ORUDIS®), naproxen (NAPROSYN®), acetaminophen, indomethacin] or narcotic analgesics [e.g., opioid analgesics such as tramadol, fentenyl, sufentanil, morphine, hydromorphone, codeine, oxycodone, and buprenorphine]; non-steroidal anti-inflammatory agents (NSAIDs) [e.g., aspirin, acetaminophen, COX-2 inhibitors]; steroids or anti-rheumatic agents; migraine preparations such as beta adrenergic blocking agents, er
  • the additional therapeutically active agent is an anti-inflammatory agent.
  • anti-inflammatory agents include, but are not limited to, aspirin; ibuprofen; ketoprofen; naproxen; etodolac (LODINE®); COX-2 inhibitors such as celecoxib (CELEBREX®), rofecoxib (VIOXX®), valdecoxib (BEXTRA®), parecoxib, etoricoxib (MK663), deracoxib, 2-(4-ethoxy-phenyl)-3-(4-methanesulfonyl-phenyl)-pyrazolo[1,5-b]pyridazine, 4-(2-oxo-3-phenyl-2,3-dihydrooxazol-4-yl)benzenesulfonamide, darbufelone, flosulide, 4-(4-cyclohexyl-2-methyl-5-oxazolyl)-2-fluorobenzene
  • anti-inflammatory agents include naproxen, which is commercially available in the form of EC-NAPROSYN® delayed release tablets, NAPROSYN®, ANAPROX® and ANAPROX® DS tablets and NAPROSYN® suspension from Roche Labs, CELEBREX® brand of celecoxib tablets, VIOXX® brand of rofecoxib, CELESTONE® brand of betamethasone, CUPRAMINE® brand penicillamine capsules, DEPEN® brand titratable penicillamine tablets, DEPO-MEDROL brand of methylprednisolone acetate injectable suspension, ARAVATM leflunomide tablets, AZULFIDIINE EN-Tabs® brand of sulfasalazine delayed release tablets, FELDENE® brand piroxicam capsules, CATAFLAM® diclofenac potassium tablets, VOLTAREN® diclofenac sodium delayed release tablets, VOLTAREN®-XR diclofenac sodium extended release tablets
  • Methods of determining the activity of the compounds provided herein for various therapeutic uses are known in the art. These include, but are not limited to, high throughput screening to identify compounds that bind to and/or modulate the activity of isolated FAAH, as well as in vitro and in vivo models of therapies.
  • Assays useful for screening the compounds provided herein may detect the binding of the inhibitor to FAAH or the release of a reaction product (e.g., fatty acid amide or ethanolamine) produced by the hydrolysis of a substrate such as oleoylethanolamide or ananadamide.
  • a reaction product e.g., fatty acid amide or ethanolamine
  • the substrate can be labeled to facilitate detection of the released reaction products.
  • U.S. Pat. No. 5,559,410 discloses high throughput screening methods for proteins
  • U.S. Pat. Nos. 5,576,220 and 5,541,061 disclose high throughput methods of screening for ligand/antibody binding.
  • Methods for screening FAAH inhibitors for an antinociceptive effect are known in the art.
  • compounds can tested in the mouse hot-plate test and the mouse formalin test, and the nociceptive reactions to thermal or chemical tissue damage measured (for example, see U.S. Pat. No. 6,326,156 for a description of methods of screening for antinociceptive activity; see also Cravatt et al. Proc. Natl. Acad. Sci. U.S.A. (2001) 98:9371-9376).
  • the zero maze consists of an elevated annular platform with two open and two closed quadrants and is based on the conflict between an animal's instinct to explore its environment and its fear of open spaces (see, for example, Bickerdike, M. J. et al., Eur. J. Pharmacol., (994) 271, 403-411; Shepherd, J. K. et al., Psychopharmacology, (1994) 116, 56-64).
  • Clinically used anxiolytic drugs such as the benzodiazepines, increase the proportion of time spent in, and the number of entries made into, the open compartments.
  • a second test for an anti-anxiety compound is the ultrasonic vocalization emission model, which measures the number of stress-induced vocalizations emitted by rat pups removed from their nest (see, for example, Drei, T. R. et al., Pharmacol. Biochem. Behav., 24, 1263-1267 (1986); Miczek, K. A. et al., Psychopharmacology, 121, 38-56 (1995); Winslow, J. T. et al., Biol. Psychiatry, 15, 745-757 (1991).
  • the effect of the compounds provided herein in the treatment of depression can be tested in the model of chronic mild stress induced anhedonia in rats.
  • This model is based on the observation that chronic mild stress causes a gradual decrease in sensitivity to rewards, for example consumption of sucrose, and that this decrease is dose-dependently reversed by chronic treatment with antidepressants. See, e.g., Willner, Paul, Psychopharmacology, 1997, 134, 319-329.
  • Another test for antidepressant activity is the forced swimming test (Nature 266, 730-732, 1977). In this test, animals are administered an agent 30 or 60 minutes before being placed in container of water, and the time during which they remain immobile is recorded. A decrease in the immobility time of the mice is indicative of antidepressant activity.
  • mice caudal suspension test (Psychopharmacology, 85, 367-370, 1985). In this test, animals are administered an agent 30 or 60 minutes before being suspended by the tail, and their immobility time is recorded. A decrease in the immobility time of the mice is indicative of antidepressant activity.
  • Inhibition of FAAH has been reported to induce sleep in test animals (see, e.g., U.S. Pat. No. 6,096,784).
  • Methods for studying sleep inducing compounds are known in the art (see, e.g., U.S. Pat. Nos. 6,096,784 and 6,271,015).
  • Compounds can be administered to a test animal (e.g., rat or mouse) or a human and the subsequent time (e.g., onset, duration) spent sleeping (e.g., eyes closed, motor quiescence) can be monitored. See also WO 98/24396.
  • One method of assessing the effect on appetite behavior is to administer a FAAH inhibitor to a rat and assess its effect on the intake of a sucrose solution (see, e.g., W. C. Lynch et al., Physiol. Behav., 1993, 54, 877-880).
  • neuropathic pain Two pharmacologically validated animal models of neuropathic pain are the rat spinal nerve ligation model (Chung model) and a rat model of chemotherapy-induced neuropathic pain. After establishing neuropathy in these models, as a measure of mechanical allodynia, paw withdrawal thresholds were measured by stimulation with von Frey filaments (see, for example, Kim S H and Chung J M, Pain (1992) 50, 355-63; Nozaki-Taguchi N, et al., Pain (2001) 93, 69-76). Clinically used neuropathic pain drugs, such as the Gabapentin (Neurontin), increase the paw withdrawal threshold from stimulation with von Frey filaments.
  • Gabapentin Neuroreactivein
  • Two pharmacologically validated animal models of inflammatory and mechanical pain are a joint compression model in rats treated with adjuvant or agents that produce joint degeneration. Treatment with clinically used anti-inflammatory agents such as naproxen increases the threshold of behavioral response to joint compression (see, for example, Wilson A W, et al., Eur. J. Pain (2006) 10, 537-49; Ivanavicius S A, et al., Pain (2007) 128, 272-282).
  • a pharmacologically validated animal models of cancer pain is mouse model where implantation in the calcaneus bone of fibrosarcoma cells produces paw hyperalgesia. Treatment with clinically used analgesics agents such as morphine increases the threshold of behavioral response to mechanical algesia (see, for example, Khasabova, et al., J. Neurscience (2008) 28, 11141-52).
  • the resulting oxime (1.1 equiv) from the first step is suspended in a 3:1 mixture of dimethoxyethane:water (v/v) (0.15 M with respect to oxime) and cooled to 0° C. N-Bromosuccinamide (NBS) (2.0 equiv) was added and the reaction was allowed to stir at 23° C. for 20 min. The resulting mixture is then added to a solution of alkene (1.0 equiv) and potassium bicarbonate (2.5 equiv) in dimethoxyethane (1.50 M with respect to alkene) and the reaction is allowed to stir for 20 h at 23° C.
  • reaction Upon completion as judged by thin layer chromatography analysis, the reaction was split between water and tert-butyl methyl ether, and the organic layer was washed with brine, dried over sodium sulfate, and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired 3-bromo-isoxazoline.
  • the reaction was then split between water and tert-butyl methyl ether, and the organic layer was washed with brine, dried over sodium sulfate, and concentrated in vacuo.
  • the concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired isoxazoline.
  • reaction was then split between water and ethyl acetate, and the organic layer was washed with 1N NaOH and brine, and then dried over sodium sulfate, and concentrated in vacuo.
  • the concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired isoxazoline.
  • the mixture was then diluted with water and extracted with ethyl acetate.
  • the organic layer was washed with brine, dried over sodium sulfate and concentrated in vacuo.
  • the concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired alkene.
  • the organic layer was washed with brine, dried over sodium sulfate and concentrated in vacuo.
  • the concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired alkene.
  • the organic layer was washed with brine and then dried over sodium sulfate and concentrated in vacuo.
  • the concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired alkene.
  • the organic layer was washed with brine and then dried over magnesium sulfate and concentrated in vacuo.
  • the concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired styrene.
  • reaction is allowed to stir at room temperature (reaction is mildly exothermic) after which ammonium chloride is added in three portions (10 equiv) and the reaction cooled back down to room temperature. After 40 min, the reaction was concentrated under vacuum until all of the tetrahydrofuran was removed. The resulting solid was collected by vacuum filtration, washed with excess waster and dried in a vacuum oven for 40° C. for 3d to provide the desired phenol in 80% yield.
  • Enantiomeric or diastereomeric mixtures of compounds can be separated using known methods, including chiral high pressure liquid chromatography (HPLC) and chiral supercritical fluid chromatography (SFC).
  • HPLC high pressure liquid chromatography
  • SFC supercritical fluid chromatography
  • Exemplary chiral columns found useful in separating such mixtures of compounds of the present invention include, but are not limited to, ChiralPak® AD-H, ChiralPak® OD-H, ChiralPak® AY, RegisPackTM, and S,S WhelkO®-1 and LUXTM Cellulose2 columns. One or more of these columns were used to separate enantiomeric mixtures of compounds of the present invention in order to obtain substantially enantiomerically pure compounds.
  • 3-bromo-4,5-dihydroisoxazole III-3a and III-3b was prepared in 2 steps starting with alkene formation from 4-phenylcyclohexanone using Method 6 followed by cycloaddition using Method 1.
  • 4-Methylenecyclohexanecarboxylic acid ethyl ester is prepared from the Wittig reaction on ethyl 4-oxocyclohexanecarboxylate using Method 3. This ester is reduced to compound III-5 according to the following procedure: To a solution of lithium aluminum hydride (4.0 equiv) in diethyl ether (1.0 M with respect to hydride) is added ethyl 4-oxocyclohexanecarboxylate in diethyl ether (2.0 M with respect to ester). The reaction is heated to reflux for 2 h after which it is cooled in an ice bath and quenched with by subsequent additions of isopropanol, 50% NaOH in water, and water.
  • the mixture is then filtered and the filter cake is washed with excess diethyl ether.
  • the filtrate is then washed with water and brine, dried over sodium sulfate, and concentrated in vacuo to provide a clear oil that is used without further purification.
  • Phenol (1.2 equiv) is then dissolved in N,N-dimethylforamide (0.20 M with respect to tosylate).
  • Cesium carbonate (1.3 equiv) is added followed by compound III-6 (1.0 equiv) and TBAI (0.10 equiv).
  • the reaction is heated to 40° C. for 19 h after which point it was diluted with tert-butylmethyl ether and washed with dilute NaOH, water and brine and then dried over sodium sulfate. Concentration under vacuum provides compound III-7 as a clear oil which is used without further purification.
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.06 M with respect to isxozaole) after which triethylamine (2.5 equiv) and benzaldehyde (1.25 equiv) are added followed by sodium triacetoxyborohydride (1.5 equiv). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute NaOH and then brine.
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.05 M with respect to isoxazole) after which triethylamine (5.0 equiv) and carbonyl diimidazole (1.25 equiv) are added.
  • the reaction is allowed to stir for 2 h after which point anisyl alcohol (2.5 equiv) was added followed by catalytic tetrabutylammonium hydrogensulfate and 50% aqueous sodium hydroxide (0.10 M with respect to isoxazole).
  • the heterogeneous mixture is allowed to stir for 16 h after which point it was diluted with ethyl acetate.
  • 3-Cylopentene-1-ol (1.0 equiv) is dissolved in N,N-dimethylformide (0.80 M with respect to the alcohol) and treated with TBAI (0.10 equiv) followed by crushed sodium hydroxide (2.0 equiv). Benzyl bromide (1.2 equiv) is then added and the reaction is allowed to stir for 48 h at room temperature. The reaction is then diluted with tert-butyl methyl ether and washed with dilute Na 2 S 2 O 3 and brine.
  • Racemic 3-bromo-4,5-dihydroisoxazole III-43 was dissolved in trifluoroacetic acid (0.20 M with respect to isoxazole) and stirred at room temperature for 1 h. The solvent is then removed under vacuum and the crude residue is azeotroped with toluene (2 ⁇ ) to provide a the trifluoroacetic acid salt as a white solid which was dissolved in methylene chloride (0.05 M with respect to isozaole) after which triethylamine (4.0 equiv) and benzyl chloroformate (1.25 equiv are added).
  • Racemic 3-bromo-4,5-dihydroisoxazole III-43 was dissolved in trifluoroacetic acid (0.20 M with respect to isoxazole) and stirred at room temperature for 1 h. The solvent is then removed under vacuum and the crude residue is azeotroped with toluene (2 ⁇ ) to provide a the trifluoroacetic acid salt as a white solid which is then is dissolved in methylene chloride (0.06 M with respect to isoxozaole) after which triethylamine (2.5 equiv) and 4-chlorobenzaldehyde (1.25 equiv) are added followed by sodium triacetoxyborohydride (1.5 equiv).
  • 3-(Pyridin-3-yloxy)-4,5-dihydroisoxazole III-58 was prepared in 3 steps from compound III-16 according to the following procedures: 6-(methylthio)pyridin-3-ol is prepared from 6-(methylthio)pyridin-3-ylboronic acid using Method 11. 3-Bromo-4,5-dihydroixoazole III-16 was then reacted with 6-(methylthio)pyridin-3-ol using Method 5.
  • 3-(Pyrrolidin-1-yl-4,5-dihydroisoxazole III-59 was prepared in 1 step according to the following procedure: 3-bromo-4,5-dihydmrisoxazole III-18 (1.0 equiv) was dissolved in n-butanol (0.64 M) followed by the addition of pyrollidine (1.2 equiv) and sodium carbonate (2.5 equiv). The reaction is the sealed and heated in an oil bath to 120° C. for 18 h after which it allowed to cool and then transferred to a separatory funnel with excess water and tert-butylmethyl ether.
  • 1-(4,5-Dihydroisoxazol-3-yl)-1-methylpyrrolidinium iodide III-60 was synthesized according to the following procedure: 3-(pyrrolidin-1-yl)-4,5-dihydroisoxazole III-59 was dissolved in methanol (0.044 M) followed by the addition of methyl iodide (0.022 M). The reaction was allowed to sit for 72 h after which it was concentrated and purified using high pressure liquid chromatography (0.1% formic acid). The desired fractions were lyophilized to provide the desired product plus some impurities which were removed by washing the solid with hexanes. Activity: C
  • 3-bromo-4,5-dihydroisoxazole III-62a and III-62b were synthesized in three steps according to the following procedures: phenyl boronic acid (2.0 equiv) is suspended in toluene (0.23 M with respect to boronic acid) and heated until a solution results. The solvent is Page 140 of 172 Attorney Docket No.: 2008074-0117 evaporated and this process is repeated. The resulting anhydride is then redissolved in methylene chloride (0.23 M).
  • 3-bromo-4,5-dihydroisoxazole III-66a and III-66b were synthesized in four steps according to the following procedures: A 250 mL round bottom flask with 10/30 thermometer port is fitted with a stir bar, analog thermometer, and Allihn condenser. 3-(3-(Trifluoromethoxy)phenyl)propanoic acid (0.22 mol, 1.0 equiv) is added, dissolved in thionyl chloride (6.0 equiv), and refluxed in an oil bath during 1 h during which time the internal temp 78-82° C. across the hour.
  • the condenser is replaced with a short-path head and the thermometer with an inlet for a stream of dry argon, and the volatiles removed by distillation.
  • cyclohexane 100 mL is added to the pot and is distilled out in the same manner to provide the desired acid chloride in quantitative yield as a brown oil that is used directly.
  • a 2 L 3-necked round bottom flask is then fitted with a mechanical stirrer, thermocouple probe, and a 250-mL pressure-equalized dropping funnel. It is charged with aluminum trichloride (0.233 mol, 1.08 equiv) and methylene chloride (0.24 M), then stirred 45 min to dissolve as much as possible.
  • reaction is then chilled in an ice bath to an internal temp of ⁇ 2.5° C.
  • a solution of acid chloride (1.0 equiv, 0.215 mol) in 200 ml methylene chloride is added via an addition funnel over 15 min.
  • the ice is removed from the bath and replaced with room-temperature water (bath temperature at 18° C.) and the reaction allowed to proceed for 2 h more, at which point the reaction is indicated to be complete by TLC and LC/MS analysis.
  • the reaction mixture is then treated with ice (500 g, and then water (600 mL) after which the mixture stirred for 1 h until all solids have dissolved.
  • the layers are separated and the water layer is extracted with diethyl ether (350 mL).
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-70a and III-70b were prepared in 2 steps according to the following procedures: 6-bromopyridin-3-ol (1.0 equiv) and sodium carbonate (10.0 equiv) are added to a microwave vial. Toluene, ethanol, and water (0.16 M, 2:2:1 v/v) are added followed by 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (1.5 equiv). The mixture is purged with argon for 15 min followed by the addition of palladium tetrakis (4 mol %).
  • reaction tube is then covered with aluminum foil and heated to 80° C. in an oil bath for 17 h. After cooling the reaction was transferred to a separatory funnel with excess water and ethyl acetate. The organic layer was then washed with water (1 ⁇ ), saturated ammonium chloride (1 ⁇ ) and brine (1 ⁇ ). The aqueous layers were combined and washed with ethyl acetate (1 ⁇ ). The organic layers were then combined, dried over sodium sulfate, concentrated and purified using flash silica gel chromatography (gradient methanol/methylene chloride) to provide 6-(1-methyl-1H-pyrazol-4-yl)pyridin-3-ol III-69 as a white solid.
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-73a and III-73b were prepared in 3 steps according to the following procedures: 5-hydroxynicotinic acid methyl ester is reacted with (1.0 equiv) is dissolved in methanol (0.08 M) after which hydrazine (50 equiv, 50% by weight in water) is added and the reaction is allowed to stir for 14 h. The reaction mixture is then concentrated under vacuum and used directly in the next step. Triethylorthoformate (8.0 equiv) is added and the reaction is sealed and heated to reflux for 14 h. The reaction is then transferred to a separatory funnel with excess ethyl acetate and water.
  • COS-7 cells were split the day before, 1:5 into 150 mm ⁇ 25 mm cell culture dishes (Corning Inc., Cat. No. 430599). Transient transfection took place at 30-40% confluency according to FuGENE 6 Transfection Reagent (Roche, Cat. No. 11814 443 001).
  • the FuGENE transfection 6 reagent (45 uL) was added to 1410 ⁇ L of media (DMEM, serum free without pen/strep) in a 15 mL conical tube and incubated at room temp for 5 minutes, followed by the addition of FAAH plasmid DNA (15 ⁇ g) (OriGene Cat. No. TC119221, Genbank Accession No. NM — 001441.1, 0.67 ug/uL) and a further incubation of 15 minutes at room temperature. The resulting solution was added into one dish of 30-40% confluent COS-7 cells in a drop-wise manner. The COS-7 cell dish was subsequently incubated for 48 hours. The cells are then harvested.
  • media DMEM, serum free without pen/strep
  • the raw fluorescence was plotted on the y axis and the inhibitor concentration on the x axis to give a dose response inhibition curve.
  • the data was fitted to a single site competitive inhibition equation, fixing the Km for the human enzyme to 12 ⁇ M and 9 ⁇ M respectively.
  • assays which can be used to determine the inhibition of FAAH by the compounds of the present invention include: (1) a fluorescence-based assay for fatty acid amide hydrolase compatible with high-throughput screening as described in Manjunath et al., Analytical Biochemistry (2005) 343:143-151; and (2) a high-throughput screening for the discovery of inhibitors of fatty acid amide hydrolase using a microsome-based fluorescent assay. Wang et al., Biomolecular Screening (2006) 1-9.
  • the isoxazoline compounds of the present invention form covalent complexes with the nucleophilic side chain of Ser-241.
  • This hypothesis is consistent with the kinetic data, with the proposed binding involving nucleophilic attack of the isoxazoline electrophile by the active site Ser-241, resulting in the elimination of the leaving group from the cytosolic port, and the subsequent formation of a covalent enzyme-isoxazoline adduct. Recovery of activity would subsequently involve a deacylation reaction, which would occur inefficiently, if at all, for the covalent enzyme-isoxazoline adduct.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Neurosurgery (AREA)
  • Psychiatry (AREA)
  • Hospice & Palliative Care (AREA)
  • Diabetes (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Cardiology (AREA)
  • Child & Adolescent Psychology (AREA)
  • Anesthesiology (AREA)
  • Addiction (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Otolaryngology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

The present invention provides isoxazoline FAAH inhibitors of the formula (I):
Figure US20150099738A1-20150409-C00001
    • or pharmaceutically acceptable forms thereof, wherein each of G, Ra, Rb, Rc, and Rd are as defined herein.
The present invention also provides pharmaceutical compositions comprising a compound of formula (I), or a pharmaceutically acceptable form thereof, and a pharmaceutically acceptable excipient.
The present invention also provides methods for treating an FAAH-mediated condition comprising administering a therapeutically effective amount of a compound of formula (I), or pharmaceutically acceptable form thereof, to a subject in need thereof.

Description

    CROSS REFERENCE TO RELATED APPLICATIONS
  • The present application claims priority to U.S. provisional patent application Ser. No. 61/179,285 filed May 18, 2009, the entirety of which is hereby incorporated herein by reference.
  • BACKGROUND
  • Fatty acid amide hydrolase (FAAH), also referred to as oleamide hydrolase and anandamide amidohydrolase, is an integral membrane protein responsible for the hydrolysis of several important endogenous neuromodulating fatty acid amides (FAAs), including anadamide, oleoylethanolamide and palmitoylethanolamide, and is intimately involved in their regulation. Because these FAAs interact with cannabinoid and vanilliod receptors, they are often referred to as “endocannabinoids” or “endovanilliods”. Initial interest in this area focused on developing FAAH inhibitors to augment the actions of FAAs and reduce pain. Further investigation found FAAH inhibitors, through interactions of the FAAs with unique extracellular and intracellular receptors, can be used to treat a variety of conditions that include, but are not limited to, inflammation, metabolic disorders (e.g., obesity-related conditions and wasting conditions such as cachexias and anorexia), disorders of the central nervous system (e.g., disorders associated with neurotoxicity and/or neurotrauma, stroke, multiple sclerosis, spinal cord injury, movement disorders such as basal ganglia disorders, amylotrophic lateral sclerosis, Alzheimer's disease, epilepsy, mental disorders such as anxiety, depression, learning disorders and Schizophrenia, sleep disorders such as insomnia, nausea and/or emesis, and drug addiction), cardiac disorders (e.g., hypertention, circulatory shock, myocardial reperfusion injury and atherosclerosis) and glaucoma (Pacher et al., “The Endocannabinoid System as an Emerging Target of Pharmacotherapy” Pharmacological Reviews (2006) 58:389-462; Pillarisetti et al., “Pain and Beyond: Fatty Acid Amides and Fatty Acid Amide Hydrolase Inhibitors in Cardiovascular and Metabolic Diseases” Drug Discovery Today (2009) 597:1-14).
  • SUMMARY
  • The present invention provides isoxazoline FAAH inhibitor compounds of the formula (I):
  • Figure US20150099738A1-20150409-C00002
  • or pharmaceutically acceptable forms thereof,
  • wherein:
  • Ra and Rd are joined to form a C1-10 carbocycyl or 3-14 membered heterocyclyl fused ring, and Rb and Rc are independently selected from —H, C1-10 alkyl and C1-10 perhaloalkyl; or
  • Rc and Rd are joined to form a C3-10 carbocycyl or 3-14 membered heterocyclyl spiro-fused ring, and Ra and Rb are independently selected from —H, C1-10 alkyl and C1-10 perhaloalkyl;
  • L is a covalent bond or a divalent C1-6 hydrocarbon group, wherein one, two or three methylene units of L are optionally and independently replaced with one or more oxygen, sulfur or nitrogen atoms;
  • G is selected from —CN, —NO2, —S(═O)Re, —SO2Re, —SO2NRfRe, —PO2Re, —PO2ORe, —PO2NRfRe, —(C═O)Re, —(C═O)ORe, —(C═O)NRfRe, —Br, —I, —F, —Cl, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, —[N(Rf)2Re]+X wherein X is a counterion;
  • each Re is selected from C1-10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocycyl, C6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl; each Rf attached to a nitrogen atom is, independently, selected from —H, C1-10 alkyl, or an amino protecting group; or Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • The present invention also provides pharmaceutical compositions comprising a compound of formula (I), or a pharmaceutically acceptable form thereof, and a pharmaceutically acceptable excipient.
  • The present invention also provides methods for treating an FAAH-mediated condition in a subject comprising administering a therapeutically effective amount of a compound of formula (I), or a pharmaceutically acceptable form thereof, to a subject in need thereof.
  • The details of additional embodiments of the invention are set forth in the accompanying Detailed Description and Exemplification as described below. Other features, objects, and advantages of the invention will be apparent from this description and from the claims.
  • DEFINITIONS
  • Definitions of specific functional groups ad chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75 Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Organic Chemistry, Thomas Sorrell, University Science Books, Sausalito, 1999; Smith and March March's Advanced Organic Chemistry, 5 Edition, John Wiley & Sons, Inc., New York, 2001; Larock, Comprehensive Organic Transformations, VCH Publishers, Inc., New York, 1989; and Carruthers, Some Modern Methods of Organic Synthesis, 3rd Edition, Cambridge University Press, Cambridge, 1987.
  • Certain compounds of the present invention can comprise one or more asymmetric centers, and thus can exist in various isomeric forms, e.g., enantiomers and/or diastereomers. The compounds provided herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. In certain embodiments, the compounds of the invention are enantiopure compounds. In certain other embodiments, mixtures of stereoisomers are provided.
  • Furthermore, certain compounds, as described herein may have one or more double bonds that can exist as either the cis or trans, or the E or Z isomer, unless otherwise indicated. The invention additionally encompasses the compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers, e.g., racemic mixtures of E/Z isomers or mixtures enriched in one E/Z isomer.
  • The terms “enantiomerically enriched,” “enantiomerically pure” and “non-racemic,” as used interchangeably herein, refer to compositions in which the percent by weight of one enantiomer is greater than the amount of that one enantiomer in a control mixture of the racemic composition (e.g., greater than 1:1 by weight). For example, an enantiomerically enriched preparation of the (S)-enantiomer, means a preparation of the compound having greater than 50% by weight of the (S)-enantiomer relative to the (R)-enantiomer, more preferably at least 75% by weight, and even more preferably at least 80% by weight. In some embodiments, the enrichment can be much greater than 80% by weight, providing a “substantially enantiomerically enriched,” “substantially enantiomerically pure” or a “substantially non-racemic” preparation, which refers to preparations of compositions which have at least 85% by weight of one enantiomer relative to other enantiomer, more preferably at least 90% by weight, and even more preferably at least 95% by weight. In preferred embodiments, the enantiomerically enriched composition has a higher potency with respect to therapeutic utility per unit mass than does the racemic mixture of that composition. Enantiomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred enantiomers can be prepared by asymmetric syntheses. See, for example, Jacques, et al., Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen, S. H., et al., Tetrahedron 33:2725 (1977); Eliel, E. L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, S. H. Tables of Resolving Agents and Optical Resolutions p. 268 (E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, Ind. 1972).
  • When a range of values is listed, it is intended to encompass each value and sub-range within the range. For example “C1-6 alkyl” is intended to encompass, C1, C2, C3, C4, C5, C6, C1-6, C1-5, C1-4, C1-3, C1-2, C2-6, C2-5, C2-4, C2-3, C3-6, C3-5, C3-4, C4-6, C4-5, and C5-6 alkyl.
  • As used herein a “direct bond” or “covalent bond” refers to a single bond joining two groups.
  • As used herein, alone or as part of another group, “halo” and “halogen” refer to fluorine (fluoro, —F), chlorine (chloro, —Cl), bromine (bromo, —Br), or iodine (iodo, —I).
  • As used herein, alone or as part of another group, “alkyl” refers to a monoradical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (“C1-10 alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C1-9 alkyl”). In some embodiments, an alkyl group has 1 to 8 carbon atoms (“C1-8 alkyl”). In some embodiments, an alkyl group has 1 to 7 carbon atoms (“C1-7 alkyl”). In some embodiments, an alkyl group has 1 to 6 carbon atoms (“C1-6 alkyl”). In some embodiments, an alkyl group has 1 to 5 carbon atoms (“C1-5 alkyl”). In some embodiments, an alkyl group has 1 to 4 carbon atoms (“C1-4 alkyl”). In some embodiments, an alkyl group has 1 to 3 carbon atoms (“C1-3 alkyl”). In some embodiments, an alkyl group has 1 to 2 carbon atoms (“C1-2 alkyl”). In some embodiments, an alkyl group has 1 carbon atom (“C1 alkyl”). In some embodiments, an alkyl group has 2 to 6 carbon atoms (“C2-6 alkyl”). Examples of C1-6 alkyl groups include methyl (C1), ethyl (C2), n-propyl (C3), isopropyl (C3), n-butyl (C4), tert-butyl (C4), sec-butyl (C4), iso-butyl (C4), n-pentyl (C5), 3-pentanyl (C5), amyl (C5), neopentyl (C5), 3-methyl-2-butanyl (C5), tertiary amyl (C5), and n-hexyl (C6). Additional examples of alkyl groups include n-heptyl (C7), n-octyl (C5) and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an “unsubstituted alkyl”) or substituted (a “substituted alkyl”) are substituted with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the alkyl group is an unsubstituted C1-10 alkyl (e.g., —CH3). In certain embodiments, the alkyl group is a substituted C1-10 alkyl.
  • “Perhaloalkyl” as defined herein refers to an alkyl group having from 1 to 10 carbon atoms wherein all of the hydrogen atoms are each independently replaced halogen, e.g., selected from fluoro, bromo, chloro or iodo (“C1-10 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 8 carbon atoms (“C1-8 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 6 carbon atoms (“C1-6 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 4 carbon atoms (“C1-4 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 3 carbon atoms (“C1-3 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 2 carbon atoms (“C1-2 perhaloalkyl”). In some embodiments, all of the hydrogen atoms are each replaced with fluoro. In some embodiments, all of the hydrogen atoms are each replaced with chloro. Examples of perhaloalkyl groups include —CF3, —CF2CF3, —CF2CF2CF3, —CCl3, —CFCl2, —CF2Cl and the like.
  • As used herein, alone or as part of another group, “alkenyl” refers to a monoradical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms and one or more carbon-carbon double bonds (“C2-10 alkenyl”). In some embodiments, an alkenyl group has 2 to 9 carbon atoms (“C2-9 alkenyl”). In some embodiments, an alkenyl group has 2 to 8 carbon atoms (“C2-8 alkenyl”). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (“C2-7 alkenyl”). In some embodiments, an alkenyl group has 2 to 6 carbon atoms (“C2-6 alkenyl”). In some embodiments, an alkenyl group has 2 to 5 carbon atoms (“C2-5 alkenyl”). In some embodiments, an alkenyl group has 2 to 4 carbon atoms (“C2-4 alkenyl”). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (“C2-3 alkenyl”). In some embodiments, an alkenyl group has 2 carbon atoms (“C2 alkenyl”). The one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl). Examples of C2-4 alkenyl groups include ethenyl (C2), 1-propenyl (C3), 2-propenyl (C3), 1-butenyl (C4), 2-butenyl (C4), butadienyl (C4) and the like. Examples of C2-6 alkenyl groups include the aforementioned C2-4 alkenyl groups as well as pentenyl (C5), pentadienyl (C5), hexenyl (C6) and the like. Additional examples of alkenyl include heptenyl (C7), octenyl (C5), octatrienyl (C5) and the like. Unless otherwise specified, each instance of an alkenyl group is independently unsubstituted (an “unsubstituted alkenyl”) or substituted (a “substituted alkenyl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the alkenyl group is an unsubstituted C2-10 alkenyl. In certain embodiments, the alkenyl group is a substituted C2-10 alkenyl.
  • As used herein, alone or as part of another group, “alkynyl” refers to a monoradical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms and one or more carbon-carbon triple bonds (“C2-10 alkynyl”). In some embodiments, an alkynyl group has 2 to 9 carbon atoms (“C2-9 alkynyl”). In some embodiments, an alkynyl group has 2 to 8 carbon atoms (“C2-8 alkynyl”). In some embodiments, an alkynyl group has 2 to 7 carbon atoms (“C2-7 alkynyl”). In some embodiments, an alkynyl group has 2 to 6 carbon atoms (“C2-6 alkynyl”). In some embodiments, an alkynyl group has 2 to 5 carbon atoms (“C2-5 alkynyl”). In some embodiments, an alkynyl group has 2 to 4 carbon atoms (“C2-4 alkynyl”). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (“C2-3 alkynyl”). In some embodiments, an alkynyl group has 2 carbon atom (“C2 alkynyl”). The one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl). Examples of C2-4 alkynyl groups include, without limitation, ethynyl (C2), 1-propynyl (C3), 2-propynyl (C3), 1-butynyl (C4), 2-butynyl (C4) and the like. Examples of C2-6 alkenyl groups include the aforementioned C2-4 alkynyl groups as well as pentynyl (C5), hexynyl (C6) and the like. Additional examples of alkynyl include heptynyl (C7), octynyl (C5) and the like. Unless otherwise specified, each instance of an alkynyl group is independently unsubstituted (an “unsubstituted alkynyl”) or substituted (a “substituted alkynyl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the alkynyl group is an unsubstituted C2-10 alkynyl. In certain embodiments, the alkynyl group is a substituted C2-10 alkynyl.
  • A “divalent C1-6 hydrocarbon group” is a divalent C1-6 alkyl group, divalent C1-6 alkenyl group or divalent C1-6 alkynyl group wherein one, two or three methylene units (—CH2—) of the hydrocarbon chain are optionally and independently replaced with one or more oxygen, sulfur or nitrogen atoms. In certain embodiments, the divalent C1-6 hydrocarbon group is a divalent C1-6 alkyl group. In certain embodiments, the divalent C1-6 hydrocarbon group is an unsubstituted divalent C1-6 hydrocarbon group (e.g., an unsubstituted divalent C1-6 alkyl group).
  • As used herein, alone or as part of another group, “alkoxy” refers to an alkyl group, as defined herein, substituted with an oxygen atom, wherein the point of attachment is the oxygen atom. In certain embodiments, the alkyl group has 1 to 10 carbon atoms (“C1-10 alkoxy”). In some embodiments, the alkyl group has 1 to 8 carbon atoms (“C1-8 alkoxy”). In some embodiments, the alkyl group has 1 to 6 carbon atoms (“C1-6 alkoxy”). In some embodiments, the alkyl group has 1 to 4 carbon atoms (“C1-4 alkoxy”). Examples of C1-4 alkoxy groups include methoxy (C1), ethoxy (C2), propoxy (C3), isopropoxy (C3), butoxy (C4), tert-butoxy (C5) and the like. Examples of C1-6 alkoxy groups include the aforementioned C1-4 alkoxy groups as well as pentyloxy (C5), isopentyloxy (C5), neopentyloxy (C5), hexyloxy (C6) and the like. Additional examples of alkoxy groups include heptyloxy (C7), octyloxy (C5) and the like. Unless otherwise specified, each instance of the alkyl moiety of the alkoxy group is independently unsubstituted (an “unsubstituted alkoxy”) or substituted (a “substituted alkoxy”) are substituted with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the alkoxy group is an unsubstituted C2-10 alkoxy (e.g., —OCH3). In certain embodiments, the alkoxy group is a substituted C2-10 alkoxy (e.g., perhaloalkoxy as defined herein).
  • “Perhaloalkoxy” refers to an alkoxy group wherein the all the hydrogen atoms of the alkyl moiety are each independently replaced with halogen atoms selected from fluoro, chloro, bromo and iodo. In certain embodiments, the alkyl moiety has 1 to 10 carbon atoms (“C1-10 perhaloalkoxy”). In some embodiments, the alkyl moiety has 1 to 8 carbon atoms (“C1-8 perhaloalkoxy”). In some embodiments, the alkyl moiety has 1 to 6 carbon atoms (“C1-6 perhaloalkoxy”). In some embodiments, the alkyl moiety has 1 to 4 carbon atoms (“C1-4 perhaloalkoxy”). In some embodiments, the alkyl moiety has 1 to 3 carbon atoms (“C1-3 perhaloalkoxy”). In some embodiments, the alkyl moiety has 1 to 2 carbon atoms (“C1-2 perhaloalkoxy”). In some embodiments, all of the hydrogen atoms are each replaced with fluoro.
  • In some embodiments, all of the hydrogen atoms are each replaced with chloro. Examples of perhaloalkoxy groups include, but are not limited to, —OCF3, —OCF2CF3, —OCF2CF2CF3, —OCCl3, —OCFCl2, —OCF2Cl and the like.
  • As used herein, alone or as part of another group, “carbocyclyl” refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms (“C3-10 carbocyclyl”) and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms (“C3-4 carbocyclyl”). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (“C3-6 carbocyclyl”). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms (“C3-6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms (“C5-10 carbocyclyl”). Examples of C3 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclobutyl (C4), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl (C6), cyclohexenyl (C6), cyclohexadienyl (C6) and the like. Examples of C3-8 carbocyclyl groups include the aforementioned C3-6 carbocyclyl groups as well as cycloheptyl (C7), cycloheptadienyl (C7), cycloheptatrienyl (C7), cyclooctyl (C5), bicyclo[2.2.1]heptanyl, bicyclo[2.2.2]octanyl, and the like. Examples of C1-10 carbocyclyl groups include the aforementioned C3-8 carbocyclyl groups as well as octahydro-1H-indenyl, decahydronaphthalenyl, spiro[4.5]decanyl and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) or tricyclic system (“tricyclic carbocyclyl”)) and can be saturated or can contain one or more carbon-carbon double or triple bonds. “Carbocyclyl” also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring. Unless otherwise specified, each instance of a carbocyclyl group is independently unsubstituted (an “unsubstituted carbocyclyl”) or substituted (a “substituted carbocyclyl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the carbocyclyl group is an unsubstituted C3-10 carbocyclyl. In certain embodiments, the carbocyclyl group is a substituted C3-10 carbocyclyl.
  • In some embodiments, “carbocyclyl” is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms (“C3-10 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms (“C3-8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms (“C3-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms (“C5-6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms (“C5-10 cycloalkyl”). Examples of C5-6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5). Examples of C3-6 cycloalkyl groups include the aforementioned C5-6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C4). Examples of C3-8 cycloalkyl groups include the aforementioned C3-6 cycloalkyl groups as well as cycloheptyl (C7) and cyclooctyl (C5). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an “unsubstituted cycloalkyl”) or substituted (a “substituted cycloalkyl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the cycloalkyl group is an unsubstituted C3-10 cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C3-10 cycloalkyl.
  • As used herein, alone or as part of another group, “heterocyclyl” refers to a radical of a 3- to 14-membered non-aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“3-14 membered heterocyclyl”). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic heterocyclyl”) or tricyclic system (“tricyclic heterocyclyl”)), and can be saturated or can contain one or more carbon-carbon double or triple bonds. Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings. “Heterocyclyl” also includes ring systems wherein the heterocycyl ring, as defined above, is fused with one or more carbocycyl groups wherein the point of attachment is either on the carbocycyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring. In some embodiments, a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-10 membered heterocyclyl”). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-8 membered heterocyclyl”). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-6 membered heterocyclyl”). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen and sulfur. Exemplary 3-membered heterocyclyls containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, thiorenyl. Exemplary 4-membered heterocyclyls containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl. Exemplary 5-membered heterocyclyls containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl and pyrrolyl-2,5-dione. Exemplary 5-membered heterocyclyls containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered heterocyclyls containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, 1H-benzo[e][1,4]diazepinyl, 1,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl, 5,6-dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7-dihydro-4H-thieno[2,3-c]pyranyl, 2,3-dihydro-1H-pyrrolo[2,3-b]pyridinyl, 2,3-dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-1H-pyrrolo[2,3-b]pyridinyl, 4,5,6,7-tetrahydrofuro[3,2-c]pyridinyl, 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, 1,2,3,4-tetrahydro-1,6-naphthyridinyl, and the like. Unless otherwise specified, each instance of heterocyclyl is independently unsubstituted (an “unsubstituted heterocyclyl”) or substituted (a “substituted heterocyclyl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the heterocyclyl group is an unsubstituted 3-14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
  • As used herein, alone or as part of another group, “aryl” refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) aromatic ring system (e.g., having 6, 10 or 14 π electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system (“C6-14 aryl”). In some embodiments, an aryl group has 6 ring carbon atoms (“C6 aryl”; e.g., phenyl). In some embodiments, an aryl group has 10 ring carbon atoms (“C10 aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms (“C14 aryl”; e.g., anthracyl). “Aryl” also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring. Unless otherwise specified, each instance of an aryl group is independently unsubstituted (an “unsubstituted aryl”) or substituted (a “substituted aryl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the aryl group is an unsubstituted C6-14 aryl. In certain embodiments, the aryl group is a substituted C6-14 aryl.
  • “Aralkyl” is a subset of “alkyl” and refers to an alkyl group, as defined herein, substituted by an aryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
  • As used herein, alone or as part of another group, “heteroaryl” refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic or tricyclic) aromatic ring system (e.g., having 6, 10 or 14 π electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-14 membered heteroaryl”). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings. “Heteroaryl” also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or on the heteroaryl ring, or wherein the heteroaryl ring, as defined above, is fused with one or more carbocycyl or heterocycyl groups wherein the point of attachment is on the heteroaryl ring. For polycyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl). In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-10 membered heteroaryl”). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-8 membered heteroaryl”). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur (“5-6 membered heteroaryl”). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen and sulfur. Exemplary 5-membered heteroaryls containing 1 heteroatom include, without limitation, pyrrolyl, furanyl and thiophenyl. Exemplary 5-membered heteroaryls containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryls containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, thiadiazolyl. Exemplary 5-membered heteroaryls containing 4 heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryls containing 1 heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryls containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl and pyrazinyl. Exemplary 6-membered heteroaryls containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7 membered heteroaryls containing 1 heteroatom include, without limitation, azepinyl, oxepinyl and thiepinyl. Exemplary 5,6-bicyclic heteroaryls include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryls include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl and quinazolinyl. Exemplary tricyclic heteroaryls include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an “unsubstituted heteroaryl”) or substituted (a “substituted heteroaryl”) with 1, 2, 3, 4, or 5 substituents as described herein. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
  • “Heteroaralkyl” is a subset of “alkyl” and refers to an alkyl group, as defined herein, substituted by a heteroaryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
  • As used herein, the term “partially unsaturated” refers to a ring moiety that includes at least one double or triple bond. The term “partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl moieties) as herein defined.
  • Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl and heteroaryl groups, as defined herein, are optionally substituted (e.g., “substituted” or “unsubstituted” alkyl, “substituted” or “unsubstituted” alkenyl, “substituted” or “unsubstituted” alkynyl, “substituted” or “unsubstituted” carbocyclyl, “substituted” or “unsubstituted” heterocyclyl, “substituted” or “unsubstituted” aryl or “substituted” or “unsubstituted” heteroaryl group). In general, the term “substituted”, whether preceded by the term “optionally” or not, means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom etc.) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a “substituted” group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
  • Exemplary carbon atom substituents include, but are not limited to, halogen (i.e., fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I)), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORaa, —ON(Rbb)2, —N(Rbb)2, —N(Rbb)3 +X, —N(ORcc)Rbb, —SH, —SRaa, —SSRcc, —C(═O)Raa, —CO2H, —CHO, —C(ORcc)2, —CO2Raa, —OC(═O)Raa, —OCO2Raa, —C(═O)N(Rbb)2, —OC(═O)N(Rbb)2, —NRbbC(═O)Raa, —NRbbCO2Raa, —NRbbC(═O)N(Rbb)2, —C(═NRbb)Raa, —C(═NRbb)ORaa, —OC(═NRbb)Raa, —OC(═NRbb)ORaa, —C(═NRbb)N(Rbb)2, —OC(═NRbb)N(Rbb)2, —NRbbC(═NRbb)N(Rbb)2, —C(═O)NRbbSO2Raa, —NRbbSO2Raa, —SO2N(Rbb)2, —SO2Raa, —SO2ORaa, —OSO2Raa, —S(═O)Raa, —OS(═O)Raa, —Si(Raa)3, —OSi(Raa)3 —C(═S)N(Rbb)2, —C(═O)SRaa, —C(═S)SRaa, —SC(S)SRaa, —P(═O)2Raa, —OP(═O)2Raa, —P(═O)(Raa)2, —OP(═O)(Raa)2, —OP(═O)(ORcc)2, —P(═O)2N(Rbb)2, —OP(═O)2N(Rbb)2, —P(═O)(NRbb)2, —OP(═O)(NRbb)2, —NRbbP(═O)(ORcc)2, —NRbbP(═OX)(NRbb)2, —P(Rcc)2, —P(Rcc)3, —OP(Rcc)2, —OP(Rcc)3, —B(ORcc)2, —BRaa(ORcc), C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-4 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
  • or two geminal hydrogens on a carbon atom are replaced with the group ═O, ═S, ═NN(Rbb)2, ═NNRbbC(═O)RU, ═NNRbbC(═O)ORaa, ═NNRbbS(═O)2Raa, ═NRbb, ═NORcc;
  • each instance of Raa is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
  • each instance of Rbb is, independently, selected from hydrogen, —OH, —ORaa, —N(Rcc)2, —CN, —C(═O)Raa, —C(═O)N(Rcc)2, —CO2Raa, —SO2Raa, C(═NRcc)ORaa, —C(═NRcc)N(Rcc)2, —SO2N(Rcc)2, —SO2Rcc, —SO2ORcc, —SORaa, —C(═S)N(Rcc)2, —C(═O)SRcc, —C(═S)SRcc, —P(═O)2Raa, —P(═O)(Raa)2, —P(═O)2N(Rcc)2, —P(═O)(NRcc)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C1-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rcc groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
  • each instance of Rcc is, independently, selected from hydrogen, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rcc groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
  • each instance of Rdd is, independently, selected from halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORee, —ON(Rff)2, —N(Rff)2, —N(Rff)3 +X, —N(ORee)Rff, —SH, —SRee, —SSRee, —C(═O)Ree, —CO2H, —CO2Ree, —OC(═O)Ree, —OCO2Ree, —C(═O)N(Rff)2, —OC(═O)N(Rff)2, —NRffC(═O)Ree, —NRffCO2Ree, —NRffC(═O)N(Rff)2, —C(═NRff)ORee, —OC(═NRff)Ree, —OC(═NRff)ORee, —C(═NRff)N(Rff)2, —OC(═NRff)N(Rff)2, —NRffC(═NRff)N(Rff)2, —NRffSO2Ree, —SO2N(Rff)2, —SO2Ree, —SO2ORee, —OSO2Ree, —S(═O)Ree, —Si(Ree)3, —OSi(Ree)3, —C(═S)N(Rff)2, —C(═O)SRee, —C(═S)SRee, —SC(═S)SRee, —P(═O)2Ree, —P(═O)(Ree)2, —OP(═O)(Ree)2, —OP(═O)(ORee)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups, or two geminal Rdd substituents can be joined to form ═O or ═S;
  • each instance of Ree is, independently, selected from C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups;
  • each instance of Rff is, independently, selected from hydrogen, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl and 5-10 membered heteroaryl, or two Rff groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups; and
  • each instance of Rgg is, independently, halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OC1-6 alkyl, —ON(C1-6 alkyl)2, —N(C1-6 alkyl)2, —N(C1-6 alkyl)3X, —NH(C1-6 alkyl)2X, —NH2(C1-6 alkyl)X, —NH3X, —N(OC1-6 alkyl)(C1-6 alkyl), —N(OH)(C1-6 alkyl), —NH(OH), —SH, —SC1-6 alkyl, —SS(C1-6 alkyl), —C(═O)(C1-6 alkyl), —CO2H, —CO2(C1-6 alkyl), —OC(═O)(C1-6 alkyl), —OCO2(C1-6 alkyl), —C(═O)NH2, —C(═O)N(C1-6 alkyl)2, —OC(═O)NH(C1-6 alkyl), —NHC(═O)(C1-6 alkyl), —N(C1-6 alkyl)C(═O)(C1-6 alkyl), —NHCO2(C1-6 alkyl), —NHC(═O)N(C1-6 alkyl)2, —NHC(═O)NH(C1-6 alkyl), —NHC(═O)NH2, —C(═NH)O(C1-6 alkyl), —OC(═NH)(C1-6 alkyl), —OC(═NH)OC1-6 alkyl, —C(═NH)N(C1-6 alkyl)2, —C(═NH)NH(C1-6 alkyl), —C(═NH)NH2, —OC(═NH)N(C1-6 alkyl)2, —OC(NH)NH(C1-6 alkyl), —OC(NH)NH2, —NHC(NH)N(C1-6 alkyl)2, —NHC(═NH)NH2, —NHSO2(C1-6 alkyl), —SO2N(C1-6 alkyl)2, —SO2NH(C1-6 alkyl), —SO2NH2, —SO2C1-6 alkyl, —SO2OC1-6 alkyl, —OSO2C1-6 alkyl, —SOC1-6 alkyl, —Si(C1-6 alkyl)3, —OSi(C1-6 alkyl)3 —C(═S)N(C1-6 alkyl)2, C(═S)NH(C1-6 alkyl), C(═S)NH2, —C(═O)S(C1-6 alkyl), —C(═S)SC1-6 alkyl, —SC(═S)SC1-6 alkyl, —P(═O)2(C1-6 alkyl), —P(═O)(C1-6 alkyl)2, —OP(═O)(C1-6 alkyl)2, —OP(═O)(OC1-6 alkyl)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two geminal Rgg substituents can be joined to form ═O or ═S;
  • wherein X is a counterion.
  • As used herein, a “counterion” is a negatively charged group associated with a positively charged quarternary amine in order to maintain electronic neutrality. Exemplary counterions include halide ions (e.g., F, Cl, Br, I), NO3 , ClO4 , OH, H2PO4 , HSO4 , sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate, ethan-1-sulfonic acid-2-sulfonate, and the like) and carboxylate ions (e.g., acetate, ethanoate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, and the like).
  • Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary and quarternary nitrogen atoms. Exemplary nitrogen atom substitutents include, but are not limited to, hydrogen, —OH, —ORaa, —N(Rcc)2, —CN, —C(═O)Raa, —C(═O)N(Rcc)2, —CO2Raa, —SO2Raa, —C(═NRbb)Raa, —C(═NRcc)ORaa, —C(═NRcc)N(Rcc)2, —SO2N(Rcc)2, —SO2Rcc, —SO2ORcc, —SORaa, —C(═S)N(Rcc)2, —C(═O)SRcc, —C(═S)SRcc, —P(═O)2Raa, —P(═O)(Raa)2, —P(═O)2N(Rcc)2, —P(═O)(NRcc)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rcc groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc and Rdd are as defined above.
  • In certain embodiments, the substituent present on the nitrogen atom is an amino protecting group. Amino protecting groups include, but are not limited to, —OH, —ORaa, —N(Rcc)2, —C(═O)Raa, —C(═O)N(Rcc)2, —CO2Raa, —SO2Raa, —C(═NRcc)Raa, —C(═NRcc)ORaa, —C(═NRcc)N(Rcc)2, —SO2N(Rcc)2, —SO2Rcc, —SO2ORcc, —SORaa, —C(═S)N(Rcc)2, —C(═O)SRcc, —C(═S)SRcc, C1-10 alkyl (e.g., aralkyl groups), C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups, and wherein Raa, Rbb, Rcc and Rdd are as defined above. Amino protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
  • For example, amino protecting groups such as amide groups (e.g., —C(═O)Raa) include, but are not limited to, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, p-phenylbenzamide, o-nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N′-dithiobenzyloxycarbonylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine derivative, o-nitrobenzamide and o-(benzoyloxymethyl)benzamide.
  • Amino protecting groups such as carbamate groups (e.g., —C(═O)ORaa) include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1-(1-adamantyl)-1-methylethyl carbamate (Adpoc), 1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc), 1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2′- and 4′-pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate (BOC), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), p-nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(1,3-dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate, t-amyl carbamate, S-benzyl thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxycarbonylvinyl carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate, 1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate, 1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p′-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1-methyl-1-cyclopropylmethyl carbamate, 1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate, 1-methyl-1-(p-phenylazophenyl)ethyl carbamate, 1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate, 2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6-trimethylbenzyl carbamate.
  • Amino protecting groups such as sulfonamide groups (e.g., —S(═O)2Raa) include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4-methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), β-trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4′,8′-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS), benzylsulfonamide, trifluoromethylsulfonamide, and phenacylsulfonamide.
  • Other amino protecting groups include, but are not limited to, phenothiazinyl-(10)-carbonyl derivative, N′-p-toluenesulfonylaminocarbonyl derivative, N′-phenylaminothiocarbonyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted 1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2-(trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(1-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr), N-9-phenylfluorenylamine (PhF), N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino (Fcm), N-2-picolylamino N′-oxide, N-1,1-dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine, N—(N′,N′-dimethylaminomethylene)amine, N,N′-isopropylidenediamine, N-p-nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N-[phenyl(pentacarbonylchromium- or tungsten)carbonyl]amine, N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide, triphenylmethylsulfenamide and 3-nitropyridinesulfenamide (Npys).
  • As used herein, a “leaving group” is an art-understood term referring to a molecular fragment that departs with a pair of electrons in heterolytic bond cleavage, wherein the molecular fragment is an anion or neutral molecule. See, for example, Smith, March Advanced Organic Chemistry 6th ed. (501-502).
  • These and other exemplary substituents are described in more detail in the Detailed Description, the Exemplification and in the claims. The invention is not intended to be limited in any manner by the above exemplary listing of substituents.
  • As used herein, a “pharmaceutically acceptable form thereof” includes pharmaceutically acceptable salts, hydrates, solvates, prodrugs, tautomers, isomers, and/or polymorphs of a compound of the present invention, as defined below and herein.
  • As used herein, the term “pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et al., describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19. Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases. Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N+(C1-4 alkyl)4 salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
  • In certain embodiments, the pharmaceutically acceptable form thereof is an isomer. As used herein, the term “isomer” includes any and all geometric isomers and stereoisomers. For example, “isomers” include cis- and trans-isomers, E- and Z-isomers, R- and S-enantiomers, diastereomers, (D)-isomers, (L)-isomers, racemic mixtures thereof, and other mixtures thereof, as falling within the scope of the invention.
  • In certain embodiments, the pharmaceutically acceptable form thereof is a tautomer. As used herein, the term “tautomer” includes two or more interconvertable compounds resulting from at least one formal migration of a hydrogen atom and at least one change in valency (e.g., a single bond to a double bond, a triple bond to a single bond, or vice versa). The exact ratio of the tautomers depends on several factors, including temperature, solvent, and pH. Tautomerizations (i.e., the reaction providing a tautomeric pair) may catalyzed by acid or base. Exemplary tautomerizations include keto-to-enol; amide-to-imide; lactam-to-lactim; enamine-to-imine; and enamine-to-(a different) enamine tautomerizations.
  • In certain embodiments, the pharmaceutically acceptable form thereof is a hydrate or solvate. As used herein, the term “hydrate” refers to a compound non-covalently associated with one or more molecules of water. Likewise, “solvate” refers to a compound non-covalently associated with one or more molecules of an organic solvent.
  • In certain embodiments, the pharmaceutically acceptable form thereof is a prodrug. As used herein, the term “prodrug” refers to a derivative of a parent compound that requires transformation within the body in order to release the parent compound. In certain cases, a prodrug has improved physical and/or delivery properties over the parent compound. Prodrugs are typically designed to enhance pharmaceutically and/or pharmacokinetically based properties associated with the parent compound. The advantage of a prodrug can lie in its physical properties, such as enhanced water solubility for parenteral administration at physiological pH compared to the parent compound, or it enhances absorption from the digestive tract, or it may enhance drug stability for long-term storage.
  • In certain embodiments, the pharmaceutically acceptable form thereof is a polymorph. As used herein, “polymorph” refers to a compound having more than one crystal structure, e.g., resulting from differences in molecular packing and/or molecular conformation of the compound in the solid state.
  • Sequence Identification Numbers
  • SEQ. ID. NO.: Homo sapiens FAAH amino acid sequence:
  • MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQR
    AGLENMDRAAQRFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLF
    TYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVSLKECFTY
    KGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDC
    SNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFP
    SSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCL
    RALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMR
    RAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNF
    KGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSA
    GKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGA
    VSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGM
    KKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
  • DETAILED DESCRIPTION
  • I. Compounds
  • The present invention provides isoxazoline FAAH inhibitor compounds of the formula (I):
  • Figure US20150099738A1-20150409-C00003
  • or a pharmaceutically acceptable form thereof,
  • wherein:
  • Ra and Rd are joined to form a C3-10 carbocycyl or 3-14 membered heterocyclyl fused ring, and Rb and Rc are independently selected from —H, C1-10 alkyl and C1-10 perhaloalkyl; or
  • Rc and Rd are joined to form a C3-10 carbocycyl or 3-14 membered heterocyclyl spiro-fused ring, and Ra and Rb are independently selected from —H, C1-10 alkyl and C1-10 perhaloalkyl;
  • L is a covalent bond or a divalent C1-6 hydrocarbon group, wherein one, two or three methylene units of L are optionally and independently replaced with one or more oxygen, sulfur or nitrogen atoms;
  • G is selected from —CN, —NO2, —S(═O)Re, —SO2Re, —SO2NRfRe, —PO2Re, —PO2ORe, —PO2NRfRe, —(C═O)Re, —(C═O)ORe, —(C═O)NRfRe, —Br, —I, —F, —Cl, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, —[N(Rf)2Re]+X wherein X is a counterion; and
  • each Re is selected from C1-10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocycyl, C6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl; each Rf attached to a nitrogen atom is, independently, selected from —H, C1-10 alkyl, or an amino protecting group; or Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • Group G
  • As defined above, G is selected from —CN, —NO2, —S(═O)Re, —SO2Re, —SO2NRfRe, —PO2Re, —PO2ORe, —PO2NRfRe, —(C═O)Re, —(C═O)ORe, —(C═O)NRfRe, —Br, —I, —F, —Cl, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, —[N(Rf)2Re]+Xwherein X is a counterion;
  • and wherein Re is selected from C1-10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocycyl, C6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl; each Rf attached to a nitrogen atom is, independently, selected from —H, C1-10 alkyl, or an amino protecting group; or Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • In certain embodiments, G is not a leaving group, e.g., for example, G is selected from —F, —CN, —NO2, —S(═O)Re, —SO2Re, —SO2NRfRe, —PO2Re, —PO2ORe, —PO2NRfRe, —(C═O)Re, —(C═O)ORe, and —(C═O)NRfRe.
  • In certain embodiments, G is selected from —CN and —NO2. In certain embodiments, G is —CN. In certain embodiments, G is —NO2.
  • In certain embodiments, G is selected from —S(═O)Re, —SO2Re, and —SO2NRfRe. In certain embodiments, G is —S(═O)Re. In certain embodiments, G is —SO2Re. In certain embodiments, G is —SO2NRfRe.
  • In certain embodiments, G is selected from —PO2Re, —PO2ORe and —PO2NRfRe. In certain embodiments, G is —PO2Re. In certain embodiments, G is —PO2ORe. In certain embodiments, G is —PO2NRfRe.
  • In certain embodiments, G is selected from —(C═O)Re, —(C═O)ORe and —(C═O)NRfRe. In certain embodiments, G is —(C═O)Re. In certain embodiments, G is —(C═O)ORe. In certain embodiments, G is —(C═O)NRfRe.
  • However, in certain embodiments, G is a leaving group, e.g., for example, G is selected from —Cl, —Br, —I, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, and —[N(Rff)2R]+Xwherein X is a counterion.
  • In certain embodiments, G is a halogen; i.e., selected from —F, —Cl, —Br and —I. In certain embodiments, G is —F. In certain embodiments, G is —Br. In certain embodiments, G is —I. In certain embodiments, G is —Cl. However, in certain embodiments, G is not a halogen. For example, in certain embodiments, G is not —Br. In certain embodiments, G is not —I. In certain embodiments, G is not —F. In certain embodiments, G is not —Cl.
  • In certain embodiments, G is selected from —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —OSO2Re, —OPO2Re, —OPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —O(C═O)NRfRe and —O(C═NRf)NRfRe. In certain embodiments, G is selected from —ORe, —O(C═O)Re, —O(C═O)ORe, —O(C═O)NRfRe and —O(C═NRf)NRfRe. In certain embodiments, G is selected from —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —OPO2NRfRe, —O(C═O)NRfRe and —O(C═NRf)NRfRe. In certain embodiments, G is —ORe. In certain embodiments, G is —ONRfRe. In certain embodiments, G is —ONRf(C═O)Re. In certain embodiments, G is —ONRfSO2Re. In certain embodiments, G is —ONRfPO2Re. In certain embodiments, G is —ONRfPO2ORe. In certain embodiments, G is —OSO2Re. In certain embodiments, G is —OPO2Re. In certain embodiments, G is —OPO2ORe. In certain embodiments, G is —OPO2NRfRe. In certain embodiments, G is —O(C═O)Re. In certain embodiments, G is —O(C═O)ORe. In certain embodiments, G is —O(C═O)NRfRe. In certain embodiments, G is —O(C═NRf)NRfRe.
  • In certain embodiments, G is selected from —ORe and —SRe. In certain embodiments, G is selected from —ORe. In certain embodiments, G is —SRe.
  • In certain embodiments, G is selected from —NRfSO2Re, —NRfPO2Re, —NRfPO2ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —NRf(C═NRf)NRfRe, —NRf(C═NRf)ORe and —[N(Rf)2Re]X wherein X is a counterion. In certain embodiments, G is selected from —NRfSO2Re, —NRfPO2Re, —NRfPO2ORe, —NRfRe, —NRf(C═O)Re and —NRf(C═O)ORe. In certain embodiments, G is selected from —NRfSO2Re, —NRfRe, —NRf(C═O)Re and —NRf(C═O)ORe. In certain embodiments, G is —NRfSO2Re. In certain embodiments, G is —NRfPO2Re. In certain embodiments, G is —NRfPO2ORe. In certain embodiments, G is —NRfRe. In certain embodiments, G is —NRf(C═O)Re. In certain embodiments, G is —NRf(C═O)ORe. In certain embodiments, G is —NRf(C═NRf)NRfRe. In certain embodiments, G is —NRf(C═NRf)ORe. In certain embodiments, G is —[N(Rf)2Re]+X wherein X is a counterion.
  • Additional embodiments of G, included in the description of groups Re and Rf, and further exemplified in the Tables and Examples, is provided below and herein.
  • Re of Group G
  • As defined generally above, in certain embodiments, wherein G is selected from —S(═O)Re, —SO2Re, —SO2NRfRe, —PO2Re, —PO2ORe, —PO2NRfRe, —(C═O)Re, —(C═O)ORe, —(C═O)NRfRe, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, and —[N(Rff)2Re]+X wherein X is a counterion, Re is selected from C1-10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocycyl, C6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl.
  • In certain embodiments, Re is selected from C1-10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocycyl, C6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl, wherein the alkyl, alkenyl, alkynyl, carbocycyl, aryl, heterocyclyl, and heteroaryl groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups, as defined below and herein.
  • In certain embodiments, Re is C1-10 alkyl. In certain embodiments, Re is C1-6 alkyl. In certain embodiments, Re is C1-6 alkyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a C1-5 alkyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a C1-4 alkyl substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re is a C1-3 alkyl substituted with 0, 1, 2 or 3 Rh groups. In certain embodiments, Re is a C1-2 alkyl substituted with 0, 1 or 2 Rh groups. Exemplary alkyl groups include, but are not limited to, methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl, isopentyl, neopentyl, and hexyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • In certain embodiments, Re is a C1-6 perhaloalkyl. In certain embodiments, Re is a C1-5 perhaloalkyl. In certain embodiments, Re is a C1-4 perhaloalkyl. In certain embodiments, Re is a C1-3 perhaloalkyl. In certain embodiments, Re is a C1-2 perhaloalkyl. Exemplary Re perhaloalkyl groups include, but are not limited to, —CF3, —CF2CF3, —CF2CF2CF3, —CCl3, —CFCl2, and —CF2Cl.
  • In certain embodiments, Re is C2-10 alkenyl. In certain embodiments, Re is C2-6 alkenyl. In certain embodiments, Re is a C2-6 alkenyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a C2-5 alkenyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a C2-3 alkenyl substituted with 0, 1, 2, or 3 Rh groups. Exemplary alkenyl groups include, but are not limited to, ethenyl, 1-propenyl, 2-propenyl, 1-butenyl, 2-butenyl, butadienyl, pentenyl, pentadienyl and hexenyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • In certain embodiments, Re is C2-10 alkynyl. In certain embodiments, Re is C2-6 alkynyl. In certain embodiments, Re is C2-6 alkynyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is C2-5 alkynyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is C2-4 alkynyl substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re is C2-3 alkynyl substituted with 0, 1, 2 or 3 Rh groups. Exemplary Re alkynyl groups include, but are not limited to, ethynyl, 1-propynyl, 2-propynyl, 1-butynyl, 2-butynyl, pentynyl and hexynyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • However, in certain embodiments, wherein G is —ORe, then Re is not C1-6 alkyl (e.g., methyl, ethyl, propyl, isopropyl, aralkyl). In certain embodiments, wherein G is —ORe, then Re is not C2-6 alkenyl (e.g., allyl).
  • In certain embodiments, wherein G is —SRe, then Re is not then Re is not C1-6 alkyl (e.g., methyl, ethyl, propyl, isopropyl, aralkyl).
  • In certain embodiments, wherein G is —NReRf and Rf is —H or C1-3 alkyl (e.g., methyl, ethyl, aralkyl) then Re is not C1-6 alkyl.
  • In certain embodiments, Re is C6-14 aryl. In certain embodiments, Re is C6-10 aryl. In certain embodiments, Re is C6-10 aryl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is C6 aryl (e.g., phenyl) substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a C1-10 aryl (e.g., naphthyl) substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • In certain embodiments, Re is phenyl. In certain embodiments, Re is phenyl substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re is phenyl substituted with 0, 1, 2 or 3 Rh groups. In certain embodiments, Re is phenyl substituted with 0, 1 or 2 Rh groups. In certain embodiments, Re is phenyl substituted with 0 or 1 Rh groups. In certain embodiments, Re is a disubstituted phenyl (i.e., substituted with 2 Rh groups). In certain embodiments, Re is a monosubstituted phenyl (i.e., substituted with 1 Rh group). In certain embodiments, Re is an unsubstituted phenyl (i.e., substituted with 0 Rh groups).
  • In certain embodiments, Re is phenyl substituted with at least one ortho Rh group. In certain embodiments, Re is phenyl substituted with at least one meta Rh group. In certain embodiments, Re is phenyl substituted with at least one para Rh group.
  • In certain embodiments, Re is a phenyl group of the formula:
  • Figure US20150099738A1-20150409-C00004
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh is as defined below and herein. In certain embodiments, x is 0, 1, 2, 3 or 4. In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1. In certain embodiments, x is 3. In certain embodiments, Re is a disubstituted phenyl group (i.e., wherein x is 2). In certain embodiments, Re is a monosubstituted phenyl group (i.e., wherein x is 1). In certain embodiments, Re is an unsubstituted phenyl group (i.e., wherein x is 0).
  • For example, in certain embodiments, Re is a substituted or unsubstituted phenyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00005
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a naphthyl. In certain embodiments, Re is a naphthyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00006
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh is as defined below and herein. In certain embodiments, x is 0, 1, 2, 3 or 4. In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1. In certain embodiments, Re is a trisubstituted naphthyl group (i.e., wherein x is 3). In certain embodiments, Re is a disubstituted naphthyl group (i.e., wherein x is 2). In certain embodiments, Re is a monosubstituted naphthyl group (i.e., wherein x is 1). In certain embodiments, Re is an unsubstituted naphthyl group (i.e., wherein x is 0).
  • For example, in certain embodiments, Re is a substituted or unsubstituted 1-naphthyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00007
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a substituted or unsubstituted 2-naphthyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00008
  • wherein Rh is as defined below and herein.
  • However, in certain embodiments, wherein G is —ORe, then Re is not C10 aryl (e.g., 1-naphthyl, 2-naphthyl).
  • In certain embodiments, Re is 5-14 membered heteroaryl. In certain embodiments, Re is a 5-10 membered heteroaryl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 5-8 membered heteroaryl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 5-6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re is a 9-10 membered heteroaryl substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • Exemplary Re heteroaryl groups include, but are not limited to, pyrrolyl, furanyl and thiophenyl, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl, tetrazolyl, pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl), pyridazinyl (e.g., 3-pyridazinyl, 4-pyridazinyl), pyrimidinyl (e.g. 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl), pyrazinyl, triazinyl, tetrazinyl, azepinyl, oxepinyl, thiepinyl, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, purinyl, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, quinazolinyl, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • In certain embodiments, Re is a 5-membered heteroaryl. In certain embodiments, Re is a 5-membered heteroaryl substituted with 0, 1, 2 or 3 Rh groups. In certain embodiments, Re is a 5-membered heteroaryl selected pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl and tetrazolyl, wherein such groups are substituted with 0, 1, 2 or 3 Rh groups.
  • For example, in certain embodiments, Re is a 5-membered heteroaryl of the formula:
  • Figure US20150099738A1-20150409-C00009
  • wherein Ya, Yb, Yc and Yd are, independently, selected from CH, CRh, O, S, N, or NRk, with the proviso that at least one of Ya, Yb, Yc and Yd is O, S, N or NRk, and wherein Rh and Rk are defined below and herein.
  • In certain embodiments of the above formula (i-d), Ya is O, S, N, or NRk and Yb, Yc and Yd are, independently, selected from CH, CRh, NRk or N. In certain embodiments of the above formula (i-d), Ya is O, S, N, or NRk and Yb, Yc and Yd are, independently, selected from CH or CRh. In certain embodiments of the above formula (i-d), Ya is O, S, or NRk, Yc is N and Yb and Yd are, independently, selected from CH or CRh.
  • In certain embodiments of the above formula (i-d), Yb is O, S, or NRk and Ya, Yc and Yd are, independently, selected from CH, CRh or N. In certain embodiments of the above formula (i-d), Yb is O, S, or NRk and Ya, Yc and Yd are, independently, selected from CH or CRh. In certain embodiments of the above formula (i-d), Yb is O, S, or or NRk, Yd is N and Ya and Yc are, independently, selected from CH or CRh.
  • In certain embodiments, Re is a substituted or unsubstituted 5-membered heteroaryl of any one of the formulae:
  • Figure US20150099738A1-20150409-C00010
  • wherein x is 0, 1 or 2, and Rh and Rk are as defined below and herein. In certain embodiments, Re is an unsubstituted 5-membered heteroaryl (i.e., wherein x is 0). In certain embodiments, Re is a substituted 5-membered heteroaryl (e.g., wherein x is 1 or 2). In certain embodiments, Re is a monosubstituted 5-membered heteroaryl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted 5-membered heteroaryl (i.e., wherein x is 2). In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • However, in certain embodiments, wherein G is —ORe, Re is not thiazolyl, e.g., of the formula:
  • Figure US20150099738A1-20150409-C00011
  • wherein x is 0, 1 or 2, and Rh and Rk are as defined below and herein.
  • In certain embodiments, Re is a 6-membered heteroaryl. In certain embodiments, Re is a 6-membered heteroaryl substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re is a 6-membered heteroaryl selected from the group consisting of pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl), pyridazinyl (e.g., 3-pyridazinyl, 4-pyridazinyl), pyrimidinyl (e.g. 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl), pyrazinyl, triazinyl and tetrazinyl, wherein such groups are substituted with 0, 1, 2, 3 or 4 Rh groups.
  • For example, in certain embodiments, Re is a 6-membered heteroaryl group of the formula:
  • Figure US20150099738A1-20150409-C00012
  • wherein Wa, Wb, Wc, Wd and We are, independently, selected from CH, CRh or N, with the proviso that at least one of Wa, Wb, Wc, Wd, and We is N, and wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a pyrindinyl group. In certain embodiments, Re is a pyrindinyl group substituted with 0, 1, 2, 3 or 4 Rh groups. For example, in certain embodiments, Re is a pyrindinyl group of the formula:
  • Figure US20150099738A1-20150409-C00013
  • wherein x is 0, 1, 2, 3 or 4, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted pyrindinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted pyrindinyl (e.g., wherein x is 1, 2, 3 or 4). In certain embodiments, Re is a monosubstituted pyrindinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted pyrindinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted pyrindinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 2-pyrindinyl group, e.g., of the formula (i-e) wherein Wa is N and Wb, Wc, Wd and We are, independently, CH or CRh. In certain embodiments Re is a 3-pyrindinyl group, e.g., of the formula (i-e) wherein Wb is N and Wa, Wc, Wd and We are, independently, CH or CRh. In certain embodiments Re is a 4-pyrindinyl group, e.g., of the formula (i-e) wherein Wc is N and Wa, Wb, Wd and We are, independently, CH or CRh.
  • In certain embodiments, Re is a substituted or unsubstituted 2-pyridinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00014
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a substituted or unsubstituted 3-pyridinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00015
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a substituted or unsubstituted 4-pyridinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00016
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a pyridazinyl group. In certain embodiments, Re is a pyridazinyl group substituted with 0, 1, 2 or 3 Rh groups. For example, in certain embodiments, Re is a pyridazinyl group of the formula:
  • Figure US20150099738A1-20150409-C00017
  • wherein x is 0, 1, 2 or 3, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted pyridazinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted pyridazinyl (e.g., wherein x is 1, 2 or 3). In certain embodiments, Re is a monosubstituted pyridazinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted pyridazinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted pyridazinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 3-pyridazinyl group, e.g., of the formula (I-e) wherein Wa and Wb are N and Wc, Wd and We are, independently, CH or CRh. In certain embodiments Re is a 4-pyridazinyl group, e.g., of the formula (I-e) wherein Wb and Wc are N and Wa, Wd and We are, independently, CH or CRh.
  • In certain embodiments, Re is a substituted or unsubstituted 3-pyridazinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00018
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a substituted or unsubstituted 4-pyridazinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00019
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a pyrimidinyl group. In certain embodiments, Re is a pyrimidinyl group substituted with 0, 1, 2 or 3 Rh groups. For example, in certain embodiments, Re is a pyrimidinyl group of the formula:
  • Figure US20150099738A1-20150409-C00020
  • wherein x is 0, 1, 2 or 3, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted pyrimidinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted pyrimidinyl (e.g., wherein x is 1, 2 or 3). In certain embodiments, Re is a monosubstituted pyrimidinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted pyridazinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted pyrimidinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 2-pyrimidinyl group, e.g., of the formula (i-e) wherein Wa and We are N and Wb, Wc and Wd are, independently, CH or CRh. In certain embodiments Re is a 4-pyrimidinyl group, e.g., of the formula (i-e) wherein Wa and Wc are N and Wb, Wd and We are, independently, CH or CRh. In certain embodiments Re is a 5-pyrimidinyl group, e.g., of the formula (i-e) wherein Wb and Wd are N and Wa, Wc and We are, independently, CH or CRh.
  • In certain embodiments, Re is a substituted or unsubstituted 2-pyrimidinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00021
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a substituted or unsubstituted 4-pyrimidinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00022
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a substituted or unsubstituted 5-pyrimidinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00023
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a pyrazinyl group. In certain embodiments, Re is a pyrazinyl group substituted with 0, 1, 2 or 3 Rh groups. For example, in certain embodiments, Re is a pyrazinyl group of the formula:
  • Figure US20150099738A1-20150409-C00024
  • wherein x is 0, 1, 2 or 3, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted pyrazinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted pyrazinyl (e.g., wherein x is 1, 2 or 3). In certain embodiments, Re is a monosubstituted pyrazinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted pyrazinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted pyrazinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a substituted or unsubstituted pyrazinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00025
  • wherein Rh is as defined below and herein.
  • In certain embodiments Re is a triazinyl group. In certain embodiments Re is a triazinyl group substituted with 0, 1 or 2 Rh groups. For example, in certain embodiments, Re is a triazinyl group of the formula:
  • Figure US20150099738A1-20150409-C00026
  • wherein x is 0, 1 or 2, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted pyrazinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted pyrazinyl (e.g., wherein x is 1 or 2). In certain embodiments, Re is a monosubstituted pyrazinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted pyrazinyl (i.e., wherein x is 2). In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a substituted or unsubstituted triazinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00027
  • wherein Rh is as defined below and herein.
  • In certain embodiments Re is a tetrazinyl group. In certain embodiments Re is a tetrazinyl group substituted with 0 or 1 Rh groups. For example, in certain embodiments, Re is a tetrazinyl group of the formula:
  • Figure US20150099738A1-20150409-C00028
  • wherein x is 0 or 1, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted pyrazinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted pyrazinyl (e.g., wherein x is 1). In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a substituted or unsubstituted tetrazinyl group of any one of the formulae:
  • Figure US20150099738A1-20150409-C00029
  • wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a 9-membered heteroaryl (e.g., a 5,6-bicyclic heteroaryl). In certain embodiments, Re is a 5,6-bicyclic heteroaryl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 5,6-bicyclic heteroaryl selected from indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • For example, in certain embodiments, Re is a 5,6-bicyclic heteroaryl of the formula:
  • Figure US20150099738A1-20150409-C00030
  • wherein Ye, Yf, Yg, Yi, Yj, Yk and Ym are, independently, C, CH, CRh, O, S, N, or NRk and Yn is C or N, with the proviso that at least one of Ye Yf, Yg is selected from O, S, N or NRk wherein Rh and Rk are as defined below and herein.
  • In certain embodiments, Re is a 5,6-bicyclic heteroaryl group of the formula (i-f), wherein Ye is selected from O, S, or NRk, y is C, and Yf, Yg, Yi, Yk and Ym are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a 5,6-bicyclic heteroaryl group of the formulae:
  • Figure US20150099738A1-20150409-C00031
  • wherein x is 0, 1, 2, 3, 4 or 5 and Rh and Rk are defined below and herein. In certain embodiments, Re is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, Re is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 5,6-bicyclic heteroaryl wherein Ye is selected from O, S, or NRk; Yg is N; Yn is C; Yf is C, CH, or CRh or N, and Yi, Yj, Yk and Ym are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a 5,6-bicyclic heteroaryl group of the formulae:
  • Figure US20150099738A1-20150409-C00032
  • wherein x is 0, 1, 2, 3, 4 or 5 and Rh and Rk are defined below and herein. In certain embodiments, Re is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, Re is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 5,6-bicyclic heteroaryl wherein Ye is NRk, S or O; Ym is N; Yn is C; and Yf, Yg, Yi, Yj, and Yk are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a 5,6-bicyclic heteroaryl group of the formulae:
  • Figure US20150099738A1-20150409-C00033
  • wherein x is 0, 1, 2, 3, 4 or 5 and Rh and Rk are defined below and herein. In certain embodiments, Re is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, Re is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 5,6-bicyclic heteroaryl wherein Y8 is O, S, or NRk; Ym is N; Yn is C; and Ye, Yf, Yi, Yj and Yk are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a 5,6-bicyclic heteroaryl group of the formulae:
  • Figure US20150099738A1-20150409-C00034
  • wherein x is 0, 1, 2, 3, 4 or 5 and Rh and Rk are defined below and herein. In certain embodiments, Re is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, Re is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 5,6-bicyclic heteroaryl wherein Ye is selected from N; Yn is N; and Yf, Yi, Yj, Yk and Ym are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a 5,6-bicyclic heteroaryl group of the formula:
  • Figure US20150099738A1-20150409-C00035
  • wherein x is 0, 1, 2, 3, 4 or 5 and Rh and Rk are defined below and herein. In certain embodiments, Re is an unsubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 0). In certain embodiments, Re is a substituted 5,6-bicyclic heteroaryl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted 5,6-bicyclic heteroaryl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 10-membered heteroaryl (e.g., a 6,6-bicyclic heteroaryl). In certain embodiments, Re is a 6,6-bicyclic heteroaryl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 6,6-bicyclic heteroaryl selected from naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl and quinazolinyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • For example, in certain embodiments, Re is a 6,6-bicyclic heteroaryl of the formula:
  • Figure US20150099738A1-20150409-C00036
  • wherein Wf, Wg, Wh, Wi, Wj, Wk, Wm and Wn are, independently, selected from C, CH, CRh or N, with the proviso that at least one of Wf, Wg, Wh, Wi, Wj, Wk, Wm and Wa is N, and wherein Rh is as defined below and herein.
  • In certain embodiments, Re is a quinolinyl group; e.g., of the formula (i-g) wherein Wi is N and Wg, Wh, Wf, Wj, Wk, Wm and Wa are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a quinolinyl group of the formulae:
  • Figure US20150099738A1-20150409-C00037
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted quinolinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted quinolinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted quinolinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted quinolinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted quinolinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is an isoquinolinyl group; e.g., of the formula (i-g) wherein Wh is N and Wf, Wg, Wi, Wk, Wm and Wn are, independently, C, CH, or CRh. For example, in certain embodiments, Re is an isoquinolinyl group of the formulae:
  • Figure US20150099738A1-20150409-C00038
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted isoquinolinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted isoquinolinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted isoquinolinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted isoquinolinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted isoquinolinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a quinoxalinyl group; e.g., of the formula (i-g) wherein Wf and Wi are N and Wg, Wh, Wj, Wk, Wm and Wn are, independently, C, CH, or CRh. For example, in certain embodiments, Re is a quinoxalinyl group of the formulae:
  • Figure US20150099738A1-20150409-C00039
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh is as defined below and herein. In certain embodiments, Re is an unsubstituted quinoxalinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted quinoxalinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted quinoxalinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted quinoxalinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted quinoxalinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 3-14 membered heterocyclyl. In certain embodiments, Re is a 3-14 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 5-10 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 5-8 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 5-6 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 9-10 membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • Exemplary heterocyclyl Re groups include, but are not limited to, azirdinyl, oxiranyl, thiorenyl, azetidinyl, oxetanyl, thietanyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, pyrrolyl-2,5-dione, dioxolanyl, oxathiolanyl, dithiolanyl, triazolinyl, oxadiazolinyl, thiadiazolinyl, piperidinyl, tetrahydropyranyl, dihydropyridinyl, thianyl, piperazinyl, morpholinyl, dithianyl, dioxanyl, triazinanyl, azepanyl, oxepanyl, thiepanyl, azocanyl, oxecanyl, thiocanyl, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, 1H-benzo[e][1,4]diazepinyl, 1,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl, 5,6-dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7-dihydro-4H-thieno[2,3-c]pyranyl, 2,3-dihydro-1H-pyrrolo[2,3-b]pyridinyl, 2,3-dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-1H-pyrrolo[2,3-b]pyridinyl, 4,5,6,7-tetrahydrofuro[3,2-c]pyridinyl, and 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, 1,2,3,4-tetrahydro-1,6-naphthyridinyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • In certain embodiments, Re is a 6-membered heterocyclyl substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, Re is a 6-membered heterocyclyl selected from piperidinyl, tetrahydropyranyl, dihydropyridinyl, thianyl, piperazinyl, morpholinyl, dithianyl, dioxanyl, and triazinanyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • For example, in certain embodiments, Re is a 6-membered heterocyclyl of the formula:
  • Figure US20150099738A1-20150409-C00040
  • wherein Wo, Wp, Wq, Wr, and Ws are, independently, selected from CH2, CHRh, C(Rh)2, NRk, O or S, and Wt is N, CH, CRh, with the proviso that at least one of Wo, Wp, Wq, Wr and Ws is selected from N, NRk, O or S, and wherein Rh and Rk are defined below and herein.
  • In certain embodiments, Re is a piperidinyl group. In certain embodiments, Re is a piperidinyl group substituted with 0, 1, 2, 3, 4 or 5 Rh groups, e.g., of the formulae:
  • Figure US20150099738A1-20150409-C00041
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh and Rk are as defined below and herein. In certain embodiments, Re is an unsubstituted piperidinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted piperidinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted piperidinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted piperidinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted piperidinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 1-piperidinyl group, e.g., of the formula (i-h) wherein Wt is N and Wo, Wp, Wq, Wr, and Ws are, independently, selected from CH2, CHRh, C(Rh)2. In certain embodiments, Re is a 2-piperidinyl group, e.g., of the formula (i-h) wherein Wo is NRk; Wp, Wq, Wr, and Ws are, independently, CHRh, C(Rh)2, or CH2; and Wt is CH or CRh. In certain embodiments, Re is a 3-piperidinyl group, e.g., of the formula (i-h) wherein Wp is NRk; Wo, Wq, Wr, and Ws are, independently, CHRh, C(Rh)2, or CH2; and Wt is CH or CRh. In certain embodiments, Re is a 4-piperidinyl group, e.g., of the formula (i-h) wherein Wq is NRk; Wo, Wp, Wr, and Ws are, independently, CHRh, C(Rh)2, or CH2; and Wt is CH or CRh.
  • In certain embodiments, Re is a piperazinyl group. In certain embodiments, Re is a piperazinyl group substituted with 0, 1, 2, 3 or 4 Rh groups, e.g., of the formulae:
  • Figure US20150099738A1-20150409-C00042
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh and Rk are as defined below and herein. In certain embodiments, Re is an unsubstituted piperazinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted piperazinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted piperazinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted piperazinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted piperazinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a 1-piperazinyl group, e.g., of the formula (i-h) wherein Wt is N, Wq is NRk and Wo, Wp, Wr, and Ws are, independently, selected from CH2, CHRh, C(Rh)2. In certain embodiments, Re is a 2-piperazinyl group, e.g., of the formula (i-h) wherein Wo and Wr are independently NRk and Wp, Wq, Wr, and Ws are, independently, CHRh, C(Rh)2, or CH2; and Wt is CH or CRh.
  • In certain embodiments, Re is a morpholinyl group. In certain embodiments, Re is a morpholinyl group substituted with 0, 1, 2, 3 or 4 Rh groups, e.g., of the formulae:
  • Figure US20150099738A1-20150409-C00043
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh and Rk are as defined below and herein. In certain embodiments, Re is an unsubstituted morpholinyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted morpholinyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted morpholinyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted morpholinyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted morpholinyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a morpholinyl group of the formula (i-h) wherein Wt is N, Wq is O and Wo, Wp, Wr, and Ws are, independently, selected from CH2, CHRh, C(Rh)2.
  • In certain embodiments, Re is a dioxanyl group. In certain embodiments, Re is a dioxanyl group substituted with 0, 1, 2, 3 or 4 Rh groups, e.g., of the formulae:
  • Figure US20150099738A1-20150409-C00044
  • wherein x is 0, 1, 2, 3, 4 or 5, and Rh and Rk are as defined below and herein. In certain embodiments, Re is an unsubstituted dioxanyl (i.e., wherein x is 0). In certain embodiments, Re is a substituted dioxanyl (e.g., wherein x is 1, 2, 3, 4 or 5). In certain embodiments, Re is a monosubstituted dioxanyl (i.e., wherein x is 1). In certain embodiments, Re is a disubstituted dioxanyl (i.e., wherein x is 2). In certain embodiments, Re is a trisubstituted dioxanyl (i.e., wherein x is 3). In certain embodiments, x is 0, 1, 2 or 3. In certain embodiments, x is 0, 1 or 2. In certain embodiments, x is 0 or 1.
  • In certain embodiments, Re is a dioxanyl group, e.g., of the formula (i-h) wherein W° and Wr are O and Wp, Wq, Wr, and Ws are, independently, CHRh, C(Rh)2, or CH2; and Wt is CH or CRh.
  • Other 6-membered heterocycyl Re groups encompassed by formula (i-h) include monosaccharide sugars, e.g., for example, pyranosides selected from ribose, arabinose, xylose, lyxose, allose, altrose, glucose, mannose, gulose, iodose, galactose and talose.
  • In certain embodiments, Re is a C3-10 carbocycyl. In certain embodiments, Re is a C3-10 carbocycyl substituted with 0, 1, 2, 3, 4, or 5 Rh groups. In certain embodiments, Re is a C5-8 carbocycyl substituted with 0, 1, 2, 3, 4, or 5 Rh groups. In certain embodiments, Re is a C5-6 carbocycyl substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re is a Cg-10 carbocycyl substituted with 0, 1, 2, 3, 4, or 5 Rh groups.
  • Exemplary Re C3-10 carbocycyl groups include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cyclohexadienyl, cycloheptyl, and cycloheptadienyl, wherein such groups are substituted with 0, 1, 2, 3, 4, or 5 Rh groups.
  • Rf of Group G
  • As defined generally above, in certain embodiments, wherein G is selected from —SO2NRfRe, —PO2NRfRe, —(C═O)NRfRe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —NRfSO2Re, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, and —[N(Rf)2Re]+X wherein X is a counterion, each Rf attached to a nitrogen atom is, independently, selected from —H or C1-10 alkyl, or an amino protecting group, or Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
  • In certain embodiments, Rf is H or a C1-10 alkyl group.
  • In certain embodiments, Rf is H.
  • In certain embodiments, Rf is a C1-10 alkyl group. In certain embodiments, Rf is C1-10 alkyl substituted with 0, 1, 2, 3, 4, or 5 Rh groups. Exemplary Rf alkyl groups include, but are not limited to, methyl, ethyl, propyl, allyl, and benzyl. In certain embodiments, Rf an unsubstituted methyl, i.e., —CH3. In certain embodiments, Rf an unsubstituted ethyl, i.e., —CH2CH3.
  • In certain embodiments, Rf is an amino protecting group. For example, in certain embodiments, Rf is selected from —OH, —ORi, —N(Rk)2, —C(═O)Ri, —C(═O)N(Rk)2, —CO2Ri, —SO2Ri, —C(═NRk)Ri, —C(═NRk)ORi, —C(═NRk)N(Rk)2, —SO2N(Rk)2, —SO2Ri, —SO2ORi, —SORi, —C(═S)N(Rk)2, —C(═O)SRi, —C(═S)SRi, C1-10 alkyl (e.g., aralkyl), C2-10 alkenyl, C2-10 alkynyl, C3 to carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups, wherein Ri, Rk, Rm are as defined below and herein.
  • However, in certain embodiments, G is —NReRf and Rf is —H or C1-3 alkyl, then Re is not C1-6 alkyl or thiazolyl.
  • Moreover, in certain embodiments, wherein G is —OC(═O)NRfRe, then Re and Rf are not both —CH3.
  • Alternatively, in certain embodiments, Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring; e.g., for example, when G is —SO2NRfRe, —PO2NRfRe, —(C═O)NRfRe, —ONRfRe, —OPO2NRfRe, —NRfRe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, and —[N(Rf)2Re]+Xwherein X is a counterion. In certain embodiments, wherein Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring, the heterocyclyl ring or heteroaryl ring are substituted with 0, 1, 2, 3, 4 or 5 Rh groups, as defined below and herein.
  • In certain embodiments, Re and Rf are joined to form an 3-14 membered heterocyclyl ring. In certain embodiments, Re and Rf are joined to form a 3-14 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4 or 5 Rh groups. In certain embodiments, and Rf are joined to form a 5-10 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4, or 5 Rh groups. In certain embodiments, Re and Rf are joined to form a 5-8 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4, or 5 Rh groups. In certain embodiments, Re and Rf are joined to form a 5-6 membered heterocyclyl ring substituted with 0, 1, 2 or 3 Rh groups. In certain embodiments, Re and Rf are joined to form a 9-10 membered heterocyclyl ring substituted with 0, 1, 2, 3, 4, or 5 Rh groups.
  • In certain embodiments, Re and Rf are joined to form a heterocyclyl group selected from azirdinyl, azetidinyl, pyrrolidinyl, dihydropyrrolyl, pyrrolyl-2,5-dione, triazolinyl, oxadiazolinyl, thiadiazolinyl, piperidinyl, dihydropyridinyl, thianyl, piperazinyl, morpholinyl, triazinanyl, azepanyl, oxepanyl, thiepanyl, azocanyl, indolinyl, isoindolinyl, tetrahydrobenzothienyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, indolinyl, and phthalimidyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 Rh groups.
  • For example, in certain embodiments, Re and Rf are joined to form a 5-membered heterocyclyl ring selected from the group:
  • Figure US20150099738A1-20150409-C00045
  • wherein x is 0, 1, 2 or 3, wherein Rh and Rk are as defined below and herein.
  • In certain embodiments, Re and Rf are joined to form a 6-membered heterocyclyl ring selected from the group:
  • Figure US20150099738A1-20150409-C00046
  • wherein x is 0, 1, 2 or 3, wherein Rh and Rk are as defined below and herein.
  • However, in certain embodiments, wherein G is —NReRf, then Re and Rf are not joined to form a pyrrolidinyl, piperidinyl or azepanyl ring.
  • In certain embodiments, Re and Rf are joined to form a 5-14 membered heteroaryl ring. In certain embodiments, Re and Rf are joined to form a 5-14 membered heteroaryl ring substituted with 0, 1, 2, 3, 4, or 5 Rh groups. In certain embodiments, Re and Rf are joined to form a 5-10 membered heteroaryl ring substituted with 0, 1, 2, 3, 4, or 5 Rh groups. In certain embodiments, Re and Rf are joined to form a 5-8 membered heteroaryl ring substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re and Rf are joined to form a 5-6 membered heteroaryl ring substituted with 0, 1, 2, 3 or 4 Rh groups. In certain embodiments, Re and Rf are joined to form a 9-10 membered heteroaryl ring substituted with 0, 1, 2, 3, 4, or 5 Rh groups.
  • In certain embodiments, Re and Rf are joined to form a 5-membered heteroaryl ring selected from:
  • Figure US20150099738A1-20150409-C00047
  • wherein x is 0, 1 or 2, and Rh and Rk are as defined below and herein.
  • However, in certain embodiments, wherein G is —NRfRe, Re and Rf are not joined to form a 1,2,4-triazolyl ring, e.g. of the formula:
  • Figure US20150099738A1-20150409-C00048
  • wherein x is 0 or 1, and Rh is as defined below and herein.
  • In certain embodiments, Re and Rf are joined to form a 9-membered heteroaryl (“5,6-bicyclic heteroaryl”) ring selected from:
  • Figure US20150099738A1-20150409-C00049
  • wherein x is 0, 1, 2 or 3 and Rh and Rk are as defined below and herein.
  • Group G Substituents Embodiments of Rh
  • As used above and herein each instance of Rh is, independently, selected from halogen (fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I)), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORi, —ON(Rk)2, —N(Rk)2, —N(Rk)3 +X, —N(ORi)Rk, —SH, —SRi, —SSRj, —C(═O)Ri, —CO2H, —CHO, —CO2Ri, —OC(═O)Ri, —OCO2Ri, —C(═O)N(Rk)2, —OC(═O)N(Rk)2, —NRk C(═O)Ri, —NRk CO2Ri, —NRk C(═O)N(Rk)2, —C(═NRk)Ri, —C(═NRk)ORi, —OC(═NRk)Ri, —OC(═NRk)ORi, (NRk)N(Rk)2, —OC(═NRk)N(Rk)2, —NRk C(═NRk)N(Rk)2, —C(═O)NRk SO2Ri, —NRk SO2Ri, —SO2N(Rk)2, —SO2Ri, —SO2ORi, —OSO2Ri, —S(═O)Ri, —OS(═O)Ri, —Si(Ri)3, —OSi(Ri)3 —C(═S)N(Rk)2, —C(═O)SRi, —C(═S)SRi, —SC(S)SRi, —P(═O)2Ri, —OP(═O)2Ri, —P(═O)(Ri)2, —OP(═O)(Ri)2, —OP(═O)(ORj)2, —P(═O)2N(Rk)2, —OP(═O)2N(Rk)2, —P(═O)(NRk)2, —OP(═O)(NRk)2, —NRk P(═O)(ORj)2, —NRk P(═O)(NRk)2, —P(Rj)2, —P(Rj)3, —OP(Rj)2, —OP(Rj)3, —B(ORj)2, —BRi(ORj), C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-14 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
  • each instance of Ri is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C1-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
  • each instance of Rk is, independently, selected from hydrogen, —OH, —ORi, —N(Rj)2, —CN, —C(═O)Ri, —C(═O)N(Rj)2, —CO2Ri, —SO2Ri, —C(═NRj)ORi, —C(═NRj)N(Rj)2, —SO2N(Rj)2, —SO2Rj, —SO2ORj, —SORj, —C(═S)N(Rh)2, —C(═O)SRj, —C(═S)SRj, —P(═O)2Ri, —P(═O)(Ri)2, —P(═O)2N(Rj)2, —P(═O)(NRj)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C1-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rj groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
  • each instance of Rj is, independently, selected from hydrogen, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rj groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
  • each instance of Rm is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORo, —ON(Rn)2, —N(Rn)2, —N(Rn)3 +X, —N(ORo)Rn, —SH, —SRo, —SSRo, —C(═O)Ro, —CO2H, —CO2Ro, —OC(═O)Ro, —OCO2Ro, —C(═O)N(Ro)2, —OC(═O)N(Rn)2, —NRnC(═O)Ro, —NRnCO2Ro, —NRnC(═O)N(Rn)2, —C(═NRn)ORo, —OC(═NRn)Ro, —OC(═NRn)ORo, —C(═NRn)N(Rn)2, —OC(═NRn)N(Rn)2, —NRnC(═NRn)N(Rn)2, —NRnSO2Ro, —SO2N(Rn)2, —SO2Ro, —SO2ORo, —OSO2Ro, —S(═O)Ro, —Si(Ro)3, —OSi(Ro)3, —C(═S)N(Rn)2, —C(═O)SRo, —C(═S)SRo, —SC(═S)SRo, —P(═O)2Ro, —P(═O)(Ro)2, —OP(═O)(Ro)2, —OP(═O)(ORo)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups, or two geminal Rm substituents can be joined to form ═O or ═S;
  • each instance of Ro is, independently, selected from C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups;
  • each instance of Rn is, independently, selected from hydrogen, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl and 5-10 membered heteroaryl, or two Re groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups; and
  • each instance of Rp is, independently, fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OC1-6 alkyl, —ON(C1-6 alkyl)2, —N(C1-6 alkyl)2, —N(C1-6 alkyl)3X, —NH(C1-6 alkyl)2X, —NH2(C1-6 alkyl)X, —NH3X, —N(OC1-6 alkyl)(C1-6 alkyl), —N(OH)(C1-6 alkyl), —NH(OH), —SH, —SC1-6 alkyl, —SS(C1-6 alkyl), —C(═O)(C1-6 alkyl), —CO2H, —CO2(C1-6 alkyl), —OC(═O)(C1-6 alkyl), —OCO2(C1-6 alkyl), —C(═O)NH2, —C(═O)N(C1-6 alkyl)2, —OC(═O)NH(C1-6 alkyl), —NHC(═O)(C1-6 alkyl), —N(C1-6 alkyl)C(═O)(C1-6 alkyl), —NHCO2(C1-6 alkyl), —NHC(═O)N(C1-6 alkyl)2, —NHC(═O)NH(C1-6 alkyl), —NHC(═O)NH2, —C(═NH)O(C1-6 alkyl), —OC(═NH)(C1-6 alkyl), —OC(═NH)OC1-6 alkyl, —C(═NH)N(C1-6 alkyl)2, —C(═NH)NH(C1-6 alkyl), —C(═NH)NH2, —OC(═NH)N(C1-6 alkyl)2, —OC(NH)NH(C1-6 alkyl), —OC(NH)NH2, —NHC(NH)N(C1-6 alkyl)2, —NHC(═NH)NH2, —NHSO2(C1-6 alkyl), —SO2N(C1-6 alkyl)2, —SO2NH(C1-6 alkyl), —SO2NH2, —SO2C1-6 alkyl, —SO2OC1-6 alkyl, —OSO2C1-6 alkyl, —SOC1-6 alkyl, —Si(C1-6 alkyl)3, —OSi(C1-6 alkyl)3 —C(═S)N(C1-6 alkyl)2, C(═S)NH(C1-6 alkyl), C(═S)NH2, —C(═O)S(C1-6 alkyl), —C(═S)SC1-6 alkyl, —SC(═S)SC1-6 alkyl, —P(═O)2(C1-6 alkyl), —P(═O)(C1-6 alkyl)2, —OP(═O)(C1-6 alkyl)2, —OP(═O)(OC1-6 alkyl)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, C6-14 aryl, 3-14 membered heterocyclyl, 5-14 membered heteroaryl; or two geminal Rp substituents can be joined to form ═O or ═S; wherein X is a counterion.
  • In certain embodiments, Rh is selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —OH, —ORi, —SRi, —SO2H, —SO3H, —N(Rk)2, —N(Rk)3 +X, —C(═O)Ri, —CO2H, —CHO, —CO2Ri, —OC(═O)Ri, —OCO2Ri, —C(═O)N(Rk)2, —OC(═O)N(Rk)2, —NRk C(═O)Ri, —NRk CO2Ri, —NRk C(═O)N(Rk)2, —C(═NRk)Ri, —C(═NRk)ORi, —OC(═NRk)Ri, —OC(═NRk)ORi, —C(═NRk)N(Rk)2, —OC(═NRk)N(Rk)2, —NRk C(═NRk)N(Rk)2, —C(═O)NRk SO2Ri, —NRk SO2Ri, —SO2N(Rk)2, —SO2Ri, —SO2ORi, —OSO2Ri, —S(═O)Ri, —OS(═O)Ri, —C(═S)N(Rk)2, —C(═O)SRi, —C(═S)SRi, —SC(S)SRi, —P(═O)2Ri, —OP(═O)2Ri, —P(═O)(Ri)2, —OP(═O)(Ri)2, —OP(═O)(ORj)2, —P(═O)2N(Rk)2, —OP(═O)2N(Rk)2, —P(═O)(NRk)2, —OP(═O)(NRk)2, —NRk P(═OX)(ORj)2, —NRkP(═O)(NRk)2, —B(ORj)2, —BRi(ORj), C1-10 alkyl, —C1-10 perhaloalkyl, C3-14 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups; and wherein X is a counterion.
  • In certain embodiments, Rh is selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —OH, —ORi, —SRi, —N(Rk)2, —N(Rk)3 +X, —C(═O)Ri, —CO2Ri, —CO2H, —OC(═O)Ri, —OCO2Ri, —C(═O)N(Rk)2, —OC(═O)N(Rk)2, —NRk C(═O)Ri, —NRk CO2Ri, —NRk C(═O)N(Rk)2, —C(═O)NRk SO2Ri, —NRk SO2Ri, —SO2N(Rk)2, —SO2Ri, C1-10 alkyl, C6 aryl, and 5-6 membered heteroaryl, wherein each alkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3 or 4 Rm groups; and wherein X is a counterion.
  • In certain embodiments, Rh is —ORi, e.g., selected from —OCH3, —OCF3, —OCH2CH3, —OCH2CF3, —OiPr and —OnBu.
  • In certain embodiments, Rh is —SRi, e.g., selected from —SCH3.
  • In certain embodiments, Rh is —N(Rk)2 or —N(Rk)3 +X, e.g., selected from —NH2 and —NH3 +X.
  • In certain embodiments, Rh is —C(═O)Ri, e.g., selected from —C(═O)CH3.
  • In certain embodiments, Rh is —CO2Ri, e.g., selected from —CO2CH3
  • In certain embodiments, Rh is —C(═O)N(Rk)2, e.g., selected from —C(═O)NHOH, —C(═O)NH2, —C(═O)NHCH3, —C(═O)N(CH3)2, —C(═O)NHCH2CH3, —C(═O)NHCH2CF3 —C(═O)NH(CH2)1-6NH3 +X, —C(═O)NHCH2C(═O)OCH3, —C(═O)NHCH2C(═O)OH and —C(═O)NHCH2CH2OH.
  • In certain embodiments, Rh is —OC(═O)Ri, e.g., selected from —OC(═O)CH3.
  • In certain embodiments, Rh is —OCO2Ri, e.g., selected from —OCO2CH3.
  • In certain embodiments, Rh is —OC(═O)N(Rk)2, e.g., selected from —OC(═O)NH2.
  • In certain embodiments, Rh is —NRkC(═O)Ri, e.g., selected from —NHC(═O)CH3.
  • In certain embodiments, Rh is —NRkCO2Ri, e.g., selected from —NHC(═O)OCH3 and —NHC(═O)OtBu.
  • In certain embodiments, Rh is —NRkC(═O)N(Rk)2, e.g., selected from —NHC(═O)NH2.
  • In certain embodiments, Rh is —C(═O)NRkSO2Ri, e.g., selected from —C(═O)NHSO2CH3, —C(═O)NHSO2CH2CH3, —C(═O)NHSO2CH9 and —C(═O)NHSO2iBu.
  • In certain embodiments, Rh is —NRkSO2Ri, e.g., selected from —NHSO2CH3.
  • In certain embodiments, Rh is —SO2N(Rk)2, e.g., selected from —SO2NH2, —SO2N(CH3)2.
  • In certain embodiments, Rh is —SO2Ri, e.g., selected from —SO2CH3, —SO2CH2CH3, —SO2C5H9 and —SO2iBu.
  • In certain embodiments, Rh is C1-10 alkyl, e.g., selected from —CH3, —CH2CH3, -iPr, -nBu, —CF3, —CH2CH2CO2Me, —CH2CH2CO2H and —CH2CH2CO2NH2.
  • In certain embodiments, Rh is selected from —C(═O)Ri, —CO2H, and —SO2Ri. In certain embodiments, Rh is —C(═O)Ri. In certain embodiments, Rh is —SO2Ri. In certain embodiments, Rh is —CO2H or —SO2CH3. In certain embodiments, Rh is —CO2H. In certain embodiments, Rh is —SO2CH3.
  • In certain embodiments, each instance of Rh is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), iodo (—I), —NH2, —NH3 +X, —CN, —NO2, —SO2CH3, —SO2CH2CH3, —SO2C5H9, —SO2iBu, —SO2NH2, —SO2N(CH3)2, —C(O)NHSO2CH3, —C(═O)NHSO2CH2CH3, —C(O)NHSO2C5H9, —C(O)NHSO2iBu, —C(O)CH3, —CO2H, —CO2CH3, —OC(═O)CH3, —OCO2CH3, —C(═O)NHOH, —C(═O)NH2, —C(═O)NHCH3, —C(═O)N(CH3)2, —C(═O)NHCH2CH3, —C(═O)NHCH2CF3 —C(═O)NH(CH2)1-6NH3 +X, —OC(O)NH2, —NHC(═O)CH3, —NHC(═O)OCH3, —NHC(═O)OtBu, —NHC(═O)NH2, —NHSO2CH3, —CH3, —CH2CH3, -iPr, -nBu, —CF3, —OH, —OCH3, —SCH3, —OCF3, —OCH2CH3, —OCH2CF3, —OiPr, —OnBu, —CH2CH2CO2Me, —CH2CH2CO2H, —CH2CH2CO2NH2, —C(═O)NHCH2C(═O)OCH3, —C(═O)NHCH2C(═O)OH, —C(═O)NHCH2CH2OH, C6 aryl substituted with 0, 1, or 2 Rm groups and 5-6 membered heteroaryl substituted with 0, 1, or 2 Rm groups; and wherein X is a counterion.
  • In certain embodiments, Rh is a C6 aryl (e.g., phenyl) substituted with 0, 1, or 2 Rm groups. In certain embodiments, Rh is a C6 aryl (e.g., phenyl) substituted with 1 Rm group, and Rm is —CO2H, —CO2CH3, —CO2CH2CH3, and —C(═O)NH2.
  • In certain embodiments, Rh is a 5-6 membered heteroaryl substituted with 0, 1, or 2 Rm groups. In certain embodiments, Rh is a 5 membered heteroaryl substituted with 0, 1, or 2 Rm groups. Exemplary 5 membered heteroaryl Rh groups include, but are not limited to, pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl, oxadiazolyl, thiadiazolyl, and tetrazolyl, wherein such groups are substituted with 0 or 1 Rm groups. In certain embodiments, the Rh 5 membered heteroaryl group is selected from pyrazolyl and oxadiazolyl, wherein such groups are substituted with 0 or 1 Rm groups.
  • Embodiments of Ri
  • In certain embodiments, each instance of Ri is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C1-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is unsubstituted.
  • In certain embodiments, Ri is unsubstituted C1-10 alkyl. In certain embodiments, Ri is C1-10 perhaloalkyl. In certain embodiments, Ri is unsubstituted C2-10 alkenyl. In certain embodiments, Ri is unsubstituted C2-10 alkynyl. In certain embodiments, Ri is unsubstituted C3-10 carbocyclyl. In certain embodiments, Ri is unsubstituted 3-14 membered heterocyclyl. In certain embodiments, Ri is unsubstituted C6-14 aryl. In certain embodiments, Ri is unsubstituted 5-14 membered heteroaryl.
  • Embodiments of Rm
  • In certain embodiments, each instance of Rm is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —SO2H, —SO3H, —OH, —ORo, —ON(Rn)2, —N(Rn)2, —N(Rn)3 +X, —N(ORo)Rn, —SH, —SRo, —SSRo, —C(═O)Ro, —CO2H, —CO2Ro, —OC(═O)Ro, —OCO2Ro, —C(═O)N(Rn)2, —OC(═O)N(Rn)2, —NRnC(═O)Ro, —NRnCO2Ro, —NRnC(═O)N(Rn)2, —C(═NRn)ORo, —OC(═NRn)Ro, —OC(═NRn)ORo, —C(═NRn)N(Rn)2, —OC(═NRn)N(Rn)2, —NRnC(═NRn)N(Rn)2, —NRnSO2Rn, —SO2N(Rn)2, —SO2Ro, —SO2ORo, —OSO2Ro, —S(═O)Ro, —C(═S)N(Rn)2, —C(═O)SRo, —C(═S)SRo, —SC(═S)SRo, —P(═O)2Ro, —P(═O)(Ro)2, —OP(═O)(Ro)2, —OP(═O)(ORo)2, C1-6 alkyl, C1-6 perhaloalkyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups.
  • In certain embodiments, each instance of Rm is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —SO2H, —SO3H, —OH, —ORo, —ON(Rn)2, —N(Rn)2, —N(Rn)3X, —N(ORo)Rn, —SH, —SRo, —SSRo, —C(═O)Ro, —CO2H, —CO2Ro, —OC(═O)Ro, —OCO2Ro, —C(═O)N(Rn)2, —OC(═O)N(Rn)2, —NRnC(═O)Ro, —NRnCO2Ro, —NRnC(═O)N(Rn)2, —C(═NRn)ORo, —OC(═NRn)Ro, —OC(═NRn)ORo, —C(═NRn)N(Rn)2, —OC(═NRn)N(Rn)2, —NRnC(═NRn)N(Rn)2, —NRnSO2Ro, —SO2N(Rn)2, —SO2Ro, —SO2ORo, —OSO2Ro, —S(═O)Ro, —C(═S)N(Rn)2, —C(═O)SRo, —C(═S)SRo, —SC(═S)SRo, —P(═O)2Ro, —P(═O)(Ro)2, —OP(═O)(Ro)2, —OP(═O)(ORo)2, C1-6 alkyl, C1-6 perhaloalkyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, 5-14 membered heteroaryl.
  • In certain embodiments, Rm is selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —NH2, —NH3 +X, —CN, —NO2, —SO2CH3, —SO2CH2CH3, —SO2CH9, —SO2iBu, —SO2NH2, —SO2N(CH3)2 —C(═O)NHSO2CH3, —C(═O)NHSO2CH2CH3, —C(═O)NHSO2C5H9, —C(═O)NHSO2iBu, —C(═O)CH3, —CO2H, —CO2CH3, —OC(═O)CH3, —OCO2CH3, —C(═O)NHOH, —C(═O)NH2, —C(═O)NHCH3, —C(═O)N(CH3)2, —C(═O)NHCH2CH3, —C(═O)NHCH2CF3 —C(═O)NH(CH2)1-6NH3 +X, —OC(O)NH2, —NHC(═O)CH3, —NHC(═O)OCH3, —NHC(═O)OtBu, —NHC(═O)NH2, —NHSO2CH3, —CH3, —CH2CH3, -iPr, -nBu, —CF3, —OH, —OCH3, —OCF3, —OCH2CH3, —OCH2CF3, —OiPr, —OnBu, —CH2CH2CO2Me, —CH2CH2CO2H, —CH2CH2CO2NH2, —C(═O)NHCH2C(═O)OCH3, —C(═O)NHCH2C(═O)OH, and —C(═O)NHCH2CH2OH.
  • Embodiments of Rk
  • As used above and herein each instance of Rk is, independently, selected from —H, —OH, —ORi, —N(Rk)2, —C(═O)Ri, —C(═O)N(Rk)2, —CO2Ri, —SO2Ri, —C(═NRk)Ri, —C(═NRk)ORi, —C(═NRk)N(Rk)2, —SO2N(Rk)2, —SO2Ri, —SO2ORi, —SORi, —C(═S)N(Rk)2, —C(═O)SRi, —C(═S)SRi, C1-10 alkyl (e.g., aralkyl), C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups, wherein Ri, Rk, Rm are as defined above and herein.
  • In certain embodiments, each instance of Rk is, independently, selected from —H, —C(═O)Ri, —C(═O)ORi, —SO2Ri, or C1-6 alkyl. In certain embodiments, each instance of Rk is, independently, selected from —H or C1-6 alkyl. In certain embodiments, each instance of Rk is, independently, selected from —H and —CH3. In certain embodiments, each instance of Rk is, independently, selected from —H. In certain embodiments, each instance of Rk is, independently, selected from —CH3.
  • Embodiments Wherein Ra and Rd are Joined (Fused)
  • As generally defined above, in certain embodiments, Ra and Rd are joined to form a C3-10 carbocycyl or 3-14 membered heterocyclyl fused ring, and Rb and Rc are independently selected from —H, C1-10 alkyl and C1-10 perhaloalkyl.
  • In certain embodiments, each of Rb and Rc independently is selected from —H, C1-6 alkyl and C1-6 perhaloalkyl. In certain embodiments, each of Rb and Rc independently is selected from —H, C1-3 alkyl and C1-3 perhaloalkyl. In certain embodiments, each of Rb and Rc independently is selected from —H, C1 alkyl and C1 perhaloalkyl. In certain embodiments, each of Rb and Rc independently is selected from —H, —CH3 and —CF3. In certain embodiments, each of Rb and Rc independently is selected from —H and —CH3. In certain embodiments, each of Rb and Rc independently is selected from —H and —CF3. In certain embodiments, Rb and Rc are both —H.
  • In certain embodiments, Ra and Rd are joined to form a C5-7 carbocycyl or 5-7 membered heterocyclyl fused ring. In certain embodiments, Rc and Rd are joined to form a C5-7 carbocycyl or 5-7 membered heterocyclyl fused ring of the formula:
  • Figure US20150099738A1-20150409-C00050
  • wherein W20, W21, W22, and W23 are, independently, CH2, CHR15, C(R15)2 or NR18, R15 and R18 are as defined below and herein, s is 0, 1 or 2, and the dashed line indicates ring fusion.
  • In certain embodiments, Ra and Rd are joined to form a C5-7 carbocycyl fused ring. For example, in certain embodiments of formula (ii-j), W20, W21, W22 and W23 are, independently, CH2, CHR15 or C(R15)2. Exemplary C5-7 carbocycyl groups which Ra and Rd can be joined to form include, but are not limited to, cyclopentyl, cyclohexyl and cycloheptyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R15 groups.
  • In certain embodiments, Ra and Rd are joined to form a 5-7 membered heterocyclyl fused ring. For example, in certain embodiments of formula (i-j), W20 is NR18, and W21, W22, and W23 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments of formula (ii-j), W21 is NR18, and W20, W22, and W23 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments of formula (i-j), W22 is NR15, and W2, W21, and W23 are, independently, CH2, CHR15 or C(R15)2. Exemplary 5-7 membered heterocyclyl groups which Ra and Rd can be joined to form include, but are not limited to, pyrrolidinyl, pyrazolidinyl, imidazolidinyl, piperidinyl, piperazinyl and azepanyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R15 groups.
  • In certain embodiments, wherein s is 0, Ra and Rd are joined to form a C5 carbocycyl or 5-membered heterocyclyl fused ring of the formula:
  • Figure US20150099738A1-20150409-C00051
  • wherein W20, W21 and W22, are, independently, CH2, CHR15, C(R15)2 or NR18, R15 and R18 are as defined below and herein, and the dashed line indicates ring fusion.
  • In certain embodiments of formula (ii-k), Ra and Rd are joined to form a C5 carbocycyl fused ring (i.e., cyclopentyl) e.g., wherein W20, W21 and W22, are, independently, CH2, CHR15, C(R15)2.
  • In certain embodiments of formula (ii-k), Ra and Rd are joined to form a 5-membered heterocycyl fused ring (e.g., pyrrolidinyl), e.g., wherein W21 is NR18, and W20, W22, and W23 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments of formula (ii-k), Ra and Rd are joined to form a 5-membered heterocycyl fused ring (e.g., pyrrolidinyl), e.g., wherein W20 is NR18, and W21, W22, and W23 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein s is 1, Ra and Rd are joined to form a C6 carbocycyl or 6-membered heterocyclyl fused ring of the formula:
  • Figure US20150099738A1-20150409-C00052
  • wherein W20, W21, W22, and W23 are, independently, CH2, CHR15, C(R15)2 or NR18, R15 and R18 are as defined below and herein, and the dashed line indicates ring fusion.
  • In certain embodiments of formula (i-m), Ra and Rd are joined to form a C6 carbocycyl fused ring (i.e., cyclohexyl) e.g., wherein W20, W21, W22, and W23 are, independently, CH2, CHR15, C(R15)2.
  • In certain embodiments of formula (i-m), Ra and Rd are joined to form a 6-membered heterocycyl fused ring (e.g., piperidinyl), e.g., wherein W21 is NR18, and W20, W22, and W2 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments of formula (i-m), Ra and Rd are joined to form a 6-membered heterocycyl fused ring (e.g., piperidinyl), e.g., wherein W20 is NR18, and W21, W22, and W23 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein s is 2, Ra and Rd are joined to form a C7 carbocycyl or 7-membered heterocyclyl ring of the formula:
  • Figure US20150099738A1-20150409-C00053
  • wherein W20, W21, W22, and W23 are, independently, CH2, CHR15, C(R15)2 or NR18, R15 and R18 are as defined below and herein, and the dashed line indicates ring fusion.
  • In certain embodiments of formula (i-n), Ra and Rd are joined to form a C7 carbocycyl ring (i.e., cycloheptyl) e.g., wherein W20, W21, W22, and W23 are, independently, CH2, CHR15, C(R15)2.
  • In certain embodiments of formula (i-n), Ra and Rd are joined to form a 7-membered heterocycyl ring (e.g., azepanyl), e.g., wherein W21 is NR18, and W20, W22, and W23 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments of formula (ii-n), Ra and Rd are joined to form a 7-membered heterocycyl ring (e.g., azepanyl), e.g., wherein W22 is NR18, and W20, W21, and W23 are, independently, CH2, CHR15 or C(R15)2.
  • Embodiments Wherein Rc and Rd are Joined (Spiro-Fused)
  • As generally defined above, in certain embodiments, Rc and Rd are joined to form a C3-10 carbocycyl or 3-14 membered heterocyclyl spiro-fused ring, and Ra and Rb are independently selected from —H, C1-10 alkyl and C1-10 perhaloalkyl.
  • In certain embodiments, each of Ra and Rb independently is selected from —H, C1-6 alkyl and C1-6 perhaloalkyl. In certain embodiments, each of Ra and Rb independently is selected from —H, C1-3 alkyl and C1-3 perhaloalkyl. In certain embodiments, each of Ra and Rb independently is selected from —H, C1 alkyl and C1 perhaloalkyl. In certain embodiments, each of Ra and Rb independently is selected from —H, —CH3 and —CF3. In certain embodiments, each of Ra and Rb independently is selected from —H and —CH3. In certain embodiments, each of Ra and Rb independently is selected from —H and —CF3. In certain embodiments, Re and Rb are both —H.
  • In certain embodiments, Rc and Rd are joined to form a C5-7 carbocycyl, a 5-7 membered heterocyclyl, a 5,6-bicyclic carbocycyl, a 6,6-bicyclic carbocycyl, a 5,6-bicyclic heterocyclyl or a 6,6-bicyclic heterocyclyl spiro-fused ring.
  • For example, in certain embodiments, Rc and Rd are joined to form a C5-7 carbocycyl, a 5-7 membered heterocyclyl, a 5,6-bicyclic carbocycyl or 5,6-bicyclic heterocyclyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00054
  • wherein W24, W25, W26, W27, W28 and W29 are, independently, CH2, CHR15, C(R15)2 or NR18, optionally wherein W25 and W26 are substituted with a fused C6 aryl ring or fused 6-membered heteroaryl ring; t and v are, independently, 0 or 1; and R15 and R18 are as defined below and herein. In certain embodiments, t is 0 and v is 0. In certain embodiments, t is 0 and v is 1. In certain embodiments, t is 1 and v is 0. In certain embodiments, t is 1 and v is 1.
  • In certain embodiments, Rc and Rd are joined to form a C5-7 carbocycyl spiro-fused ring. For example, in certain embodiments of formula (iii-a), W24, W25, W26, W27, W28 and W29 are, independently, CH2, CHR15, or C(R15)2. Exemplary C5-7 carbocycyl groups which Rc and Rd can be joined to form include, but are not limited to, cyclopentyl, cyclohexyl and cycloheptyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R15 groups.
  • In certain embodiments, Rc and Rd are joined to form a 5-7 membered heterocyclyl, spiro-fused ring. For example, in certain embodiments of formula (iii-a), W25 is NR18 and W26, W27, W28 and W29 are, independently, CH2, CHR15, C(R15)2. In certain embodiments of formula (iii-a), W26 is NR18 and W24, W25, W27, W28 and W29 are, independently, CH2, CHR15, C(R15)2. In certain embodiments of formula (iii-a), W27 is NR18 and W24, W25, W26, W28 and W29 are, independently, CH2, CHR15, C(R15)2. Exemplary 5-7 membered heterocyclyl groups which Rc and Rd can be joined to form include, but are not limited to, pyrrolidinyl, pyrazolidinyl, imidazolidinyl, piperidinyl, piperazinyl and azepanyl, wherein such groups are substituted with 0, 1, 2, 3, 4 or 5 R15 groups.
  • In certain embodiments, wherein t is 0 and v is 0, Rc and Rd are joined to form a C5 carbocycyl or 5-membered heterocyclyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00055
  • wherein W25, W26, W27 and W28 are, independently, CH2, CHR15, C(R15)2 r NR18, and R15 and R18 are as defined below and herein.
  • In certain embodiments, Rc and Rd are joined to form a C5 carbocycyl spiro-fused ring (e.g., cyclopentyl); e.g., of formula (iii-b) wherein W25 is NR18 and W26, W27 and W28 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, Rc and Rd are joined to form a 5-membered heterocyclyl spiro-fused ring; e.g., of formula (iii-b) wherein W26 is NR18 and W25, W27 and W28 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein t is 0 and v is 1, Rc and Rd are joined to form a C6 carbocycyl or 6-membered heterocyclyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00056
  • wherein W25, W26, W27, W28 and W29 are, independently, CH2, CHR15, C(R15)2 or NR18, and R15 and R18 are as defined below and herein.
  • In certain embodiments, Rc and Rd are joined to form a C6 carbocycyl spiro-fused ring (e.g., cyclohexyl); e.g., of formula (ii-c) wherein W25, W2, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, Rc and Rd are joined to form a 5-membered heterocyclyl spiro-fused ring; e.g., of formula (ii-c) wherein W26 is NR18 and W25, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, Rc and Rd are joined to form a 5-membered heterocyclyl spiro-fused ring of formula (ii-c) wherein W27 is NR18 and W25, W26, W28 and W29 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein t is 1 and v is 1, Rc and Rd are joined to form a C7 carbocycyl or 7-membered heterocyclyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00057
  • wherein W24, W25, W26, W27, W28 and W29 are, independently, CH2, CHR15, C(R15)2 or NR18, and R15 and R18 are as defined below and herein.
  • In certain embodiments, Rc and Rd are joined to form a C7 carbocycyl spiro-fused ring (e.g., cycloheptyl); e.g., of formula (iii-d) wherein W24, W25, W26, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, Rc and Rd are joined to form a 7-membered heterocyclyl spiro-fused ring; e.g., of formula (iii-d) wherein W25 is NR18 and W24, W26, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, Rc and Rd are joined to form a 7-membered heterocyclyl spiro-fused ring wherein W26 is NR18 and W24, W25, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, Rc and Rd are joined to form a 7-membered heterocyclyl spiro-fused ring wherein W27 is NR18 and W24, W25, W26, W28 and W29 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, Rc and Rd are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring or a 5,6-bicyclic heterocycyl spiro-fused ring. For example, in certain embodiments of formula (iii-a), t and v are both 0, W25 and W26 are substituted with a fused C6 aryl ring or fused 6-membered heteroaryl ring, and W27 is CH2, CHR15, C(R15)2, and NR18, and W28 is CH2, CHR15 or C(R15)2. In certain embodiments of formula (iii-a), Rc and Rd are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring, e.g., wherein t and v are both 0, W25 and W26 are substituted with a fused C6 aryl ring or fused 6-membered heteroaryl ring, and W27 and W28 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W25 and W26 are substituted with a fused C6 aryl ring.
  • For example, in certain embodiments, wherein t and v are both 0 and W25 and W26 are substituted with a fused C6 aryl ring, Rc and Rd are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00058
  • wherein W27 and W28 are, independently, CH2, CHR15, and C(R15)2, z is 0, 1, 2, 3 or 4; and R15 and is defined below and herein. In certain embodiments, W27 and W28 are both CH2 groups. In certain embodiments, z is 0, 1, 2, 3 or 4. In certain embodiments, z is 0, 1, 2 or 3. In certain embodiments, z is 0, 1 or 2. In certain embodiments, z is 2. In certain embodiments, z is 1. In certain embodiments, z is 0.
  • In certain embodiments, Rc and Rd are joined to form a 6,6-bicyclic carbocycyl spiro-fused ring or a 6,6-bicyclic heterocycyl spiro-fused ring. For example, in certain embodiments of formula (iii-a), t is 0 and v is 1, W25 and W26 are substituted with a fused C6 aryl ring or fused 6-membered heteroaryl ring, and W27 and W28 are independently CH2, CHR15, C(R15)2, and NR18, and W29 is CH2, CHR15, C(R15)2. In certain embodiments of formula (iii-a), Rc and Rd are joined to form a 6,6-bicyclic carbocycyl spiro-fused ring, e.g., wherein t is 0 and v is 1, W25 and W26 are substituted with a fused C6 aryl ring or fused 6-membered heteroaryl ring, and W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W25 and W26 are substituted with a fused C6 aryl ring.
  • For example, in certain embodiments, wherein t is 0 and v is 1 and W25 and W26 are substituted with a fused C6 aryl ring, Rc and Rd are joined to form a 6,6-bicyclic carbocycyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00059
  • wherein W27, W28 and W29 are, independently, CH2, CHR15, and C(R15)2, z is 0, 1, 2, 3 or 4, and R15 is as defined below and herein. In certain embodiments, W27, W28 and W29 are each CH2 groups. In certain embodiments, z is 0, 1, 2, 3 or 4. In certain embodiments, z is 0, 1, 2 or 3. In certain embodiments, z is 0, 1 or 2. In certain embodiments, z is 2. In certain embodiments, z is 1. In certain embodiments, z is 0.
  • In another aspect, Rc and Rd are joined to form a bridged carbocycyl or bridged heterocycyl spiro-fused ring of the formula:
  • Figure US20150099738A1-20150409-C00060
  • wherein W30, W31, W32, W33 and W33 are, independently, CH2, CHR15, C(R15)2 or NR18; and W34 and W35 are, independently, CH or CR15, and and R15 and R18 are as defined below and herein.
  • In certain embodiments of formula (iii-f), W30, W31, W32, W33 are, independently, CH2, CHR15 or C(R15)2; W36 is NR18; and W34 and W35 are, independently, CH or CR15. In certain embodiments of formula (ii-f), W30, W31, W32, W33 and W36 are, independently, CH2, CHR15 or C(R15)2; and W34 and W35 are, independently, CH or CR15. In certain embodiments of formula (iii-f), W34 and W15 are CH.
  • R15 Groups
  • As used herein, each instance of R15 is, independently, selected from halogen (i.e., fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I)), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OR16, —ON(R18)2, —N(R18)2, —N(R18)3 +X, —N(OR17)R18, —SH, —SR16, —SSR17, —C(═O)R16, —CO2H, —CHO, —CO2R16, —OC(═O)R16, —OCO2R16, —C(═O)N(R18)2, —OC(═O)N(R18)2, —NR18C(═O)R16, —NR18CO2R16, —NR18C(═O)N(R18)2, —C(═NR18)R16, —C(═NR18)OR16, —OC(═NR18)R16, —OC(═NR18)OR16, —C(═NR18)N(R18)2, —OC(═NR18)N(R18)2, —NR18C(═NR18)N(R18)2, —C(═O)NR18SO2R16, —NR18SO2R16, —SO2N(R18)2, —SO2R16, —SO2OR16, —OSO2R16, —S(═O)R16, —OS(═O)R16, —Si(R16)3, —OSi(R16)3 —C(═S)N(R18)2, —C(═O)SR16, —C(═S)SR16, —SC(S)SR16, —P(═O)2R16, —OP(═O)2R16, —P(═O)(R6)2, —OP(═O)(R16)2, —OP(═O)(OR17)2, —P(═O)2N(R18)2, —OP(═O)2N(R18)2, —P(═O)(NR18)2, —OP(═ONR18)2, —NR18P(═O)(OR17)2, —NR18P(═O)(NR18)2, —P(R17)2, —P(R7)3, —OP(R7)2, —OP(R7)3, —B(OR17)2, —BR16(OR17), C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-14 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups; or two vicinal R15 groups are replaced with the group —O(C(R2)2)1-2O— wherein each R2 is independently H, C1-6 alkyl or halogen;
  • each instance of R16 is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups;
  • each instance of R18 is, independently, selected from hydrogen, —OH, —OR16, —N(R17)2, —CN, —C(═O)R16, —C(═O)N(R17)2, —CO2R16, —SO2R16, —C(═NR7)OR16, —C(═NR17)N(R7)2, —SO2N(R17)2, —SO2R17, —SO2OR17, —SOR16, —C(═S)N(R17)2, —C(═O)SR17, —C(═S)SR17, —P(═O)2R16, —P(═O)(R16)2, —P(═O)2N(R17)2, —P(═O)(NR7)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two R17 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups;
  • each instance of R17 is, independently, selected from hydrogen, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two R17 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups;
  • each instance of R19 is, independently, selected from halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OR20, —ON(R21)2, —N(R21)2, —N(R21)3X, —N(OR20)R21, —SH, —SR20, —SSR20, C(═O)R20, —CO2H, —CO2R20, —OC(═O)R20, —OC2R20, —C(═O)N(R21)2, —OC(═O)N(R21)2, —NR21C(═O)R20, —NR21CO2R20, —NR21C(═O)N(R21)2, —C(═NR21)OR20, —OC(═NR21)R20, —OC(═NR21)OR20, —C(═NR21)N(R21)2, —OC(═NR21)N(R21)2, —NR21C(═NR21)N(R21)2, —NR21SO2R20, —SO2N(R21)2, —SO2R20, —SO2OR20, —OSO2R20, —S(═O)R20, —Si(R20), —OSi(R20)3, C(═S)N(R21)2, —C(═O)SR20, —C(═S)SR20, —SC(═S)SR20, —P(═O)2R20, —P(═O)(R20)2, —OP(═O)(R20)2, —OP(═O)(OR20)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R22 groups, or two geminal R19 substituents can be joined to form ═O or ═S;
  • each instance of R20 is, independently, selected from C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R22 groups;
  • each instance of R21 is, independently, selected from hydrogen, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl and 5-10 membered heteroaryl, or two R21 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R22 groups; and
  • each instance of R22 is, independently, halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OC1-6 alkyl, —ON(C1-6 alkyl)2, —N(C1-6 alkyl)2, —N(C1-6 alkyl)3X, —NH(C1-6 alkyl)2X, —NH2(C1-6 alkyl)X, —NH3X, —N(OC1-6 alkyl)(C1-6 alkyl), —N(OH)(C1-6 alkyl), —NH(OH), —SH, —SC1-6 alkyl, —SS(C1-6 alkyl), —C(═O)(C1-6 alkyl), —CO2H, —CO2(C1-6 alkyl), —OC(═O)C1-6 alkyl), —OCO2(C1-6 alkyl), —C(═O)NH2, —C(═O)N(C1-6 alkyl)2, —OC(═O)NH(C1-6 alkyl), —NHC(═O)(C1-6 alkyl), —N(C1-6 alkyl)C(═O)(C1-6 alkyl), —NHCO2(C1-6 alkyl), —NHC(═O)N(C1-6 alkyl)2, —NHC(═O)NH(C1-6 alkyl), —NHC(═O)NH2, —C(═NH)O(C1-6 alkyl), —OC(═NH)(C1-6 alkyl), —OC(═NH)OC1-6 alkyl, —C(═NH)N(C1-6 alkyl)2, —C(═NH)NH(C1-6 alkyl), —C(═NH)NH2, —OC(═NH)N(C1-6 alkyl)2, —OC(NH)NH(C1-6 alkyl), —OC(NH)NH2, —NHC(NH)N(C1-6 alkyl)2, —NHC(═NH)NH2, —NHSO2(C1-6 alkyl), —SO2N(C1-6 alkyl)2, —SO2NH(C1-6 alkyl), —SO2NH2, —SO2C1-6 alkyl, —SO2OC1-6 alkyl, —OSO2C1-6 alkyl, —SOC1-6 alkyl, —Si(C1-6 alkyl)3, —OSi(C1-6 alkyl)3 —C(═S)N(C1-6 alkyl)2, C(═S)NH(C1-6 alkyl), C(═S)NH2, —C(═O)S(C1-6 alkyl), —C(═S)SC1-6 alkyl, —SC(═S)SC1-6 alkyl, —P(═O)2(C1-6 alkyl), —P(═O)(C1-6 alkyl)2, —OP(═O)C1-6 alkyl)2, —OP(═O)(OC1-6 alkyl)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two geminal R22 substituents can be joined to form ═O or ═S;
  • wherein X is a counterion.
  • In certain embodiments, each instance of R15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —OR16, —C(═O)N(R18)2, —SO2N(R18)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups.
  • In certain embodiments, R15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —OR16 and C1-10 perhaloalkyl. In certain embodiments, R15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I) and —OR16. In certain embodiments, R15 is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I) and C1-10 perhaloalkyl.
  • In certain embodiments, R15 is selected from —OR16 and C1-10 perhaloalkyl.
  • In certain embodiments, R15 is —OR6. In certain embodiments, R16 is selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C6-10 aryl, and 5-6 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups.
  • In certain embodiments, R15 is —OR16, and R16 is selected from C1-10 alkyl. In certain embodiments, R15 is —OR16, and R16 is selected from C1-6 alkyl. In certain embodiments, R15 is —OR16, and R16 is selected from C1-4 alkyl. In certain embodiments, R15 is —OR16, and R16 is selected from C1-2 alkyl. In certain embodiments, R15 is —OR16 and R16 is —CH3, -Et, -iPr, -nBu, -n-pentyl. In certain embodiments, R15 is —OR16 and R16 is —CH3.
  • In certain embodiments, R15 is —OR16, and R16 is selected from C1-10 perhaloalkyl. In certain embodiments, R15 is —OR16, and R16 is selected from C1-6 perhaloalkyl. In certain embodiments, R15 is —OR16, and R16 is selected from C1-4 perhaloalkyl. In certain embodiments, R15 is —OR16, and R16 is selected from C1-2 perhaloalkyl. In certain embodiments, R15 is —OR16 and R16 is —CF3, —CF2CF3, —CF2CF2CF3, —CCl3, —CFCl2, or —CF2Cl. In certain embodiments, R15 is —OR16 and R16 is —CF3.
  • In certain embodiments, R15 is —OR16, and R16 is selected from C2-10 alkenyl. In certain embodiments, R15 is —OR16, and R16 is selected from C2-6 alkenyl. In certain embodiments, R15 is —OR16, and R16 is selected from C2-4 alkenyl. In certain embodiments, R15 is —OR16, and R16 is selected from —CH2CHCH2 (i.e., allyl).
  • In certain embodiments, R15 is —OR16, and R16 is selected from C2-10 alkynyl. In certain embodiments, R15 is —OR16, and R16 is selected from C2-6 alkynyl. In certain embodiments, R15 is —OR16, and R16 is selected from C2-4 alkynyl. In certain embodiments, R15 is —OR16, and R16 is selected from —CH2CCH (i.e., propargyl).
  • In certain embodiments, R15 is —OR16, and R16 is selected from C6 aryl (e.g., phenyl) substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is —OR16, and R16 is phenyl substituted with 0, 1 or 2 R19 groups. In certain embodiments, R15 is —OR16, and R16 is phenyl substituted with 1 R19 groups. In certain embodiments, R15 is —OR16, and R16 is phenyl substituted with 0 R19 groups (i.e., —C6H5).
  • In certain embodiments, R15 is —OR16, and R16 is selected from 5-6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is —OR16, and R16 is selected from a 6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is —OR16, and R16 is selected from pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl) substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is —OR16, and R16 is selected from pyrimidinyl (e.g., 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl) substituted with 0, 1, 2 or 3 R19 groups.
  • In certain embodiments, R15 is —C(═O)N(R18)2.
  • In certain embodiments, R15 is —SO2N(R18)2.
  • In certain embodiments, R15 is C1-10 perhaloalkyl. In certain embodiments, R15 is C1-6 perhaloalkyl. In certain embodiments, R15 is C1-4 perhaloalkyl. In certain embodiments, R15 is C1-2 perhaloalkyl. In certain embodiments, R15 is selected from —CF3, —CF2CF3, —CF2CF2CF3, —CCl3, —CFCl2, and —CF2Cl. In certain embodiments, R15 is selected from —CF3.
  • In certain embodiments, R15 is C1-10 alkyl substituted with 0, 1, 2, 3, 4, or 5 R19 groups. In certain embodiments, R15 is C1-6 alkyl substituted with 0, 1, 2, 3, 4, or 5 R19 groups.
  • R15 is C1-4 alkyl substituted with 0, 1, 2, 3, 4, or 5 R19 groups. In certain embodiments, the R15 alkyl group is unsubstituted (0 R19 groups). In certain embodiments, R15 is —CH3, -Et, -iPr, -nBu, -n-pentyl.
  • In certain embodiments, R15 is C2-10 alkenyl substituted with 0, 1, 2, 3, 4, or 5 R19 groups. In certain embodiments, R15 is C2-6 alkenyl substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is C2-4 alkenyl substituted with 0, 1, 2 or 3 R19 groups. In certain embodiments, the R15 alkenyl group is unsubstituted (0 R19 groups). In certain embodiments, R15 is —CH2CHCH2 (i.e., allyl),
  • In certain embodiments, R15 is C2-10 alkynyl substituted with 0, 1, 2, 3, 4, or 5 R19 groups. In certain embodiments, R15 is C2-6 alkynyl substituted with 0, 1, 2 or 3 R19 groups. In certain embodiments, R15 is C2-4 alkynyl substituted with 0, 1 or 2 R19 groups. In certain embodiments, the R15 alkynyl group is unsubstituted (0 R19 groups). In certain embodiments, R15 is —CH2CCH (i.e., propargyl).
  • In certain embodiments, R15 is C6-14 aryl. In certain embodiments, R15 is selected from C6 aryl (e.g., phenyl) substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is an unsubstituted phenyl. In certain embodiments, R15 is a monosubstituted phenyl (i.e., substituted with 1 R19 group).
  • In certain embodiments, R15 is 5-14 membered heteroaryl substituted with 0, 1, 2, 3, 4, or 5 R19 groups. In certain embodiments, R15 is 5-6 membered heteroaryl substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is a 6-membered heteroaryl substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is pyridinyl (e.g., 2-pyridinyl, 3-pyridinyl, 4-pyridinyl) substituted with 0, 1, 2, 3 or 4 R19 groups. In certain embodiments, R15 is pyrimidinyl (e.g., 2-pyrimidinyl, 4-pyrimidinyl, 5-pyrimidinyl) substituted with 0, 1, 2 or 3 R19 groups. In certain embodiments, the R15 heteroaryl group is unsubstituted (0 R19 groups).
  • R18 Groups
  • In certain embodiments, each instance of R18 is, independently, selected from —H, —OH, —OR16, —N(R17)2, —C(═O)R16, —C(═O)N(R17)2, —CO2R16, —SO2R16, —C(═NR7)R16, —C(═NR17)OR16, —C(═NR17)N(R17)2, —SO2N(R17)2, —SO2R16, —SO2OR16, —SOR16, —C(═S)N(R7)2, —C(═O)SR16, —C(═S)SR16, C1-10 alkyl (e.g., aralkyl), C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups, wherein R16, R17, R19 are as defined above and herein.
  • In certain embodiments, each instance of R17 is, independently, selected from —H, —C(═O)R16, —C(═O)OR16, —SO2R16, or C1-6 alkyl. In certain embodiments, each instance of R17 is, independently, selected from —H or C1-6 alkyl. In certain embodiments, each instance of R17 is, independently, selected from —H and —CH3. In certain embodiments, each instance of R17 is, independently, selected from —H. In certain embodiments, each instance of R17 is, independently, selected from —CH3.
  • Additional Embodiments of Compounds of Formula (I)
  • As defined generally above, the present invention provides compounds of the formula (I):
  • Figure US20150099738A1-20150409-C00061
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, Rc and Rd are as defined herein.
  • For example, wherein Ra and Rd are joined to form a C3-10 carbocycyl or 3-14 membered heterocycyl, the present invention provides compounds of the formula (IV):
  • Figure US20150099738A1-20150409-C00062
  • or a pharmaceutically acceptable form thereof, wherein s is 0, 1, or 2 and, W20, W21, W22, W23, G, Rc, Rd, R15 and R18 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 0, the present invention provides compounds of the formula (IV-a):
  • Figure US20150099738A1-20150409-C00063
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, W20, W21, and W22 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 0, W21 is NR18, and W20, W22, and W23 are, independently, CH2, CHR1S or C(R15)2, the present invention provides compounds of the formula (IV-b):
  • Figure US20150099738A1-20150409-C00064
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, R18, and R15, are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 1, the present invention provides compounds of the formula (IV-c):
  • Figure US20150099738A1-20150409-C00065
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, W20, W21, W22 and W23 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 1, W21 is NR18, and W20, W22, and W23 are, independently, CH2, CHR1S or C(R15)2, the present invention provides compounds of the formula (IV-d):
  • Figure US20150099738A1-20150409-C00066
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, R18, and R15, are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 1, W22 is NR18, and W20, W21, and W23 are, independently, CH2, CHR1S or C(R15)2, the present invention provides compounds of the formula (IV-e):
  • Figure US20150099738A1-20150409-C00067
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, R18, and R15, are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 2, the present invention provides compounds of the formula (IV-f):
  • Figure US20150099738A1-20150409-C00068
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, W20, W21, W22 and W23 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein s is 2, W22 is NR18, and W20, W21, and W23 are, independently, CH2, CHR15 or C(R15)2, the present invention provides compounds of the formula (IV-g):
  • Figure US20150099738A1-20150409-C00069
  • or a pharmaceutically acceptable form thereof, wherein G, Rb, Rc, R18, and R15, are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In another aspect, wherein Rc and Rd are joined to form a C3-10 carbocycyl or a 3-14 membered heterocycyl ring, the present invention provides compounds of the formula (V):
  • Figure US20150099738A1-20150409-C00070
  • or a pharmaceutically acceptable form thereof,
  • wherein W24, W26, W27, W28 and W30 are, independently, CH2, CHR15, C(R15)2 or NR18, optionally wherein W25 and W26 are substituted with a fused C6 aryl ring or fused 6-membered heteroaryl ring; t and v are, independently, 0 or 1; wherein G, Ra, Rb, R15 and R18 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I). In certain embodiments, t is 0 and v is 0. In certain embodiments, t is 0 and v is 1. In certain embodiments, t is 1 and v is 0. In certain embodiments, t is 1 and v is 1.
  • In certain embodiments, wherein t is 0 and v is 0, the present invention provides compounds of the formula (V-a):
  • Figure US20150099738A1-20150409-C00071
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, W25, W26, W27 and W28 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I). In certain embodiments, W27 is NR18 and W25, W26 and W28 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W25, W26, W27 and W28 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein t is 0, v is 0, W27 is NR18, and W25, W26 and W28 are, independently, CH2, CHR15 or C(R15)2, the present invention provides compounds of the formula (V-b):
  • Figure US20150099738A1-20150409-C00072
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, R15 and R18 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein t is 0 and v is 1, the present invention provides compounds of the formula (V-c):
  • Figure US20150099738A1-20150409-C00073
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, W25, W26, W27, W28 and W29 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I). In certain embodiments, W26 is NR18 and W25, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W27 is NR18 and W25, W26, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W25, W26, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein t is 0, v is 1, W27 is NR18, and W25, W26, and W29 are, independently, CH2, CHR15 or C(R15)2, the present invention provides compounds of the formula (V-d):
  • Figure US20150099738A1-20150409-C00074
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, R15 and R18 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein t is 1 and v is 1, the present invention provides compounds of the formula (V-e):
  • Figure US20150099738A1-20150409-C00075
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, W24, W25, W26, W27, W28 and W29 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I). In certain embodiments, W25 is NR18 and W24, W26, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W26 is NR18 and W24, W25, W27, W28 and WZ are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W27 is NR18 and W24, W25, W26, W28 and W29 are, independently, CH2, CHR15 or C(R15)2. In certain embodiments, W24, W25, W26, W27, W28 and W29 are, independently, CH2, CHR15 or C(R15)2.
  • In certain embodiments, wherein t is 1, v is 1, W27 is NR18 and W24, W25, W26, W28 and W29 are, independently, CH2, CHR15 or C(R15)2, the present invention provides compounds of the formula (V-f):
  • Figure US20150099738A1-20150409-C00076
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb, R15 and R18 are as defined above and herein. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I).
  • In certain embodiments, wherein t is 0, v is 0, W27 and W28 are, independently, CH2, CHR15 and C(R15)2, and W25 and W26 are substituted with a fused C6 aryl ring, Rc and Rd are joined to form a 5,6-bicyclic carbocycyl spiro-fused ring of the formula (V-g):
  • Figure US20150099738A1-20150409-C00077
  • or a pharmaceutically acceptable form thereof, wherein G, Ra, Rb and R15 are as defined above and herein. In certain embodiments, Ra and Rb are —H. In certain embodiments, z is 1. In certain embodiments, G is —ORe. In certain embodiments, G is —Br. However, in certain embodiments, G is not halogen (e.g., —Br, —Cl, —I). In certain embodiments, R15 is selected from —OR16 and C1-10 perhaloalkyl.
  • Exemplary Compounds of the Present Invention
  • Exemplified compounds of formulae (I), (IV) and (V) and subgenera thereof, are depicted in Tables 1a to 1d, provided below, and are also described in more detail in Examples 1-66, provided herein. Compounds were assayed as inhibitors of human FAAH using the Method described in detail in Example 67.
  • In certain embodiments, the compound is any one of the compounds provided in Table 1a, or a pharmaceutically acceptable form thereof:
  • TABLE 1a
    Figure US20150099738A1-20150409-C00078
    Compound G R18
    III-27 —Br
    Figure US20150099738A1-20150409-C00079
    III-48 —Cl
    Figure US20150099738A1-20150409-C00080
    III-51
    Figure US20150099738A1-20150409-C00081
    Figure US20150099738A1-20150409-C00082
    III-52
    Figure US20150099738A1-20150409-C00083
    Figure US20150099738A1-20150409-C00084
    III-18 —Br
    Figure US20150099738A1-20150409-C00085
    III-46
    Figure US20150099738A1-20150409-C00086
    Figure US20150099738A1-20150409-C00087
    III-59
    Figure US20150099738A1-20150409-C00088
    Figure US20150099738A1-20150409-C00089
    III-60
    Figure US20150099738A1-20150409-C00090
    Figure US20150099738A1-20150409-C00091
    III-16 —Br
    Figure US20150099738A1-20150409-C00092
    III-58
    Figure US20150099738A1-20150409-C00093
    Figure US20150099738A1-20150409-C00094
    III-49 —Br
    Figure US20150099738A1-20150409-C00095
    III-50
    Figure US20150099738A1-20150409-C00096
    Figure US20150099738A1-20150409-C00097
    III-9 —Br
    Figure US20150099738A1-20150409-C00098
    III-47 —Cl
    Figure US20150099738A1-20150409-C00099
    III-53
    Figure US20150099738A1-20150409-C00100
    Figure US20150099738A1-20150409-C00101
    III-14 —Br —H
    III-15 —Br
    Figure US20150099738A1-20150409-C00102
    III-17 —Br
    Figure US20150099738A1-20150409-C00103
    III-19 —Br
    Figure US20150099738A1-20150409-C00104
    III-20 —Br
    Figure US20150099738A1-20150409-C00105
    III-21 —Br
    Figure US20150099738A1-20150409-C00106
    III-22 —Br
    Figure US20150099738A1-20150409-C00107
    III-23 —Br
    Figure US20150099738A1-20150409-C00108
    III-24 —Br
    Figure US20150099738A1-20150409-C00109
    III-25 —Br
    Figure US20150099738A1-20150409-C00110
    III-26 —Br
    Figure US20150099738A1-20150409-C00111
    III-28 —Br
    Figure US20150099738A1-20150409-C00112
    III-29 —Br
    Figure US20150099738A1-20150409-C00113
    III-30 —Br
    Figure US20150099738A1-20150409-C00114
    III-31 —Br
    Figure US20150099738A1-20150409-C00115
    III-32 —Br
    Figure US20150099738A1-20150409-C00116
    III-33 —Br
    Figure US20150099738A1-20150409-C00117
    III-34 —Br
    Figure US20150099738A1-20150409-C00118
    III-35 —Br
    Figure US20150099738A1-20150409-C00119
    III-36 —Br
    Figure US20150099738A1-20150409-C00120
    III-37 —Br
    Figure US20150099738A1-20150409-C00121
    III-38 —Br
    Figure US20150099738A1-20150409-C00122
    III-39 —Br
    Figure US20150099738A1-20150409-C00123
    III-40 —Br
    Figure US20150099738A1-20150409-C00124
    III-41 —Br
    Figure US20150099738A1-20150409-C00125
    III-54
    Figure US20150099738A1-20150409-C00126
    Figure US20150099738A1-20150409-C00127
    III-55
    Figure US20150099738A1-20150409-C00128
    Figure US20150099738A1-20150409-C00129
    III-56
    Figure US20150099738A1-20150409-C00130
    Figure US20150099738A1-20150409-C00131
    III-57
    Figure US20150099738A1-20150409-C00132
    Figure US20150099738A1-20150409-C00133
  • In certain embodiments, the compound is any one of the compounds provided in Table 1b, or a pharmaceutically acceptable form thereof:
  • TABLE 1b
    Figure US20150099738A1-20150409-C00134
    Compound G R18
    III-43 —Br
    Figure US20150099738A1-20150409-C00135
    III-44 —Br
    Figure US20150099738A1-20150409-C00136
    III-45 —Br
    Figure US20150099738A1-20150409-C00137
  • In certain embodiments, the compound is any one of the compounds provided in Table 1c, or a pharmaceutically acceptable form thereof:
  • TABLE 1c
    Figure US20150099738A1-20150409-C00138
    Com-
    pound G R15
    III-63 —Br
    Figure US20150099738A1-20150409-C00139
    III-64
    Figure US20150099738A1-20150409-C00140
    Figure US20150099738A1-20150409-C00141
    III-66 —Br —OCF3
    III-67
    Figure US20150099738A1-20150409-C00142
    —OCF3
    III-68
    Figure US20150099738A1-20150409-C00143
    —OCF3
    III-70
    Figure US20150099738A1-20150409-C00144
    —OCF3
    III-71
    Figure US20150099738A1-20150409-C00145
    —OCF3
    III-73
    Figure US20150099738A1-20150409-C00146
    —OCF3
    III-74
    Figure US20150099738A1-20150409-C00147
    —OCF3
  • In certain embodiments, the compound is any one of the compounds provided in Table 1d, or a pharmaceutically acceptable form thereof:
  • TABLE 1d
    Figure US20150099738A1-20150409-C00148
    III-1
    Figure US20150099738A1-20150409-C00149
    III-2
    Figure US20150099738A1-20150409-C00150
    III-3
    Figure US20150099738A1-20150409-C00151
    III-4
    Figure US20150099738A1-20150409-C00152
    III-8
    Figure US20150099738A1-20150409-C00153
    III-10
    Figure US20150099738A1-20150409-C00154
    III-11
    Figure US20150099738A1-20150409-C00155
    III-12
    Figure US20150099738A1-20150409-C00156
    III-13
    Figure US20150099738A1-20150409-C00157
    III-42
    Figure US20150099738A1-20150409-C00158
    III-62
  • However, in certain embodiments of formulae (I), (IV) and (V), or subgenera thereof, any one of the following compounds, wherein R18 is as defined herein, and R15 is —OCH3, —CN, —CO2H, —CO2CH3, —CO2CH2CH3:
  • Figure US20150099738A1-20150409-C00159
  • are specifically excluded.
  • II. Pharmaceutical Compositions
  • In certain embodiments, the present invention provides a pharmaceutical composition comprising a compound of the formula (I) or a pharmaceutically acceptable form thereof, and a pharmaceutically acceptable excipient.
  • Pharmaceutically acceptable excipients include any and all solvents, diluents or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. General considerations in the formulation and/or manufacture of pharmaceutical compositions agents can be found, for example, in Remington's Pharmaceutical Sciences, Sixteenth Edition, E. W. Martin (Mack Publishing Co., Easton, Pa., 1980), and Remington: The Science and Practice of Pharmacy, 21st Edition (Lippincott Williams & Wilkins, 2005).
  • Pharmaceutical compositions described herein can be prepared by any method known in the art of pharmacology. In general, such preparatory methods include the steps of bringing the active ingredient into association with a carrier and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
  • Pharmaceutical compositions can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
  • Relative amounts of the active ingredient, the pharmaceutically acceptable carrier, and/or any additional ingredients in a pharmaceutical composition of the invention will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient.
  • Pharmaceutically acceptable excipients used in the manufacture of provided pharmaceutical compositions include inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and perfuming agents may also be present in the composition.
  • Exemplary diluents include calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and combinations thereof.
  • Exemplary granulating and/or dispersing agents include potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, etc., and combinations thereof.
  • Exemplary surface active agents and/or emulsifiers include natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and Veegum [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g. stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g. carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g. polyoxyethylene sorbitan monolaurate [Tween 20], polyoxyethylene sorbitan [Tween 60], polyoxyethylene sorbitan monooleate [Tween 80], sorbitan monopalmitate [Span 40], sorbitan monostearate [Span 60], sorbitan tristearate [Span 65], glyceryl monooleate, sorbitan monooleate [Span 80]), polyoxyethylene esters (e.g. polyoxyethylene monostearate [Myrj 45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g. Cremophor), polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [Brij 30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic F 68, Poloxamer 188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and/or combinations thereof.
  • Exemplary binding agents include starch (e.g. cornstarch and starch paste), gelatin, sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.), natural and synthetic gums (e.g. acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum), and larch arabogalactan), alginates, polyethylene oxide, polyethylene glycol, inorganic calcium salts, silicic acid, polymethacrylates, waxes, water, alcohol, etc., and/or combinations thereof.
  • Exemplary preservatives include antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and other preservatives.
  • Exemplary antioxidants include alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and sodium sulfite.
  • Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA) and salts and hydrates thereof (e.g., sodium edetate, disodium edetate, trisodium edetate, calcium disodium edetate, dipotassium edetate, and the like), citric acid and salts and hydrates thereof (e.g., citric acid monohydrate), fumaric acid and salts and hydrates thereof, malic acid and salts and hydrates thereof, phosphoric acid and salts and hydrates thereof, and tartaric acid and salts and hydrates thereof. Exemplary antimicrobial preservatives include benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and thimerosal.
  • Exemplary antifungal preservatives include butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and sorbic acid.
  • Exemplary alcohol preservatives include ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
  • Exemplary acidic preservatives include vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
  • Other preservatives include tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant Plus, Phenonip, methylparaben, Germall 115, Germaben II, Neolone, Kathon, and Euxyl. In certain embodiments, the preservative is an anti-oxidant. In other embodiments, the preservative is a chelating agent.
  • Exemplary buffering agents include citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, D-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, etc., and combinations thereof.
  • Exemplary lubricating agents include magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.
  • Exemplary oils include almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and combinations thereof.
  • Liquid dosage forms for oral and parenteral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs. In addition to the active ingredients, the liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, the oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and perfuming agents. In certain embodiments for parenteral administration, the conjugates of the invention are mixed with solubilizing agents such as Cremophor, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and combinations thereof.
  • Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation can be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P. and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid are used in the preparation of injectables.
  • The injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
  • In order to prolong the effect of a drug, it is often desirable to slow the absorption of the drug from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle.
  • Compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing the conjugates of this invention with suitable non-irritating excipients or carriers such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
  • Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, the active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol and glycerol monostearate, h) absorbents such as kaolin and bentonite clay, and i) lubricants such as talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate, and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may comprise buffering agents.
  • Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type can be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polethylene glycols and the like.
  • The active ingredients can be in micro-encapsulated form with one or more excipients as noted above. The solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings and other coatings well known in the pharmaceutical formulating art. In such solid dosage forms the active ingredient can be admixed with at least one inert diluent such as sucrose, lactose or starch. Such dosage forms may comprise, as is normal practice, additional substances other than inert diluents, e.g., tableting lubricants and other tableting aids such a magnesium stearate and microcrystalline cellulose. In the case of capsules, tablets and pills, the dosage forms may comprise buffering agents. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes.
  • Dosage forms for topical and/or transdermal administration of a compound of this invention may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants and/or patches. Generally, the active ingredient is admixed under sterile conditions with a pharmaceutically acceptable carrier and/or any needed preservatives and/or buffers as can be required. Additionally, the present invention contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of an active ingredient to the body. Such dosage forms can be prepared, for example, by dissolving and/or dispensing the active ingredient in the proper medium. Alternatively or additionally, the rate can be controlled by either providing a rate controlling membrane and/or by dispersing the active ingredient in a polymer matrix and/or gel.
  • Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices such as those described in U.S. Pat. Nos. 4,886,499; 5,190,521; 5,328,483; 5,527,288; 4,270,537; 5,015,235; 5,141,496; and 5,417,662. Intradermal compositions can be administered by devices which limit the effective penetration length of a needle into the skin, such as those described in PCT publication WO 99/34850 and functional equivalents thereof. Jet injection devices which deliver liquid vaccines to the dermis via a liquid jet injector and/or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable. Jet injection devices are described, for example, in U.S. Pat. Nos. 5,480,381; 5,599,302; 5,334,144; 5,993,412; 5,649,912; 5,569,189; 5,704,911; 5,383,851; 5,893,397; 5,466,220; 5,339,163; 5,312,335; 5,503,627; 5,064,413; 5,520,639; 4,596,556; 4,790,824; 4,941,880; 4,940,460; and PCT publications WO 97/37705 and WO 97/13537. Ballistic powder/particle delivery devices which use compressed gas to accelerate vaccine in powder form through the outer layers of the skin to the dermis are suitable. Alternatively or additionally, conventional syringes can be used in the classical mantoux method of intradermal administration.
  • Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions. Topically-administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of the active ingredient can be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
  • A pharmaceutical composition of the invention can be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 to about 7 nanometers or from about 1 to about 6 nanometers. Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant can be directed to disperse the powder and/or using a self propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container. Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nanometers and at least 95% of the particles by number have a diameter less than 7 nanometers. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nanometer and at least 90% of the particles by number have a diameter less than 6 nanometers. Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
  • Low boiling propellants generally include liquid propellants having a boiling point of below 65° F. at atmospheric pressure. Generally the propellant may constitute 50 to 99.9% (w/w) of the composition, and the active ingredient may constitute 0.1 to 20% (w/w) of the composition. The propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
  • Pharmaceutical compositions of the invention formulated for pulmonary delivery may provide the active ingredient in the form of droplets of a solution and/or suspension. Such formulations can be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising the active ingredient, and may conveniently be administered using any nebulization and/or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate. The droplets provided by this route of administration may have an average diameter in the range from about 0.1 to about 200 nanometers.
  • The formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition of the invention. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 to 500 micrometers. Such a formulation is administered, by rapid inhalation through the nasal passage from a container of the powder held close to the nares.
  • Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of the active ingredient, and may comprise one or more of the additional ingredients described herein. A pharmaceutical composition of the invention can be prepared, packaged, and/or sold in a formulation suitable for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may contain, for example, 0.1 to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising the active ingredient. Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 to about 200 nanometers, and may further comprise one or more of the additional ingredients described herein.
  • A pharmaceutical composition of the invention can be prepared, packaged, and/or sold in a formulation suitable for ophthalmic administration. Such formulations may, for example, be in the form of eye drops including, for example, a 0.1/1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid carrier. Such drops may further comprise buffering agents, salts, and/or one or more other of the additional ingredients described herein. Other opthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are contemplated as being within the scope of this invention.
  • Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with ordinary experimentation. General considerations in the formulation and/or manufacture of pharmaceutical compositions can be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005.
  • Still further encompassed by the invention are pharmaceutical packs and/or kits. Pharmaceutical packs and/or kits provided may comprise a provided composition and a container (e.g., a vial, ampoule, bottle, syringe, and/or dispenser package, or other suitable container). In some embodiments, provided kits may optionally further include a second container comprising a suitable aqueous carrier for dilution or suspension of the provided composition for preparation of administration to a subject. In some embodiments, contents of provided formulation container and solvent container combine to form at least one unit dosage form.
  • In some embodiments, a provided composition of the invention can be useful in conjunction with subject controlled analgesia (PCA) devices, wherein a subject can administer, for example, opioid analgesia as required for pain management.
  • Optionally, a single container may comprise one or more compartments for containing a provided composition, and/or appropriate aqueous carrier for suspension or dilution.
  • In some embodiments, a single container can be appropriate for modification such that the container may receive a physical modification so as to allow combination of compartments and/or components of individual compartments. For example, a foil or plastic bag may comprise two or more compartments separated by a perforated seal which can be broken so as to allow combination of contents of two individual compartments once the signal to break the seal is generated. A pharmaceutical pack or kit may thus comprise such multi-compartment containers including a provided composition and appropriate solvent and/or appropriate aqueous carrier for suspension.
  • Optionally, instructions for use are additionally provided in such kits of the invention. Such instructions may provide, generally, for example, instructions for dosage and administration. In other embodiments, instructions may further provide additional detail relating to specialized instructions for particular containers and/or systems for administration. Still further, instructions may provide specialized instructions for use in conjunction and/or in combination with additional therapy. In one non-limiting example, the formulations of the invention can be used in conjunction with opioid analgesia administration, which may, optionally, comprise use of a subject controlled analgesia (PCA) device. Thus, instructions for use of provided formulations may comprise instructions for use in conjunction with PCA administration devices.
  • III. Methods of Use and Treatment
  • The present invention provides methods for treating a FAAH-mediated condition comprising administering to a subject in need thereof a therapeutically effective amount of a compound of formula (I) or a pharmaceutically acceptable form thereof.
  • The present invention also provides methods for inhibiting FAAH in a subject comprising administering to a subject in need thereof a therapeutically effective amount of a compound of formula (I) or a pharmaceutically acceptable form thereof.
  • The present invention also provides a method of inhibiting activation of the FAAH pathway in vitro or ex vivo, comprising contacting a FAAH protein with a compound of formula (I) in an amount sufficient to reduce the activation of the FAAH pathway.
  • The present invention also provides use of a compound of formula (I) for the treatment of a FAAH-mediated condition in a subject.
  • The present invention also provides use of a compound of formula (I) in the manufacture of a medicament. In certain embodiments, the medicament is useful for treating a FAAH-mediated condition.
  • A “subject” to which administration is contemplated includes, but is not limited to, humans (i.e., a male or female of any age group, e.g., a pediatric subject (e.g, infant, child, adolescent) or adult subject (e.g., young adult, middle-aged adult or senior adult)) and/or other primates (e.g., cynomolgus monkeys, rhesus monkeys); mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, goats, cats, and/or dogs; and/or birds, including commercially relevant birds such as chickens, ducks, geese, and/or turkeys.
  • As used herein, and unless otherwise specified, the terms “treat,” “treating” and “treatment” contemplate an action that occurs while a subject is suffering from the specified disease, disorder or condition, which reduces the severity of the disease, disorder or condition, or retards or slows the progression of the disease, disorder or condition.
  • As used herein, unless otherwise specified, the terms “prevent,” “preventing” and “prevention” contemplate an action that occurs before a subject begins to suffer from the specified disease, disorder or condition, which inhibits or reduces the severity of the disease, disorder or condition.
  • As used herein, and unless otherwise specified, the terms “manage,” “managing” and “management” encompass preventing the recurrence of the specified disease, disorder or condition in a subject who has already suffered from the disease, disorder or condition, and/or lengthening the time that a subject who has suffered from the disease, disorder or condition remains in remission. The terms encompass modulating the threshold, development and/or duration of the disease, disorder or condition, or changing the way that a subject responds to the disease, disorder or condition.
  • As used herein, and unless otherwise specified, a “therapeutically effective amount” of a compound is an amount sufficient to provide a therapeutic benefit in the treatment or management of a disease, disorder or condition, or to delay or minimize one or more symptoms associated with the disease, disorder or condition. A therapeutically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other therapies, which provides a therapeutic benefit in the treatment or management of the disease, disorder or condition. The term “therapeutically effective amount” can encompass an amount that improves overall therapy, reduces or avoids symptoms or causes of disease or condition, or enhances the therapeutic efficacy of another therapeutic agent.
  • As used herein, and unless otherwise specified, a “prophylactically effective amount” of a compound is an amount sufficient to prevent a disease, disorder or condition, or one or more symptoms associated with the disease, disorder or condition, or prevent its recurrence. A prophylactically effective amount of a compound means an amount of therapeutic agent, alone or in combination with other agents, which provides a prophylactic benefit in the prevention of the disease, disorder or condition. The term “prophylactically effective amount” can encompass an amount that improves overall prophylaxis or enhances the prophylactic efficacy of another prophylactic agent.
  • As used herein “inhibition”, “inhibiting”, “inhibit” and “inhibitor”, and the like, refer to the ability of a compound to reduce, slow, halt or prevent activity of a particular biological process (e.g., FAAH activity) in a cell relative to vehicle.
  • “FAAH-mediated condition” as used herein, refers to a disease, disorder or condition which is treatable by inhibition of FAAH activity. “Disease”, “disorder” or “condition” are terms used interchangeably herein. FAAH-mediated conditions include, but are not limited to, painful conditions, inflammatory conditions, immune disorders, disorders of the central nervous system, metabolic disorders, cardiac disorders and glaucoma.
  • In certain embodiments, the FAAH-mediated condition is a painful condition. As used herein, a “painful condition” includes, but is not limited to, neuropathic pain (e.g., peripheral neuropathic pain), central pain, deafferentiation pain, chronic pain (e.g., chronic nociceptive pain, and other forms of chronic pain such as post-operative pain, e.g., pain arising after hip, knee, or other replacement surgery), pre-operative pain, stimulus of nociceptive receptors (nociceptive pain), acute pain (e.g., phantom and transient acute pain), non-inflammatory pain, inflammatory pain, pain associated with cancer, wound pain, burn pain, post-operative pain, pain associated with medical procedures, pain resulting from pruritus, painful bladder syndrome, pain associated with premenstrual dysphoric disorder and/or premenstrual syndrome, pain associated with chronic fatigue syndrome, pain associated with pre-term labor, pain associated with withdrawl symptoms from drug addiction, joint pain, arthritic pain (e.g., pain associated with crystalline arthritis, osteoarthritis, psoriatic arthritis, gouty arthritis, reactive arthritis, rheumatoid arthritis or Reiter's arthritis), lumbosacral pain, musculo-skeletal pain, headache, migraine, muscle ache, lower back pain, neck pain, toothache, dental/maxillofacial pain, visceral pain and the like.
  • One or more of the painful conditions contemplated herein can comprise mixtures of various types of pain provided above and herein (e.g. nociceptive pain, inflammatory pain, neuropathic pain, etc.). In some embodiments, a particular pain can dominate. In other embodiments, the painful condition comprises two or more types of pains without one dominating. A skilled clinician can determine the dosage to achieve a therapeutically effective amount for a particular subject based on the painful condition.
  • In certain embodiments, the painful condition is neuropathic pain. The term “neuropathic pain” refers to pain resulting from injury to a nerve. Neuropathic pain is distinguished from nociceptive pain, which is the pain caused by acute tissue injury involving small cutaneous nerves or small nerves in muscle or connective tissue. Neuropathic pain typically is long-lasting or chronic and often develops days or months following an initial acute tissue injury. Neuropathic pain can involve persistent, spontaneous pain as well as allodynia, which is a painful response to a stimulus that normally is not painful. Neuropathic pain also can be characterized by hyperalgesia, in which there is an accentuated response to a painful stimulus that usually is trivial, such as a pin prick. Neuropathic pain conditions can develop following neuronal injury and the resulting pain may persist for months or years, even after the original injury has healed. Neuronal injury may occur in the peripheral nerves, dorsal roots, spinal cord or certain regions in the brain. Neuropathic pain conditions include, but are not limited to, diabetic neuropathy (e.g., peripheral diabetic neuropathy); sciatica; non-specific lower back pain; multiple sclerosis pain; carpal tunnel syndrome, fibromyalgia; HIV-related neuropathy; neuralgia (e.g., post-herpetic neuralgia, trigeminal neuralgia); pain resulting from physical trauma (e.g., amputation; surgery, invasive medical procedures, toxins, burns, infection), pain resulting from cancer or chemotherapy (e.g., chemotherapy-induced pain such as chemotherapy-induced peripheral neuropathy), and pain resulting from an inflammatory condition (e.g., a chronic inflammatory condition). Neuropathic pain can result from a peripheral nerve disorder such as neuroma; nerve compression; nerve crush, nerve stretch or incomplete nerve transsection; mononeuropathy or polyneuropathy. Neuropathic pain can also result from a disorder such as dorsal root ganglion compression; inflammation of the spinal cord; contusion, tumor or hemisection of the spinal cord; tumors of the brainstem, thalamus or cortex; or trauma to the brainstem, thalamus or cortex.
  • The symptoms of neuropathic pain are heterogeneous and are often described as spontaneous shooting and lancinating pain, or ongoing, burning pain. In addition, there is pain associated with normally non-painful sensations such as “pins and needles” (paraesthesias and dysesthesias), increased sensitivity to touch (hyperesthesia), painful sensation following innocuous stimulation (dynamic, static or thermal allodynia), increased sensitivity to noxious stimuli (thermal, cold, mechanical hyperalgesia), continuing pain sensation after removal of the stimulation (hyperpathia) or an absence of or deficit in selective sensory pathways (hypoalgesia).
  • In certain embodiments, the painful condition is non-inflammatory pain. The types of non-inflammatory pain include, without limitation, peripheral neuropathic pain (e.g., pain caused by a lesion or dysfunction in the peripheral nervous system), central pain (e.g., pain caused by a lesion or dysfunction of the central nervous system), deafferentation pain (e.g., pain due to loss of sensory input to the central nervous system), chronic nociceptive pain (e.g., certain types of cancer pain), noxious stimulus of nociceptive receptors (e.g., pain felt in response to tissue damage or impending tissue damage), phantom pain (e.g., pain felt in a part of the body that no longer exists, such as a limb that has been amputated), pain felt by psychiatric subjects (e.g., pain where no physical cause may exist), and wandering pain (e.g., wherein the pain repeatedly changes location in the body).
  • In certain embodiments, the painful condition is inflammatory pain. In certain embodiments, the painful condition (e.g., inflammatory pain) is associated with an inflammatory condition and/or an immune disorder.
  • In certain embodiments, the FAAH-mediated condition is an inflammatory condition. The term “inflammatory condition” refers to those diseases, disorders or conditions that are characterized by signs of pain (dolor, from the generation of noxious substances and the stimulation of nerves), heat (calor, from vasodilatation), redness (rubor, from vasodilatation and increased blood flow), swelling (tumor, from excessive inflow or restricted outflow of fluid), and/or loss of function (functio laesa, which can be partial or complete, temporary or permanent. Inflammation takes on many forms and includes, but is not limited to, acute, adhesive, atrophic, catarrhal, chronic, cirrhotic, diffuse, disseminated, exudative, fibrinous, fibrosing, focal, granulomatous, hyperplastic, hypertrophic, interstitial, metastatic, necrotic, obliterative, parenchymatous, plastic, productive, proliferous, pseudomembranous, purulent, sclerosing, seroplastic, serous, simple, specific, subacute, suppurative, toxic, traumatic, and/or ulcerative inflammation.
  • Exemplary inflammatory conditions include, but are not limited to, inflammation associated with acne, anemia (e.g., aplastic anemia, haemolytic autoimmune anaemia), asthma, arteritis (e.g., polyarteritis, temporal arteritis, periarteritis nodosa, Takayasu's arteritis), arthritis (e.g., crystalline arthritis, osteoarthritis, psoriatic arthritis, gouty arthritis, reactive arthritis, rheumatoid arthritis and Reiter's arthritis), ankylosing spondylitis, amylosis, amyotrophic lateral sclerosis, autoimmune diseases, allergies or allergic reactions, atherosclerosis, bronchitis, bursitis, chronic prostatitis, conjunctivitis, Chagas disease, chronic obstructive pulmonary disease, cermatomyositis, diverticulitis, diabetes (e.g., type I diabetes mellitus, type 2 diabetes mellitus), a skin condition (e.g., psoriasis, eczema, burns, dermatitis, pruritus (itch)), endometriosis, Guillain-Barre syndrome, infection, ischaemic heart disease, Kawasaki disease, glomerulonephritis, gingivitis, hypersensitivity, headaches (e.g., migraine headaches, tension headaches), ileus (e.g., postoperative ileus and ileus during sepsis), idiopathic thrombocytopenic purpura, interstitial cystitis (painful bladder syndrome), gastrointestinal disorder (e.g., selected from peptic ulcers, regional enteritis, diverticulitis, gastrointestinal bleeding, eosinophilic gastrointestinal disorders (e.g., eosinophilic esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis, eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux disease (GORD, or its synonym GERD), inflammatory bowel disease (IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's syndrome, indeterminate colitis) and inflammatory bowel syndrome (IBS)), lupus, multiple sclerosis, morphea, myeasthenia gravis, myocardial ischemia, nephrotic syndrome, pemphigus vulgaris, pernicious aneaemia, peptic ulcers, polymyositis, primary biliary cirrhosis, neuroinflammation associated with brain disorders (e.g., Parkinson's disease, Huntington's disease, and Alzheimer's disease), prostatitis, chronic inflammation associated with cranial radiation injury, pelvic inflammatory disease, reperfusion injury, regional enteritis, rheumatic fever, systemic lupus erythematosus, schleroderma, scierodoma, sarcoidosis, spondyloarthopathies, Sjogren's syndrome, thyroiditis, transplantation rejection, tendonitis, trauma or injury (e.g., frostbite, chemical irritants, toxins, scarring, burns, physical injury), vasculitis, vitiligo and Wegener's granulomatosis. In certain embodiments, the inflammatory disorder is selected from arthritis (e.g., rheumatoid arthritis), inflammatory bowel disease, inflammatory bowel syndrome, asthma, psoriasis, endometriosis, interstitial cystitis and prostatistis. In certain embodiments, the inflammatory condition is an acute inflammatory condition (e.g., for example, inflammation resulting from infection). In certain embodiments, the inflammatory condition is a chronic inflammatory condition (e.g., conditions resulting from asthma, arthritis and inflammatory bowel disease). The compounds may also be useful in treating inflammation associated with trauma and non-inflammatory myalgia. The compounds may also be useful in treating inflammation associated with cancer.
  • In certain embodiments, the FAAH-mediated condition is an immune disorder. Immune disorders, such as auto-immune disorders, include, but are not limited to, arthritis (including rheumatoid arthritis, spondyloarthopathies, gouty arthritis, degenerative joint diseases such as osteoarthritis, systemic lupus erythematosus, Sjogren's syndrome, ankylosing spondylitis, undifferentiated spondylitis, Behcet's disease, haemolytic autoimmune anaemias, multiple sclerosis, amyotrophic lateral sclerosis, amylosis, acute painful shoulder, psoriatic, and juvenile arthritis), asthma, atherosclerosis, osteoporosis, bronchitis, tendonitis, bursitis, skin condition (e.g., psoriasis, eczema, burns, dermatitis, pruritus (itch)), enuresis, eosinophilic disease, gastrointestinal disorder (e.g., selected from peptic ulcers, regional enteritis, diverticulitis, gastrointestinal bleeding, eosinophilic gastrointestinal disorders (e.g., eosinophilic esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis, eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux disease (GORD, or its synonym GERD), inflammatory bowel disease (IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's syndrome, indeterminate colitis) and inflammatory bowel syndrome (IBS)), and disorders ameliorated by a gastroprokinetic agent (e.g., ileus, postoperative ileus and ileus during sepsis; gastroesophageal reflux disease (GORD, or its synonym GERD); eosinophilic esophagitis, gastroparesis such as diabetic gastroparesis; food intolerances and food allergies and other functional bowel disorders, such as non-ulcerative dyspepsia (NUD) and non-cardiac chest pain (NCCP, including costo-chondritis)).
  • In certain embodiments, the inflammatory disorder and/or the immune disorder is a gastrointestinal disorder. In some embodiments, the gastrointestinal disorder is selected from gastrointestinal disorder (e.g., selected from peptic ulcers, regional enteritis, diverticulitis, gastrointestinal bleeding, eosinophilic gastrointestinal disorders (e.g., eosinophilic esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis, eosinophilic colitis), gastritis, diarrhea, gastroesophageal reflux disease (GORD, or its synonym GERD), inflammatory bowel disease (IBD) (e.g., Crohn's disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, ischaemic colitis, diversion colitis, Behcet's syndrome, indeterminate colitis) and inflammatory bowel syndrome (IBS)). In certain embodiments, the gastrointestinal disorder is inflammatory bowel disease (IBD).
  • In certain embodiments, the inflammatory condition and/or immune disorder is a skin condition. In some embodiments, the skin condition is pruritus (itch), psoriasis, eczema, burns or dermatitis. In certain embodiments, the skin condition is psoriasis. In certain embodiments, the skin condition is pruritis.
  • In certain embodiments, the FAAH-mediated condition is a disorder of the central nervous system (CNS) (“CNS disorder”). Exemplary CNS disorders include, but are not limited to, neurotoxicity and/or neurotrauma, stroke, multiple sclerosis, spinal cord injury, epilepsy, a mental disorder, a sleep condition, a movement disorder, nausea and/or emesis, amyotrophic lateral sclerosis, Alzheimer's disease and drug addiction.
  • In certain embodiments, the CNS disorder is neurotoxicity and/or neurotrauma, e.g., for example, as a result of acute neuronal injury (e.g., tramatic brain injury (TBI), stroke, epilepsy) or a chronic neurodegenerative disorder (e.g., multiple sclerosis, Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis, Alzheimer's disease). In certain embodiments, the compound of the present invention provides a neuroprotective effect, e.g., against an acute neuronal injury or a chronic neurodegenerative disorder.
  • In certain embodiments, the CNS disorder is stroke (e.g., ischemic stroke).
  • In certain embodiments, the CNS disorder is multiple sclerosis.
  • In certain embodiments, the CNS disorder is spinal cord injury.
  • In certain embodiments, the CNS disorder is epilepsy.
  • In certain embodiments, the CNS disorder is a mental disorder, e.g., for example, depression, anxiety or anxiety-related conditions, a learning disability or schizophrenia.
  • In certain embodiments, the CNS disorder is depression. “Depression,” as used herein, includes, but is not limited to, depressive disorders or conditions, such as, for example, major depressive disorders (e.g., unipolar depression), dysthymic disorders (e.g., chronic, mild depression), bipolar disorders (e.g., manic-depression), seasonal affective disorder, and/or depression associated with drug addiction (e.g., withdrawal). The depression can be clinical or subclinical depression. The depression can be associated with or prementrual syndrome and/or premenstrual dysphoric disorder.
  • In certain embodiments, the CNS disorder is anxiety. “Anxiety,” as used herein, includes, but is not limited to anxiety and anxiety-related conditions, such as, for example, clinical anxiety, panic disorder, agoraphobia, generalized anxiety disorder, specific phobia, social phobia, obsessive-compulsive disorder, acute stress disorder, post-traumatic stress disorder, adjustment disorders with anxious features, anxiety disorder associated with depression, anxiety disorder due to general medical conditions, and substance-induced anxiety disorders, anxiety associated with drug addiction (e.g., withdrawal, dependence, reinstatement) and anxiety associated with nausea and/or emesis. This treatment may also be to induce or promote sleep in a subject (e.g., for example, a subject with anxiety).
  • In certain embodiments, the CNS disorder is a learning disorder (e.g., attention deficit disorder (ADD)).
  • In certain embodiments, the CNS disorder is Schizophrenia.
  • In certain embodiments, the CNS disorder is a sleep condition. “Sleep conditions” include, but are not limited to, insomia, narcolepsy, sleep apnea, restless legs syndrome (RLS), delayed sleep phase syndrome (DSPS), periodic limb movement disorder (PLMD), hypopnea syndrome, rapid eye movement behavior disorder (RBD), shift work sleep condition (SWSD), and sleep problems (e.g., parasomnias) such as nightmares, night terrors, sleep talking, head banging, snoring, and clenched jaw and/or grinding of teeth (bruxism).
  • In certain embodiments, the CNS disorder is a movement disorder, e.g., basal ganglia disorders, such as, for example, Parkinson's disease, levodopa-induced dyskinesia, Huntington's disease, Gilles de la Tourette's syndrome, tardive diskinesia and dystonia.
  • In certain embodiments, the CNS disorder is Alzheimer's disease.
  • In certain embodiments, the CNS disorder is amyotrophic lateral sclerosis (ALS).
  • In certain embodiments, the CNS disorder is nausea and/or emesis.
  • In certain embodiments, the CNS disorder is drug addiction (e.g., for instance, addiction to opiates, nicotine, cocaine, psychostimulants or alcohol).
  • In still yet other embodiments, the FAAH-mediated condition is a cardiac disorder, e.g., for example, selected from hypertension, circulatory shock, myocardial reperfusion injury and atherosclerosis.
  • In certain embodiments, the FAAH-mediated condition is a metabolic disorder (e.g., a wasting condition, an obesity-related condition or complication thereof).
  • In certain embodiments, the metabolic disorder is a wasting condition. A “wasting condition,” as used herein, includes but is not limited to, anorexia and cachexias of various natures (e.g., weight loss associated with cancer, weight loss associated with other general medical conditions, weight loss associated with failure to thrive, and the like).
  • In certain embodiments, the metabolic disorder is an obesity-related condition or a complication thereof. An “obesity-related condition” as used herein, includes, but is not limited to, obesity, undesired weight gain (e.g., from medication-induced weight gain, from cessation of smoking) and an over-eating disorder (e.g., binge eating, bulimia, compulsive eating, or a lack of appetite control each of which can optionally lead to undesired weight gain or obesity). “Obesity” and “obese” as used herein, refers to class I obesity, class II obesity, class III obesity and pre-obesity (e.g., being “over-weight”) as defined by the World Health Organization.
  • Reduction of storage fat is expected to provide various primary and/or secondary benefits in a subject (e.g., in a subject diagnosed with a complication associated with obesity) such as, for example, an increased insulin responsiveness (e.g., in a subject diagnosed with Type II diabetes mellitus); a reduction in elevated blood pressure; a reduction in elevated cholesterol levels; and/or a reduction (or a reduced risk or progression) of ischemic heart disease, arterial vascular disease, angina, myocardial infarction, stroke, migraines, congestive heart failure, deep vein thrombosis, pulmonary embolism, gall stones, gastroesophagael reflux disease, obstructive sleep apnea, obesity hypoventilation syndrome, asthma, gout, poor mobility, back pain, erectile dysfunction, urinary incontinence, liver injury (e.g., fatty liver disease, liver cirrhosis, alcoholic cirrhosis, endotoxin mediated liver injury) or chronic renal failure. Thus, the method of this invention is applicable to obese subjects, diabetic subjects, and alcoholic subjects.
  • In some embodiments, treatment of an obesity-related condition or complication thereof involves reduction of body weight in the subject. In some embodiments, treatment of an obesity-related condition or complication thereof involves appetite control in the subject.
  • In other embodiments, the FAAH-mediated condition is glaucoma.
  • IV. Administration
  • Provided compounds can be administered using any amount and any route of administration effective for treatment. The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the infection, the particular composition, its mode of administration, its mode of activity, and the like.
  • Compounds provided herein are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions of the present invention will be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective dose level for any particular subject or organism will depend upon a variety of factors including the disease, disorder, or condition being treated and the severity of the disorder; the activity of the specific active ingredient employed; the specific composition employed; the age, body weight, general health, sex and diet of the subject; the time of administration, route of administration, and rate of excretion of the specific active ingredient employed; the duration of the treatment; drugs used in combination or coincidental with the specific active ingredient employed; and like factors well known in the medical arts.
  • The compounds and compositions provided herein can be administered by any route, including oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (as by powders, ointments, creams, and/or drops), mucosal, nasal, bucal, enteral, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; and/or as an oral spray, nasal spray, and/or aerosol. Specifically contemplated routes are systemic intravenous injection, regional administration via blood and/or lymph supply, and/or direct administration to an affected site. In general the most appropriate route of administration will depend upon a variety of factors including the nature of the agent (e.g., its stability in the environment of the gastrointestinal tract), the condition of the subject (e.g., whether the subject is able to tolerate oral administration), etc.
  • The exact amount of a compound required to achieve a therapeutically effective amount will vary from subject to subject, depending, for example, on species, age, and general condition of a subject, severity of the side effects or disorder, identity of the particular compound(s), mode of administration, and the like. The desired dosage can be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks. In certain embodiments, the desired dosage can be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
  • In certain embodiments, a therapeutically effective amount of a compound for administration one or more times a day to a 70 kg adult human may comprise about 0.0001 mg to about 3000 mg, about 0.0001 mg to about 2000 mg, about 0.0001 mg to about 1000 mg, about 0.001 mg to about 1000 mg, about 0.01 mg to about 1000 mg, about 0.1 mg to about 1000 mg, about 1 mg to about 1000 mg, about 1 mg to about 100 mg, about 10 mg to about 1000 mg, or about 100 mg to about 1000 mg, of an inventive compound per unit dosage form. It will be appreciated that dose ranges as described herein provide guidance for the administration of provided pharmaceutical compositions to an adult. The amount to be administered to, for example, a child or an adolescent can be determined by a medical practitioner or person skilled in the art and can be lower or the same as that administered to an adult.
  • It will be also appreciated that a compound or composition, as described herein, can be administered in combination with one or more additional therapeutically active agents. The compound or composition can be administered concurrently with, prior to, or subsequent to, one or more additional therapeutically active agents. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent. In will further be appreciated that the additional therapeutically active agent utilized in this combination can be administered together in a single composition or administered separately in different compositions. The particular combination to employ in a regimen will take into account compatibility of the inventive compound with the additional therapeutically active agent and/or the desired therapeutic effect to be achieved. In general, it is expected that additional therapeutically active agents utilized in combination be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
  • The compounds or compositions can be administered in combination with agents that improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body. It will also be appreciated that therapy employed may achieve a desired effect for the same disorder (for example, a compound can be administered in combination with an anti-inflammatory, anti-anxiety and/or anti-depressive agent, etc.), and/or it may achieve different effects (e.g., control of adverse side-effects).
  • Exemplary active agents include, but are not limited to, anti-cancer agents, antibiotics, anti-viral agents, anesthetics, anti-coagulants, inhibitors of an enzyme, steroidal agents, steroidal or non-steroidal anti-inflammatory agents, antihistamine, immunosuppressant agents, anti-neoplastic agents, antigens, vaccines, antibodies, decongestant,s sedatives, opioids, pain-relieving agents, analgesics, anti-pyretics, hormones, prostaglandins, progestational agents, anti-glaucoma agents, ophthalmic agents, anti-cholinergics, anti-depressants, anti-psychotics, hypnotics, tranquilizers, anti-convulsants/anti-epileptics (e.g., Neurontin, Lyrica, valproates (e.g., Depacon), and other neurostabilizing agents), muscle relaxants, anti-spasmodics, muscle contractants, channel blockers, miotic agents, anti-secretory agents, anti-thrombotic agents, anticoagulants, anti-cholinergics, 3-adrenergic blocking agents, diuretics, cardiovascular active agents, vasoactive agents, vasodilating agents, anti-hypertensive agents, angiogenic agents, modulators of cell-extracellular matrix interactions (e.g. cell growth inhibitors and anti-adhesion molecules), or inhibitors/intercalators of DNA, RNA, protein-protein interactions, protein-receptor interactions, etc. Active agents include small organic molecules such as drug compounds (e.g., compounds approved by the Food and Drugs Administration as provided in the Code of Federal Regulations (CFR)), peptides, proteins, carbohydrates, monosaccharides, oligosaccharides, polysaccharides, nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides or proteins, small molecules linked to proteins, glycoproteins, steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides, oligonucleotides, antisense oligonucleotides, lipids, hormones, vitamins and cells.
  • In certain embodiments, the additional therapeutically active agent is a pain-relieving agent. Exemplary pain relieving agents include, but are not limited to, analgesics such as non-narcotic analgesics [e.g., salicylates such as aspirin, ibuprofen (MOTRIN®, ADVIL®), ketoprofen (ORUDIS®), naproxen (NAPROSYN®), acetaminophen, indomethacin] or narcotic analgesics [e.g., opioid analgesics such as tramadol, fentenyl, sufentanil, morphine, hydromorphone, codeine, oxycodone, and buprenorphine]; non-steroidal anti-inflammatory agents (NSAIDs) [e.g., aspirin, acetaminophen, COX-2 inhibitors]; steroids or anti-rheumatic agents; migraine preparations such as beta adrenergic blocking agents, ergot derivatives; tricyclic antidepressants (e.g., amitryptyline, desipramine, imipramine); anti-epileptics (e.g., clonaxepam, valproic acid, phenobarbital, phenytoin, tiagaine, gabapentin, carbamazepine, topiramate, sodium valproate); α2 agonists; selective serotonin reuptake inhibitors (SSRIs), selective norepinepherine uptake inhibitors; benzodiazepines; mexiletine (MEXITIL); flecainide (TAMBOCOR); NMDA receptor antagonists [e.g., ketamine, detromethorphan, methadone]; and topical agents [e.g., capsaicin (Zostrix), EMLA cream, lidocaine, prilocaine].
  • In other embodiments, the additional therapeutically active agent is an anti-inflammatory agent. Exemplary anti-inflammatory agents include, but are not limited to, aspirin; ibuprofen; ketoprofen; naproxen; etodolac (LODINE®); COX-2 inhibitors such as celecoxib (CELEBREX®), rofecoxib (VIOXX®), valdecoxib (BEXTRA®), parecoxib, etoricoxib (MK663), deracoxib, 2-(4-ethoxy-phenyl)-3-(4-methanesulfonyl-phenyl)-pyrazolo[1,5-b]pyridazine, 4-(2-oxo-3-phenyl-2,3-dihydrooxazol-4-yl)benzenesulfonamide, darbufelone, flosulide, 4-(4-cyclohexyl-2-methyl-5-oxazolyl)-2-fluorobenzenesulfonamide), meloxicam, nimesulide, 1-Methylsulfonyl-4-(1,1-dimethyl-4-(4-fluorophenyl)cyclopenta-2,4-dien-3-yl)benzene, 4-(1,5-Dihydro-6-fluoro-7-methoxy-3-(trifluoromethyl)-(2)-benzothiopyrano(4,3-c)pyrazol-1-yl)benzenesulfonamide, 4,4-dimethyl-2-phenyl-3-(4-methylsulfonyl)phenyl)cyclo-butenone, 4-Amino-N-(4-(2-fluoro-5-trifluoromethyl)-thiazol-2-yl)-benzene sulfonamide, 1-(7-tert-butyl-2,3-dihydro-3,3-dimethyl-5-benzo-furanyl)-4-cyclopropyl butan-1-one, or their physiologically acceptable salts, esters or solvates; sulindac (CLINORIL®); diclofenac (VOLTAREN®); piroxicam (FELDENE®); diflunisal (DOLOBID®), nabumetone (RELAFEN®), oxaprozin (DAYPRO®), indomethacin (INDOCIN®); or steroids such as PEDIAPED® prednisolone sodium phosphate oral solution, SOLU-MEDROL® methylprednisolone sodium succinate for injection, PRELONE® brand prednisolone syrup.
  • Further examples of anti-inflammatory agents include naproxen, which is commercially available in the form of EC-NAPROSYN® delayed release tablets, NAPROSYN®, ANAPROX® and ANAPROX® DS tablets and NAPROSYN® suspension from Roche Labs, CELEBREX® brand of celecoxib tablets, VIOXX® brand of rofecoxib, CELESTONE® brand of betamethasone, CUPRAMINE® brand penicillamine capsules, DEPEN® brand titratable penicillamine tablets, DEPO-MEDROL brand of methylprednisolone acetate injectable suspension, ARAVA™ leflunomide tablets, AZULFIDIINE EN-Tabs® brand of sulfasalazine delayed release tablets, FELDENE® brand piroxicam capsules, CATAFLAM® diclofenac potassium tablets, VOLTAREN® diclofenac sodium delayed release tablets, VOLTAREN®-XR diclofenac sodium extended release tablets, or ENBREL® etanerecept products.
  • V. Methods of Determining Biological Activity
  • Methods of determining the activity of the compounds provided herein for various therapeutic uses are known in the art. These include, but are not limited to, high throughput screening to identify compounds that bind to and/or modulate the activity of isolated FAAH, as well as in vitro and in vivo models of therapies.
  • Assays useful for screening the compounds provided herein may detect the binding of the inhibitor to FAAH or the release of a reaction product (e.g., fatty acid amide or ethanolamine) produced by the hydrolysis of a substrate such as oleoylethanolamide or ananadamide. The substrate can be labeled to facilitate detection of the released reaction products. U.S. Pat. No. 5,559,410 discloses high throughput screening methods for proteins, and U.S. Pat. Nos. 5,576,220 and 5,541,061 disclose high throughput methods of screening for ligand/antibody binding.
  • Methods for screening FAAH inhibitors for an antinociceptive effect are known in the art. For example, compounds can tested in the mouse hot-plate test and the mouse formalin test, and the nociceptive reactions to thermal or chemical tissue damage measured (for example, see U.S. Pat. No. 6,326,156 for a description of methods of screening for antinociceptive activity; see also Cravatt et al. Proc. Natl. Acad. Sci. U.S.A. (2001) 98:9371-9376).
  • Two pharmacologically validated animal models of anxiety are the elevated zero maze test, and the isolation-induced ultrasonic emission test. The zero maze consists of an elevated annular platform with two open and two closed quadrants and is based on the conflict between an animal's instinct to explore its environment and its fear of open spaces (see, for example, Bickerdike, M. J. et al., Eur. J. Pharmacol., (994) 271, 403-411; Shepherd, J. K. et al., Psychopharmacology, (1994) 116, 56-64). Clinically used anxiolytic drugs, such as the benzodiazepines, increase the proportion of time spent in, and the number of entries made into, the open compartments.
  • A second test for an anti-anxiety compound is the ultrasonic vocalization emission model, which measures the number of stress-induced vocalizations emitted by rat pups removed from their nest (see, for example, Insel, T. R. et al., Pharmacol. Biochem. Behav., 24, 1263-1267 (1986); Miczek, K. A. et al., Psychopharmacology, 121, 38-56 (1995); Winslow, J. T. et al., Biol. Psychiatry, 15, 745-757 (1991).
  • The effect of the compounds provided herein in the treatment of depression can be tested in the model of chronic mild stress induced anhedonia in rats. This model is based on the observation that chronic mild stress causes a gradual decrease in sensitivity to rewards, for example consumption of sucrose, and that this decrease is dose-dependently reversed by chronic treatment with antidepressants. See, e.g., Willner, Paul, Psychopharmacology, 1997, 134, 319-329.
  • Another test for antidepressant activity is the forced swimming test (Nature 266, 730-732, 1977). In this test, animals are administered an agent 30 or 60 minutes before being placed in container of water, and the time during which they remain immobile is recorded. A decrease in the immobility time of the mice is indicative of antidepressant activity.
  • A similar test for antidepressant activity is the mouse caudal suspension test (Psychopharmacology, 85, 367-370, 1985). In this test, animals are administered an agent 30 or 60 minutes before being suspended by the tail, and their immobility time is recorded. A decrease in the immobility time of the mice is indicative of antidepressant activity.
  • Animal models are available for assessing anticonvulsant activity of test compounds (see, e.g., U.S. Pat. Nos. 6,309,406 and 6,326,156).
  • Inhibition of FAAH has been reported to induce sleep in test animals (see, e.g., U.S. Pat. No. 6,096,784). Methods for studying sleep inducing compounds are known in the art (see, e.g., U.S. Pat. Nos. 6,096,784 and 6,271,015). Compounds can be administered to a test animal (e.g., rat or mouse) or a human and the subsequent time (e.g., onset, duration) spent sleeping (e.g., eyes closed, motor quiescence) can be monitored. See also WO 98/24396.
  • Methods for screening FAAH inhibitors which induce catalepsy are also well known in the art (see, e.g., Quistand et al. in Toxicology and Applied Pharmacology 173: 48-55 (2001); Cravatt et al. Proc. Natl. Acad. Sci. U.S.A. 98:9371-9376 (2001)).
  • Methods of assessing appetitive behavior are known in the art (see, e.g., U.S. Pat. No. 6,344,474). One method of assessing the effect on appetite behavior is to administer a FAAH inhibitor to a rat and assess its effect on the intake of a sucrose solution (see, e.g., W. C. Lynch et al., Physiol. Behav., 1993, 54, 877-880).
  • Two pharmacologically validated animal models of neuropathic pain are the rat spinal nerve ligation model (Chung model) and a rat model of chemotherapy-induced neuropathic pain. After establishing neuropathy in these models, as a measure of mechanical allodynia, paw withdrawal thresholds were measured by stimulation with von Frey filaments (see, for example, Kim S H and Chung J M, Pain (1992) 50, 355-63; Nozaki-Taguchi N, et al., Pain (2001) 93, 69-76). Clinically used neuropathic pain drugs, such as the Gabapentin (Neurontin), increase the paw withdrawal threshold from stimulation with von Frey filaments.
  • Two pharmacologically validated animal models of inflammatory and mechanical pain are a joint compression model in rats treated with adjuvant or agents that produce joint degeneration. Treatment with clinically used anti-inflammatory agents such as naproxen increases the threshold of behavioral response to joint compression (see, for example, Wilson A W, et al., Eur. J. Pain (2006) 10, 537-49; Ivanavicius S A, et al., Pain (2007) 128, 272-282).
  • A pharmacologically validated animal models of cancer pain is mouse model where implantation in the calcaneus bone of fibrosarcoma cells produces paw hyperalgesia. Treatment with clinically used analgesics agents such as morphine increases the threshold of behavioral response to mechanical algesia (see, for example, Khasabova, et al., J. Neurscience (2008) 28, 11141-52).
  • EXEMPLIFICATION
  • The invention now being generally described, it will be more readily understood by reference to the following examples, which are included merely for purposes of illustration of certain aspects and embodiments of the present invention, and are not intended to limit the invention.
  • General Synthetic Methods
  • Figure US20150099738A1-20150409-C00160
  • General conditions for the preparation of 3-bromo-isoxazolines: Alkene (1.2 equiv) and potassium hydrogen carbonate (2.5 equiv) are suspended in ethyl acetate (0.40 M with respect to alkene). N,N-Dibromoformaldoxime (1.0 equiv) is added and the reaction was allowed to stir at 23° C. for 14-28 h. Upon completion as judged by thin layer chromatography analysis, the reaction was split between water and tert-butyl methyl ether, and the organic layer was washed with water and brine, dried over sodium sulfate, and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired 3-bromo-isoxazoline.
  • Figure US20150099738A1-20150409-C00161
  • General conditions for the preparation of 3-bromo-isoxazolines: A flask is charge with glyoxylic acid monohydrate (1.0 equiv) and hydroxylamine hydrochloride (1.1 equiv). The mixture was dissolved in water (2.0 M with respect to glyoxylic acid monohydrate) and stirred at 23° C. for 24 h. The mixture was diluted with water and extracted with ethyl acetate. The organic layer was dried over sodium sulfate and concentrated to provide the desired crude oxime which was used directly in subsequent cycloaddition. The resulting oxime (1.1 equiv) from the first step is suspended in a 3:1 mixture of dimethoxyethane:water (v/v) (0.15 M with respect to oxime) and cooled to 0° C. N-Bromosuccinamide (NBS) (2.0 equiv) was added and the reaction was allowed to stir at 23° C. for 20 min. The resulting mixture is then added to a solution of alkene (1.0 equiv) and potassium bicarbonate (2.5 equiv) in dimethoxyethane (1.50 M with respect to alkene) and the reaction is allowed to stir for 20 h at 23° C. Upon completion as judged by thin layer chromatography analysis, the reaction was split between water and tert-butyl methyl ether, and the organic layer was washed with brine, dried over sodium sulfate, and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired 3-bromo-isoxazoline.
  • Figure US20150099738A1-20150409-C00162
  • General conditions for the preparation of 3-aryloxy-isoxazolines or 3-heteroaryloxy-isoxazolines: A microwave reaction vial is charged with a given 3-bromo-isoxazoline (1.0 equiv) and an alcohol (e.g., a phenol or a hydroxypyridine) (3.0 equiv) and dissolved in N-methylpyrrolidine (0.50 M with respect to isoxazoline). Crushed sodium hydroxide (2.0 equiv) is added and the mixture was sealed and heated in a microwave reaction at 150° C. for 30 min. The reaction was then split between water and tert-butyl methyl ether, and the organic layer was washed with brine, dried over sodium sulfate, and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired isoxazoline.
  • Figure US20150099738A1-20150409-C00163
  • General conditions for the preparation of 3-aryloxy-isoxazolines or 3-heteroaryloxy-isoxazolines: A flask is charged with a given 3-bromo-isoxazoline (1.0 equiv) and the alcohol (e.g., a phenol or a hydroxypyridine) (2.0 equiv) and dissolved in N,N-dimethylforamide (0.4 M with respect to isoxazoline). Sodium hydride (2.0 equiv) is added and the reaction is allowed to stir for 10 min until all of the gas evolution ceases. The reaction is then heated to 150° C. for 1-5 h. After the reaction is determine to be complete by thin layer chromatography analysis, the reaction was then split between water and ethyl acetate, and the organic layer was washed with 1N NaOH and brine, and then dried over sodium sulfate, and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired isoxazoline.
  • Figure US20150099738A1-20150409-C00164
  • General conditions for the preparation of 3-aryloxy-isoxazolines: A flask is charged with a given 3-bromo-isoxazoline (1.0 equiv) and the alcohol (e.g., a phenol or a hydroxypyridine) (2.0 equiv) and dissolved in N,N-dimethylforamide or N-methylpyrrolidinone (0.15 M with respect to isoxazole). Cesium carbonate (1.2 to 3 equiv) is added and the reaction is heated to 120° C. in an oil bath for 1 h. The reaction was then split between water and tert-butyl methyl ether, and the organic layer was washed with brine, dried over sodium sulfate, and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (methanol/methylene chloride) to provide the desired isoxazoline.
  • Figure US20150099738A1-20150409-C00165
  • General conditions for the preparation of alkenes: under a nitrogen atmosphere, 0.25 M methyltriphenylphosphonium bromide (1.1 equiv) dissolved in tetrahydrofuran was cooled to 0° C. after which the mixture was treated drop wise with sodium hexamethyldisilazane (NaHMDS) in tetrahydrofuran (1.0 M, 1.2 equiv). After stirring an additional 30 min at 0° C., a given aldehyde or ketone is added and the reaction is allowed to warm slowly to 23° C. overnight. The mixture was quenched saturated ammonium chloride and concentrated to remove the tetrahydrofuran. The mixture was then diluted with water and extracted with ethyl acetate. The organic layer was washed with brine, dried over sodium sulfate and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired alkene.
  • Figure US20150099738A1-20150409-C00166
  • General conditions for the preparation of alkenes: under a nitrogen atmosphere, 0.15 M methyltriphenylphosphonium bromide (1.5 equiv) dissolved in tetrahydrofuran was cooled to −78° C. after which the mixture was treated drop wise with n-butyl lithium in hexanes (2.5 M, 1.5 equiv). After stirring an additional 1 h at −78° C., a given aldehyde or ketone is added and the reaction is allowed to warm slowly to 23° C. overnight. The mixture was quenched saturated ammonium chloride and concentrated to remove the tetrahydrofuran. The mixture was then diluted with water and extracted with ethyl acetate. The organic layer was washed with brine, dried over sodium sulfate and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired alkene.
  • Figure US20150099738A1-20150409-C00167
  • General conditions for the preparation of alkenes: under a nitrogen atmosphere, 0.12 M methyltriphenylphosphonium bromide (2.5 equiv) was dissolved in tetrahydrofuran after which potassium tert-butoxide (4.0 equiv) was added in six portions. After stirring an additional 1 h at 23° C., a given aldehyde or ketone is added and the reaction was heated to 55° C. for 2 h. The mixture was quenched saturated ammonium chloride and concentrated to remove the tetrahydrofuran. The mixture was then acidified to pH 5-6 with 1N HCl and extracted with methylene chloride. The organic layer was washed with brine and then dried over sodium sulfate and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired alkene.
  • Figure US20150099738A1-20150409-C00168
  • General conditions for the preparation of styrenes: a dry flask under argon atmosphere was charged with aryl bromide (1.0 equiv), potassium vinyltrifluoroborate (1.2 equiv), 1,1″-bis(diphenylphosphino)-ferrocenedichloropalladium(II) methylene chloride adduct (0.02 equiv) and triethylamine (1.0 equiv) and the mixture was suspended in isopropanol (0.25 M with respect to aryl bromide) and heated at 80° C. for 2-24 h. The mixture was then diluted with water and extracted with diethyl ether. The organic layer was washed with brine and then dried over magnesium sulfate and concentrated in vacuo. The concentrated reaction mixture was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired styrene.
  • Figure US20150099738A1-20150409-C00169
  • General conditions for the preparation of styrenes: a dry flask under a nitrogen atmosphere was charged with aryl bromide (1.0 equiv), tributylvinyltin (1.1 equiv) and dissolved in toluene (0.3 M with respect to bromide). The resulting mixture was further purged with nitrogen for 10 min after which tetrakis(triphenyphosphine)palladium (0.1 equiv) was added and the reaction was refluxed for 1.5 h. After the reaction was determined to be complete by TLC analysis, it was allowed to cool and loaded directly onto a silica gel column where it was purified by flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired styrene.
  • Figure US20150099738A1-20150409-C00170
  • General conditions for the hydrolysis of pyridyl and pyrimidinyl boronic acids to their corresponding phenols: A flask is charged with a given boronic acid or ester thereof (1.0 equiv) and dissolved in tetrahydrofuran (1.1 M, 10 volumes). Sodium perborate (1.0 equiv) is dissolved in water (1.1 M with respect to boronic acid, 10 volumes) and sonicated for 10 min. The perborate suspension is then added to the THF solution using tetrahydrofuran (1.6 volumes) to rinse the remaining solid perborate into the reaction mixture. The reaction is allowed to stir at room temperature (reaction is mildly exothermic) after which ammonium chloride is added in three portions (10 equiv) and the reaction cooled back down to room temperature. After 40 min, the reaction was concentrated under vacuum until all of the tetrahydrofuran was removed. The resulting solid was collected by vacuum filtration, washed with excess waster and dried in a vacuum oven for 40° C. for 3d to provide the desired phenol in 80% yield.
  • Chiral HPLC Method
  • Enantiomeric or diastereomeric mixtures of compounds can be separated using known methods, including chiral high pressure liquid chromatography (HPLC) and chiral supercritical fluid chromatography (SFC). Exemplary chiral columns found useful in separating such mixtures of compounds of the present invention include, but are not limited to, ChiralPak® AD-H, ChiralPak® OD-H, ChiralPak® AY, RegisPack™, and S,S WhelkO®-1 and LUX™ Cellulose2 columns. One or more of these columns were used to separate enantiomeric mixtures of compounds of the present invention in order to obtain substantially enantiomerically pure compounds.
  • Synthesis of Exemplary Compounds of Formula I
  • Syntheses of exemplary compounds are set forth below. Compounds were assayed as inhibitors of human FAAH using the method described in detail in Example 67. Activity designated as “A” refers to compounds having a Ki of less than or equal to 100 nM, “B” refers to compounds having a Ki of between 100 nM and 1 microM, and “C” refers to compounds having a Ki of greater than or equal to 1 microM.
  • Example 1
  • Figure US20150099738A1-20150409-C00171
  • 3-Bromo-4,5-dihydroisoxazole III-1 was prepared in 1 step from methylenecyclohexane using Method 1. [M−H]−=217.0 m/z. Activity: A.
  • Example 2
  • Figure US20150099738A1-20150409-C00172
  • 3-bromo-4,5-dihydroisoxazole III-2a and III-2b were prepared in 2 steps starting with alkene formation from 4-tert-butylcyclohexanone using Method 6 followed by cycloaddition using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=273.1 m/z. Activity: B
  • Example 3
  • Figure US20150099738A1-20150409-C00173
  • 3-bromo-4,5-dihydroisoxazole III-3a and III-3b was prepared in 2 steps starting with alkene formation from 4-phenylcyclohexanone using Method 6 followed by cycloaddition using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=293.0 m/z. Activity: A.
  • Example 4
  • Figure US20150099738A1-20150409-C00174
  • 3-Brom-4,5-dihydroisoxazole III-4 was prepared in 2 steps starting with alkene formation from 1,4-dioxaspiro[4.5]decan-8-one using Method 6 followed by cycloaddition using Method 1. [M−H]−=275.0 m/z. Activity: C.
  • Example 5
  • Figure US20150099738A1-20150409-C00175
  • 4-Methylenecyclohexanecarboxylic acid ethyl ester is prepared from the Wittig reaction on ethyl 4-oxocyclohexanecarboxylate using Method 3. This ester is reduced to compound III-5 according to the following procedure: To a solution of lithium aluminum hydride (4.0 equiv) in diethyl ether (1.0 M with respect to hydride) is added ethyl 4-oxocyclohexanecarboxylate in diethyl ether (2.0 M with respect to ester). The reaction is heated to reflux for 2 h after which it is cooled in an ice bath and quenched with by subsequent additions of isopropanol, 50% NaOH in water, and water. The mixture is then filtered and the filter cake is washed with excess diethyl ether. The filtrate is then washed with water and brine, dried over sodium sulfate, and concentrated in vacuo to provide a clear oil that is used without further purification.
  • Compound III-5 (1.0 equiv) is then dissolved in pyridine (0.90 M with respect to the alcohol). p-Toluenesulfonyl chloride (1.1 equiv) is added and the reaction is allowed to stir for 16 h after which it was quenched with a few drops of water, diluted with excess methylene chloride and washed with water, dilute HCl and brine. The organic layer is then dried over sodium sulfate and concentrated in vacuo to provide a off-white solid which was used directly without further purification.
  • Phenol (1.2 equiv) is then dissolved in N,N-dimethylforamide (0.20 M with respect to tosylate). Cesium carbonate (1.3 equiv) is added followed by compound III-6 (1.0 equiv) and TBAI (0.10 equiv). The reaction is heated to 40° C. for 19 h after which point it was diluted with tert-butylmethyl ether and washed with dilute NaOH, water and brine and then dried over sodium sulfate. Concentration under vacuum provides compound III-7 as a clear oil which is used without further purification.
  • Figure US20150099738A1-20150409-C00176
  • The crude alkene was directly converted to the desired diastereomers 3-bromo-4,5-dihydroisoxazole III-8a and III-8b in 1 step using Method 2. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=323.6 m/z. Activity: A
  • Example 6
  • Figure US20150099738A1-20150409-C00177
  • 3-Brom-4,5-dihydroisoxazole III-9 was prepared in 2 steps starting with alkene formation from 1-(tert-butoxycarbonyl)-4-piperidone using Method 7 followed by cycloaddition using Method 1 or Method 2. [M−H]−=318.1 m/z. Activity: A.
  • Example 7
  • Figure US20150099738A1-20150409-C00178
  • 3-bromo-4,5-dihydroisoxazole III-10a and III-10b was prepared in 2 steps starting with alkene formation from 1-(tert-butoxycarbonyl)-3-piperidone using Method 7 followed by cycloaddition using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=318.1 m/z. Activity: C
  • Example 8
  • Figure US20150099738A1-20150409-C00179
  • 3-bromo-4,5-dihydroisoxazole III-11a and III-11b were prepared in 2 steps starting with alkene formation from N-(tert-butoxycarbonyl)-3-pyrrolidinone using Method 7 followed by cycloaddition using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=304.7 m/z. Activity: B
  • Example 9
  • Figure US20150099738A1-20150409-C00180
  • 3-bromo-4,5-dihydroisoxazole III-12a and III-12b were prepared in 2 steps starting with alkene formation from 1-(tert-butoxycarbonyl)-4-oxoazepane using Method 7 followed by cycloaddition using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=332.1 m/z. Activity: A
  • Example 10
  • Figure US20150099738A1-20150409-C00181
  • 3-bromo-4,5-dihydroisoxazole III-13a and III-13b were prepared in 2 steps starting with alkene formation from N-(tert-butoxycarbonyl)-nortropinone using Method 7 followed by cycloaddition using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=344.1 m/z. Activity: C
  • Example 11
  • Figure US20150099738A1-20150409-C00182
  • 3-Bromo-4,5-dihydroisoxazole III-9 was dissolved in trifluoroacetic acid (0.20 M with respect to isoxazole) and stirred at room temperature for 1 h. The solvent is then removed under vacuum and the crude residue is azeotroped with toluene (2×) to provide III-14 as the TFA salt (white solid). [M−H]−=218.0 m/z. Activity: C.
  • Example 12
  • Figure US20150099738A1-20150409-C00183
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.03 M with respect to isxozaole) after which triethylamine (4.0 equiv) and acetic anhydride (3.0 equiv are added). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute HCl, dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide acetate III-15 as a white solid. [M−H]−=260.0 m/z. Activity: C.
  • Example 13
  • Figure US20150099738A1-20150409-C00184
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.05 M with respect to isxozaole) after which triethylamine (4.0 equiv) and benzoyl chloride (1.25 equiv are added). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute HCl, dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide acetate III-16 as a white film. [M−H]−=332.0 m/z. Activity: A.
  • Example 14
  • Figure US20150099738A1-20150409-C00185
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.05 M with respect to isxozaole) after which triethylamine (4.0 equiv) and benzenesulfonyl chloride (1.25 equiv are added). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute HCl, dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide sulfonamide III-17 as a white solid. [M−H]−=358.0 m/z. Activity: B.
  • Example 15
  • Figure US20150099738A1-20150409-C00186
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.05 M with respect to isxozaole) after which triethylamine (4.0 equiv) and benzyl chloroformate (1.25 equiv are added). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute HCl, dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide carbamate III-18 as a white solid. [M−H]−=352.0 m/z. Activity: A.
  • Example 16
  • Figure US20150099738A1-20150409-C00187
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.06 M with respect to isxozaole) after which triethylamine (2.5 equiv) and benzaldehyde (1.25 equiv) are added followed by sodium triacetoxyborohydride (1.5 equiv). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide N-benzylpiperidine III-19 as a white solid. [M−H]−=308.1 m/z. Activity: A.
  • Example 17
  • Figure US20150099738A1-20150409-C00188
  • 3-Bromo-4,5-dihydroisoxazole III-20 was prepared in using the analogous procedure as Example 16 except that 4-chlorobenzaldehyde was used in the place of benzaldehyde. [M+H]+=342.6 m/z. Activity: A.
  • Example 18
  • Figure US20150099738A1-20150409-C00189
  • 3-Bromo-4,5-dihydroisoxazole III-21 was prepared in using the analogous procedure as Example 16 except that 4-methoxybenzaldehyde was used in the place of benzaldehyde. [M+H]+=338.7 m/z. Activity: A.
  • Example 19
  • Figure US20150099738A1-20150409-C00190
  • 3-Bromo-4,5-dihydroisoxazole III-22 was prepared in using the analogous procedure as Example 16 except that 2-pyridinecarboxaldehyde was used in the place of benzaldehyde. [M+H]+=312.1 m/z. Activity: B.
  • Example 20
  • Figure US20150099738A1-20150409-C00191
  • 3-Bromo-4,5-dihydroisoxazole III-23 was prepared in using the analogous procedure as Example 16 except that 3-pyridinecarboxaldehyde was used in the place of benzaldehyde. [M+H]+=312.4 m/z. Activity: B.
  • Example 21
  • Figure US20150099738A1-20150409-C00192
  • 3-Bromo-4,5-dihydroisoxazole III-24 was prepared in using the analogous procedure as Example 16 except that 4-methylbenzaldehyde was used in the place of benzaldehyde. [M+H]+=322.5 m/z. Activity: A.
  • Example 22
  • Figure US20150099738A1-20150409-C00193
  • 3-Bromo-4,5-dihydroisoxazole III-25 was prepared in using the analogous procedure as Example 16 except that 3,4-dichlorobenzaldehyde was used in the place of benzaldehyde. [M+H]+=378.6 m/z. Activity: A.
  • Example 23
  • Figure US20150099738A1-20150409-C00194
  • Bromo-4,5-dihydroisoxazole III-26 was prepared in using the analogous procedure as Example 16 except that 4-trifluoromethylbenzaldehyde was used in the place of benzaldehyde. [M+H]+=376.6 m/z. Activity: A.
  • Example 24
  • Figure US20150099738A1-20150409-C00195
  • 3-Bromo-4,5-dihydroisoxazole III-27 was prepared in using the analogous procedure as Example 16 except that 3-chlorobenzaldehyde was used in the place of benzaldehyde. [M+H]+=342.6 m/z. Activity: A.
  • Example 25
  • Figure US20150099738A1-20150409-C00196
  • 3-Bromo-4,5-dihydroisoxazole III-28 was prepared in using the analogous procedure as Example 16 except that hydrocinnamaldehyde was used in the place of benzaldehyde. [M+H]+=336.7 m/z. Activity: A.
  • Example 26
  • Figure US20150099738A1-20150409-C00197
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in N,N-dimethylforamide (0.05 M with respect to isoxazole) after which potassium carbonate (3.0 equiv) was added followed by potassium iodide (0.2 equiv) and 2-bromoethylbenzene (3.0 equiv). The reaction was heated to 70° C. in an oil bath for 16 h after which point it was purified directly using flash silica gel chromatography (ethyl acetate/hexanes) to provide amine III-29 as an oil. [M+H]+=324.6 m/z. Activity: A.
  • Example 27
  • Figure US20150099738A1-20150409-C00198
  • 3-Bromo-4,5-dihydroisoxazole III-30 was prepared in using the analogous procedure as Example 6 except that 1-phenyl-4-piperidone was used in the place of 1-(tert-butoxycarbonyl)-4-piperidone. [M+H]+=297.0 m/z. Activity: B.
  • Example 28
  • Figure US20150099738A1-20150409-C00199
  • 3-Bromo-4,5-dihydroisoxazole III-30 is dissolved in chloroform (0.01 M with respect to isoxazole) after which bromine (1.0 equiv) is added. The reaction is allowed to stir for 16 h after which point is diluted with water and washed with saturated Na2CO3. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide III-31 as a yellow solid. [M+H]+=377.0 m/z. Activity: B.
  • Example 29
  • Figure US20150099738A1-20150409-C00200
  • 3-Bromo-4,5-dihydroisoxazole III-32 was prepared in using the analogous procedure as Example 16 except that cyclohexanecarboxaldehyde was used in the place of benzaldehyde. [M+H]+=390.5 m/z. Activity: A.
  • Example 30
  • Figure US20150099738A1-20150409-C00201
  • 3-Bromo-4,5-dihydroisoxazole III-33 was prepared in using the analogous procedure as Example 16 except that pivaldehyde was used in the place of benzaldehyde. [M+H]+=290.5 m/z. Activity: B.
  • Example 31
  • Figure US20150099738A1-20150409-C00202
  • 3-Bromo-4,5-dihydroisoxazole III-34 was prepared in using the analogous procedure as Example 13 except that hydrocinnamaldehyde was used in the place of benzoyl chloride. [M+H]+=352.8 m/z. Activity: A.
  • Example 32
  • Figure US20150099738A1-20150409-C00203
  • 3-Bromo-4,5-dihydroisoxazole III-35 was prepared in using the analogous procedure as Example 15 except that methyl chloroformate was used in the place of benzyl chloroformate. [M+H]+=378.8 m/z. Activity: B.
  • Example 33
  • Figure US20150099738A1-20150409-C00204
  • 3-Bromo-4,5-dihydroisoxazole III-36 was prepared in using the analogous procedure as Example 15 except that iso-butyl chloroformate was used in the place of benzyl chloroformate. [M+H]+=318.7 m/z. Activity: A.
  • Example 34
  • Figure US20150099738A1-20150409-C00205
  • 3-Bromo-4,5-dihydroisoxazole III-37 was prepared in using the analogous procedure as Example 15 except that phenyl chloroformate was used in the place of benzyl chloroformate. [M+H]+=340.7 m/z. Activity: A.
  • Example 35
  • Figure US20150099738A1-20150409-C00206
  • 3-Bromo-4,5-dihydroisoxazole III-38 was prepared in using the analogous procedure as Example 15 except that 2,2,2-trichloroethyl chloroformate was used in the place of benzyl chloroformate. [M+H]+=394.5 m/z. Activity: B.
  • Example 36
  • Figure US20150099738A1-20150409-C00207
  • 3-Bromo-4,5-dihydroisoxazole III-14 is dissolved in methylene chloride (0.05 M with respect to isoxazole) after which triethylamine (5.0 equiv) and carbonyl diimidazole (1.25 equiv) are added. The reaction is allowed to stir for 2 h after which point anisyl alcohol (2.5 equiv) was added followed by catalytic tetrabutylammonium hydrogensulfate and 50% aqueous sodium hydroxide (0.10 M with respect to isoxazole). The heterogeneous mixture is allowed to stir for 16 h after which point it was diluted with ethyl acetate. The water layer was washed two additional times with ethyl acetate after which the organic layers were combined, dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide carbamate III-39 as a white solid. [M+H]+=382.9 m/z. Activity: A.
  • Example 7
  • Figure US20150099738A1-20150409-C00208
  • 3-Brom-4,5-dihydroisoxazole III-40 was prepared in using the analogous procedure as Example 36 except that 4-chlorobenzyl alcohol was used in the place of anisyl alcohol. [M+H]+=388.8 m/z. Activity: A.
  • Example 38
  • Figure US20150099738A1-20150409-C00209
  • 3-bromo-4,5-dihydroisoxazole III-41a and III-41b were prepared in using the analogous procedure as Example 36 except that racemic sec-phenethyl alcohol was used in the place of anisyl alcohol. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=368.8 m/z. Activity: A
  • Example 39
  • Figure US20150099738A1-20150409-C00210
  • 3-Cylopentene-1-ol (1.0 equiv) is dissolved in N,N-dimethylformide (0.80 M with respect to the alcohol) and treated with TBAI (0.10 equiv) followed by crushed sodium hydroxide (2.0 equiv). Benzyl bromide (1.2 equiv) is then added and the reaction is allowed to stir for 48 h at room temperature. The reaction is then diluted with tert-butyl methyl ether and washed with dilute Na2S2O3 and brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide the desired cycloalkene as a colorless oil. This compound was then converted to the desired 3-bromo-4,5-dihydroisoxazole III-42 using the cycloaddition procedures outlined in Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=295.0 m/z. Activity: B.
  • Example 40
  • Figure US20150099738A1-20150409-C00211
  • 3-bromo-4,5-dihydroisoxazole III-43a and III-43b were prepared in 1 step from N-(tert-butoxycarbonyl)-2,5-dihydro-1H-pyrrole using Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M−H]−=290.0 m/z. Activity: B.
  • Example 41
  • Figure US20150099738A1-20150409-C00212
  • Racemic 3-bromo-4,5-dihydroisoxazole III-43 was dissolved in trifluoroacetic acid (0.20 M with respect to isoxazole) and stirred at room temperature for 1 h. The solvent is then removed under vacuum and the crude residue is azeotroped with toluene (2×) to provide a the trifluoroacetic acid salt as a white solid which was dissolved in methylene chloride (0.05 M with respect to isozaole) after which triethylamine (4.0 equiv) and benzyl chloroformate (1.25 equiv are added). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute HCl, dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide carbamate III-44 as a white solid. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=324.6 m/z. Activity: A
  • Example 42
  • Figure US20150099738A1-20150409-C00213
  • Racemic 3-bromo-4,5-dihydroisoxazole III-43 was dissolved in trifluoroacetic acid (0.20 M with respect to isoxazole) and stirred at room temperature for 1 h. The solvent is then removed under vacuum and the crude residue is azeotroped with toluene (2×) to provide a the trifluoroacetic acid salt as a white solid which is then is dissolved in methylene chloride (0.06 M with respect to isoxozaole) after which triethylamine (2.5 equiv) and 4-chlorobenzaldehyde (1.25 equiv) are added followed by sodium triacetoxyborohydride (1.5 equiv). The reaction is allowed to stir for 16 h after which point is diluted with ethyl acetate and washed with dilute NaOH and then brine. The organic layer is then dried over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (ethyl acetate/hexanes) to provide N-benzylpiperidine III-45 as a white solid. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=316.6 m/z. Activity: C
  • Example 43
  • Figure US20150099738A1-20150409-C00214
  • 3-(Pyridin-3-yloxy)-4,5-dihydroisoxazole III-46 was prepared in 1 step from compound III-18 and 3-hydroxypyridine using Method 5. [M+H]+=369.4 m/z. Activity: A
  • Example 44
  • Figure US20150099738A1-20150409-C00215
  • 3-Chloro-4,5-dihydroisoxazole III-47 was prepared in 2 steps starting with alkene formation from 1-(tert-butoxycarbonyl)-4-piperidone using Method 6 followed by cycloaddition using Method 2 except that N-chlorosuccinamide was used in place of N-bromosuccinamide. [M+H]+=274.9 m/z. Activity: A
  • Example 45
  • Figure US20150099738A1-20150409-C00216
  • 3-Chloro-4,5-dihydroisoxazole III-48 was prepared in using the analogous procedure as Example 17 except that 3-chloro-4,5-dihydroisoxazole III-47 was used in the place of 3-bromo-4,5-dihydroisoxazole III-9. [M+H]+=298.6 m/z. Activity: A
  • Example 46
  • Figure US20150099738A1-20150409-C00217
  • 3-Bromo-4,5-dihydroisoxazole III-49 was prepared in using the analogous procedure as Example 16 except that 4-ethynylcarboxaldehyde was used in the place of benzaldehyde. [M+H]+=335.1 m/z. Activity: A
  • Example 47
  • Figure US20150099738A1-20150409-C00218
  • 3-(Pyridin-3-yloxy)-4,5-dihydroisoxazole III-50 was prepared in 1 step from compound III-49 and 3-hydroxypyridine using Method 5. [M+H]+=348.6 m/z. Activity: A
  • Example 48
  • Figure US20150099738A1-20150409-C00219
  • 3-(Pyridin-3-yloxy)-4,5-dihydroisoxazole III-51 was prepared in 1 step from compound III-20 and 3-hydroxypyridine using Method 5. [M−H]−=358.1 m/z. Activity: A
  • Example 49
  • Figure US20150099738A1-20150409-C00220
  • 3-(Pyrimidin-5-yloxy)-4,5-dihydroisoxazole III-52 was prepared in 1 step from compound III-20 and 5-hydroxypyrimidine using Method 5. [M+H]+=360.2 m/z. Activity: A
  • Example 50
  • Figure US20150099738A1-20150409-C00221
  • 3-(Pyrimidin-5-yloxy)-4,5-dihydroisoxazole III-54 was prepared in 3 steps from compound III-9 starting with the synthesis of 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-53 from compound III-9 and 5-hydroxypyrimidine using Method 5. Compound III-53 is then deprotected using analogous conditions to Example 11 and then converted to desired product III-54 using the analogous procedure as Example 13 except that hydrocinnamaldehyde was used in the place of benzoyl chloride. [M+H]+=367.6 m/z. Activity: B
  • Example 51
  • Figure US20150099738A1-20150409-C00222
  • 3-(Pyrimidin-5-yloxy)-4,5-dihydroisoxazole III-55 was prepared in 3 steps from compound III-9 using the analogous procedure as Example 50 except that 4-chlorobenzoyl chloride was used in the place of hydrocinnamaldehyde. [M−H]−=372.9 m/z. Activity: A
  • Example 52
  • Figure US20150099738A1-20150409-C00223
  • 3-(Pyrimidin-5-yloxy-4,5-dihydroisoxazole III-56 was synthesized two steps from compound III-53 starting with deprotection using analogous conditions to Example 11. The resulting trifluoroacetic acid salt (1.0 equiv) is then dissolved in methylene chloride (0.11 M with respect to isoxazole) after which phenyl isocyanate (1.5 equiv) is added followed by pyridine (5.0 equiv). The reaction is allowed to stir overnight at room temperature after which point the reaction was transferred to a separatory funnel with excess water and methylene chloride. The organic layer was washed with saturate sodium bicarbonate (2×), dried over magnesium sulfate, and concentrated to provide a white solid which was purified by flash silica gel chromatography (gradient of ethyl acetate/methanol). [M+H]+=353.6 m/z. Activity: C
  • Example 53
  • Figure US20150099738A1-20150409-C00224
  • 3-(Pyridin-3-yloxy)-4,5-dihydroisoxazole III-57 was synthesized in two steps from compound III-53 starting with deprotection using analogous conditions to Example 11. The resulting trifluoroacetic acid salt (1.0 equiv) is then dissolved in methylene chloride (0.11 M with respect to isoxazole after which 5,5,5-trifluoropentanoic acid (1.5 equiv), EDC (1.5 equiv) and triethylamine (3.0 equiv) are added. The reaction is allowed to stir for 14 h at room temperature after which point the reaction was transferred to a separatory funnel with excess water and methylene chloride. The organic layer was washed with saturate sodium bicarbonate (2×), dried over magnesium sulfate, and concentrated to provide a white solid which was purified by flash silica gel chromatography (gradient of ethyl acetate/methanol). [M+H]+=373.7 m/z. Activity: C
  • Example 54
  • Figure US20150099738A1-20150409-C00225
  • 3-(Pyridin-3-yloxy)-4,5-dihydroisoxazole III-58 was prepared in 3 steps from compound III-16 according to the following procedures: 6-(methylthio)pyridin-3-ol is prepared from 6-(methylthio)pyridin-3-ylboronic acid using Method 11. 3-Bromo-4,5-dihydroixoazole III-16 was then reacted with 6-(methylthio)pyridin-3-ol using Method 5. The resulting 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole was dissolved in methylene chloride (0.5 M with respect to isoxazole) after which point m-chloroperbenzoic acid (2.0 equiv) was added in 1 portion and the reaction was allowed to stir at room temperature for 1 h. After the reaction was determined to be complete by LC/MS, the reaction was transferred to a separatory funnel with excess water and methylene chloride. The organic layer was washed with saturate sodium bicarbonate (2×), and 1N NaOH (1×), dried over magnesium sulfate, and concentrated to provide a white solid which was purified by flash silica gel chromatography (gradient of ethyl acetate/methanol). [M+H]+=415.8 m/z. Activity: B
  • Example 55
  • Figure US20150099738A1-20150409-C00226
  • 3-(Pyrrolidin-1-yl-4,5-dihydroisoxazole III-59 was prepared in 1 step according to the following procedure: 3-bromo-4,5-dihydmrisoxazole III-18 (1.0 equiv) was dissolved in n-butanol (0.64 M) followed by the addition of pyrollidine (1.2 equiv) and sodium carbonate (2.5 equiv). The reaction is the sealed and heated in an oil bath to 120° C. for 18 h after which it allowed to cool and then transferred to a separatory funnel with excess water and tert-butylmethyl ether. The aqueous layer was washed with tert-butylmethyl ether (2×) and the combined organic layers were washed with brine, dried over magnesium sulfate and concentrate to provide a orange solid that was purified using flash silica gel chromatography (gradient ethyl acetate/hexanes) to provide III-59 as a white solid. [M+H]+=345.4 m/z. Activity: C
  • Example 56
  • Figure US20150099738A1-20150409-C00227
  • 1-(4,5-Dihydroisoxazol-3-yl)-1-methylpyrrolidinium iodide III-60 was synthesized according to the following procedure: 3-(pyrrolidin-1-yl)-4,5-dihydroisoxazole III-59 was dissolved in methanol (0.044 M) followed by the addition of methyl iodide (0.022 M). The reaction was allowed to sit for 72 h after which it was concentrated and purified using high pressure liquid chromatography (0.1% formic acid). The desired fractions were lyophilized to provide the desired product plus some impurities which were removed by washing the solid with hexanes. Activity: C
  • Example 57
  • Figure US20150099738A1-20150409-C00228
  • 3-bromo-4,5-dihydroisoxazole III-62a and III-62b were synthesized in three steps according to the following procedures: phenyl boronic acid (2.0 equiv) is suspended in toluene (0.23 M with respect to boronic acid) and heated until a solution results. The solvent is Page 140 of 172 Attorney Docket No.: 2008074-0117 evaporated and this process is repeated. The resulting anhydride is then redissolved in methylene chloride (0.23 M). 6-Hydroxy-3,4-dihydronaphthalen-1(2H)-one (1.0 equiv), triethylamine (5.0 equiv) and copper acetate (0.95 equiv) are added and the reaction is sealed and stirred for 16 h at room temperature. The mixture is then transferred to a separatory funnel with excess methylene chloride and water. The organic layer is then washed with water, dilute sodium hydroxide, and brine. The organic layer is dried with sodium sulfate, and concentrated to provide III-61 as a brown oil which is converted directly to racemic 3-bromo-4,5-dihydroisoxazole II-62 using Method 5 followed by Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=359.5 m/z. Activity: A
  • Example 58
  • Figure US20150099738A1-20150409-C00229
  • 3-bromo-4,5-dihydroisoxazole III-63a and III-63b was prepared using the analogous procedure as Example 57 except that 5-hydroxy-2,3-dihydro-1H-inden-1-one was used in place of 6-hydroxy-3,4-dihydronaphthalen-1(2H)-one as the starting material in the first step. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=343.7 m/z. Activity: A
  • Example 59
  • Figure US20150099738A1-20150409-C00230
  • 3-(pyrimidin-5-yloxy)-4,5-dihydroisoxazole III-60a and III-60b were prepared in 1 step from racemic compound II-63 and 5-hydroxypyrimidine using Method 5. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=361.2 m/z. Activity: A
  • Example 60
  • Figure US20150099738A1-20150409-C00231
  • 3-bromo-4,5-dihydroisoxazole III-66a and III-66b were synthesized in four steps according to the following procedures: A 250 mL round bottom flask with 10/30 thermometer port is fitted with a stir bar, analog thermometer, and Allihn condenser. 3-(3-(Trifluoromethoxy)phenyl)propanoic acid (0.22 mol, 1.0 equiv) is added, dissolved in thionyl chloride (6.0 equiv), and refluxed in an oil bath during 1 h during which time the internal temp 78-82° C. across the hour. At this time, the condenser is replaced with a short-path head and the thermometer with an inlet for a stream of dry argon, and the volatiles removed by distillation. When distillation is complete, cyclohexane (100 mL) is added to the pot and is distilled out in the same manner to provide the desired acid chloride in quantitative yield as a brown oil that is used directly. A 2 L 3-necked round bottom flask is then fitted with a mechanical stirrer, thermocouple probe, and a 250-mL pressure-equalized dropping funnel. It is charged with aluminum trichloride (0.233 mol, 1.08 equiv) and methylene chloride (0.24 M), then stirred 45 min to dissolve as much as possible. The reaction is then chilled in an ice bath to an internal temp of <2.5° C. A solution of acid chloride (1.0 equiv, 0.215 mol) in 200 ml methylene chloride is added via an addition funnel over 15 min. After the addition is complete, the ice is removed from the bath and replaced with room-temperature water (bath temperature at 18° C.) and the reaction allowed to proceed for 2 h more, at which point the reaction is indicated to be complete by TLC and LC/MS analysis. The reaction mixture is then treated with ice (500 g, and then water (600 mL) after which the mixture stirred for 1 h until all solids have dissolved. The layers are separated and the water layer is extracted with diethyl ether (350 mL). The combined organics are washed with water (250 mL, 1×), half-saturated sodium bicarbonate (250 mL, 1×), brine (250 mL, 1×), dried over magnesium sulfate and concentrated to provide 5-(trifluoromethoxy)-2,3-dihydro-1H-inden-1-one III-65 as a pink solid in quantitative yield. This material is then is converted directly to racemic 3-bromo-4,5-dihydroisoxazole III-66 using Method 5 followed by Method 1. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=335.6 m/z. Activity: A
  • Example 61
  • Figure US20150099738A1-20150409-C00232
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-67a and III-67b were prepared in 2 step from racemic compound II-66 and 6-(methylthio)pyridin-3-ol using Method 5 after 6-(methylthio)pyridin-3-ol is first prepared from 6-(methylthio)pyridin-3-ylboronic acid using Method 11. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=396.7 m/z. Activity: A
  • Example 62
  • Figure US20150099738A1-20150409-C00233
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-68a and III-68b were prepared in 1 step from racemic compound II-67 using analogous oxidation conditions as in Example 54. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=429.4 m/z. Activity: A
  • Example 63
  • Figure US20150099738A1-20150409-C00234
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-70a and III-70b were prepared in 2 steps according to the following procedures: 6-bromopyridin-3-ol (1.0 equiv) and sodium carbonate (10.0 equiv) are added to a microwave vial. Toluene, ethanol, and water (0.16 M, 2:2:1 v/v) are added followed by 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (1.5 equiv). The mixture is purged with argon for 15 min followed by the addition of palladium tetrakis (4 mol %). The reaction tube is then covered with aluminum foil and heated to 80° C. in an oil bath for 17 h. After cooling the reaction was transferred to a separatory funnel with excess water and ethyl acetate. The organic layer was then washed with water (1×), saturated ammonium chloride (1×) and brine (1×). The aqueous layers were combined and washed with ethyl acetate (1×). The organic layers were then combined, dried over sodium sulfate, concentrated and purified using flash silica gel chromatography (gradient methanol/methylene chloride) to provide 6-(1-methyl-1H-pyrazol-4-yl)pyridin-3-ol III-69 as a white solid. This compound is then reacted with racemic 3-bromo-4,5-dihydroisoxazole III-66 using Method 5 to provide the desired racemic compound III-70. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=430.0 m/z. Activity: A
  • Example 64
  • Figure US20150099738A1-20150409-C00235
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-71a and III-71b were prepared using the analogous procedure as Example 63 except that 1-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole was used in place of 1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole as the boronoate in the first step. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=430.0 m/z. Activity: A
  • Example 65
  • Figure US20150099738A1-20150409-C00236
  • 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-73a and III-73b were prepared in 3 steps according to the following procedures: 5-hydroxynicotinic acid methyl ester is reacted with (1.0 equiv) is dissolved in methanol (0.08 M) after which hydrazine (50 equiv, 50% by weight in water) is added and the reaction is allowed to stir for 14 h. The reaction mixture is then concentrated under vacuum and used directly in the next step. Triethylorthoformate (8.0 equiv) is added and the reaction is sealed and heated to reflux for 14 h. The reaction is then transferred to a separatory funnel with excess ethyl acetate and water. The organic layer was washed water and brine, drive over sodium sulfate and concentrated under vacuum to provide crude material which was purified using flash silica gel chromatography (gradient methanol/methylene chloride. to provide the desired oxadiazole III-72. This compound is then reacted with racemic 3-bromo-4,5-dihydroisoxazole III-66 using Method 5 to provide the desired racemic compound III-73. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=419.5 m/z. Activity: A
  • Example 66
  • Figure US20150099738A1-20150409-C00237
  • The enantiomers of 3-(pyridin-3-yloxy)-4,5-dihydroisoxazole III-74a and III-74b were prepared in 2 steps according to the following procedures: racemic 3-bromo 4,5-dihydroisoxazole III-66 was reacted with 5-hydroxynicotinic acid methyl ester using Method 5. The resulting ester (1.0 equiv) was dissolved in 1:1 tetrahydrofuran/water (0.06 M) and lithium hydroxide (8.0 equiv) was added. The reaction was allowed to stir at room temperature for 1 h after which point the tetrahydrofuran was removed under a stream of nitrogen and the remaining solution was acidified to pH<2 with 1N HCl to provide the racemic desired acid III-74 as a white solid which was isolated via vacuum filtration. These compounds can be separated using chiral HPLC methods known in the art. For example, see chiral HPLC Method disclosed herein. [M+H]+=395.5 m/z. Activity: A
  • Example 67 Inhibition of Human FAAH
  • Human FAAH Preparation: COS-7 cells were split the day before, 1:5 into 150 mm×25 mm cell culture dishes (Corning Inc., Cat. No. 430599). Transient transfection took place at 30-40% confluency according to FuGENE 6 Transfection Reagent (Roche, Cat. No. 11814 443 001).
  • Transfection Procedure: The FuGENE transfection 6 reagent (45 uL) was added to 1410 μL of media (DMEM, serum free without pen/strep) in a 15 mL conical tube and incubated at room temp for 5 minutes, followed by the addition of FAAH plasmid DNA (15 μg) (OriGene Cat. No. TC119221, Genbank Accession No. NM001441.1, 0.67 ug/uL) and a further incubation of 15 minutes at room temperature. The resulting solution was added into one dish of 30-40% confluent COS-7 cells in a drop-wise manner. The COS-7 cell dish was subsequently incubated for 48 hours. The cells are then harvested.
  • Harvest procedure: Media was aspirated from the dishes and the cells rinsed with 10 mL PBS. The PBS was removed and 3 mL of PBS added to the dish. The dish was scraped to resuspend the cells, and the subsequent cell suspension collected into a 15 mL conical tube. The cells were pelleted by centrifugation at 1200 rpm for 5 minutes in a bench top centrifuge. PBS was removed and the cell pellet snap frozen in liquid nitrogen and stored at −80° C.
  • COS-7 cells—FAAH purification:
      • (1) Fractionation: Frozen cell pellets from transient transfections were thawed on ice and resuspended in 12.5 mM Hepes pH 8.0, 100 mM NaCl, 1 mM EDTA (10 mL/0.2 g cell pellet). The pellets were dounce homogenized and then sonicated to produce cell extract. The cell extract was subsequently centrifuged at 1000 g to remove cellular debris. The pellet was discarded and the supernatant centrifuged at 13,000 g for 20 minutes. The pellet contained membrane bound FAAH. The supernatant was discarded and the pellet resolubilized.
      • (2) Re-solubilization: The fraction of interest, (13,000 g, membrane fraction) was resuspended in 2.3 mL re-suspension buffer (20 mM Hepes pH 7.8, 10% v/v Glycerol, 1 mM EDTA, 1% Triton X-100) and the sample incubated on ice for 1 hour and then centrifuged to remove any particulate matter. The supernatant containing solubilized human FAAH was aliquoted and snap frozen in liquid nitrogen and stored at −80° C. until use.
      • (3) Characterization: Protein Concentration determined by Bradford assay.
        • SDS gel and Western blot to confirm presence of FAAH
        • FAAH activity assay
        • Km determination—96-well assay
        • Linear dependence—96-well assay
        • Standard compound Ki determination—384-well assay
  • Human FAAH assay; Experimental Protocol: A 0.1 mg/mL Human FAAH solution was made up in FAAH reaction buffer, and 24 ul pipeted into a 384 well plate. To this was added 1 μL of a 3 fold serially diluted inhibitor from a DMSO stock solution. The FAAH solution and inhibitor were incubated for 30 minutes at room temperature. The FAAH reaction was initiated by the addition of 25 μL of 40 μM AMC Arachidonoyl Amide in FAAH reaction buffer, yielding a final reaction human FAAH preparation concentration of 0.05 mg/ml and AMC-Arachidonoyl substrate concentration of 20 μM, reaction volume 50 μL. The reaction was allowed to proceed for 4 hours at room temperature. The reaction was stopped by the addition of 25 μL 12 μM α-ketoheterocycle (Cayman Chemicals, catalogue #10435). The microtiter plate was read in the envision plate reader.
  • The raw fluorescence was plotted on the y axis and the inhibitor concentration on the x axis to give a dose response inhibition curve. The data was fitted to a single site competitive inhibition equation, fixing the Km for the human enzyme to 12 μM and 9 μM respectively.
  • Other assays which can be used to determine the inhibition of FAAH by the compounds of the present invention include: (1) a fluorescence-based assay for fatty acid amide hydrolase compatible with high-throughput screening as described in Manjunath et al., Analytical Biochemistry (2005) 343:143-151; and (2) a high-throughput screening for the discovery of inhibitors of fatty acid amide hydrolase using a microsome-based fluorescent assay. Wang et al., Biomolecular Screening (2006) 1-9.
  • Example 68 Evidence for Covalent Complex Formation Between Serine-241 of FAAH and Isoxazolines
  • Treatment of rat FAAH protein with the active site-directed irreversible inhibitor methoxy arachidonyl fluorophosphonate results in a crystal structure wherein methoxy arachidonyl phosphonate is covalently bound to the side chain of Ser-241 (Bracey et al., Science (2002) 298:1793-1796).
  • Based on this data, it is hypothesized that the isoxazoline compounds of the present invention form covalent complexes with the nucleophilic side chain of Ser-241. This hypothesis is consistent with the kinetic data, with the proposed binding involving nucleophilic attack of the isoxazoline electrophile by the active site Ser-241, resulting in the elimination of the leaving group from the cytosolic port, and the subsequent formation of a covalent enzyme-isoxazoline adduct. Recovery of activity would subsequently involve a deacylation reaction, which would occur inefficiently, if at all, for the covalent enzyme-isoxazoline adduct.
  • Recovery of activity experiments were performed via a jump dilution method which involved rapidly diluting the enzyme-inhibitor complex 5-fold below its apparent Ki, and measuring activity as a function of time. Little or no enzyme activity was regained over a period of two hours, indicating essentially irreversible inhibition, or a very slowly hydrolysable complex, supporting the above hypothesis.
  • Other Embodiments
  • Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

Claims (27)

1-13. (canceled)
14. A compound having formula:
Figure US20150099738A1-20150409-C00238
or a pharmaceutically acceptable form thereof;
wherein
R18 is selected from —OH, —OR16, —N(R17)2, —CN, —C(═O)R16, —C(═O)N(R17)2, —CO2R16, —SO2R16, —C(═NR17)OR16, —C(═NR17)N(R17)2, —SO2N(R17)2, —SO2R17, —SO2OR17, —SOR16, —C(═S)N(R7)2, —C(═O)SR17, —C(═S)SR17, —P(═O)2R16, —P(═O)(R16)2, —P(═O)2N(R17)2, —P(═O)(NR17)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two R17 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups;
each instance of R16 is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups;
each instance of R17 is, independently, selected from hydrogen, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two R17 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R19 groups;
each instance of R19 is, independently, selected from halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OR20, —ON(R21)2, —N(R21)2, —N(R21)3X, —N(OR20)R21, —SH, —SR20, —SSR20, —C(═O)R20, —CO2H, —CO2R20, —OC(═O)R20, —OC2R20, —C(═O)N(R21)2, —OC(═O)N(R21)2, —NR21C(═O)R20, —NR21CO2R20, —NR21C(═O)N(R21)2, —C(═NR21)OR20, —OC(═NR21)R20, —OC(═NR21)OR20, —C(═NR21)N(R21)2, —OC(═NR21)N(R21)2, —NR21C(═NR21)N(R21)2, —NR21SO2R20, —SO2N(R21)2, —SO2R20, —SO2OR20, —OSO2R20, —S(═O)R20, —Si(R20)3, —OSi(R20)3, —C(═S)N(R21)2, —C(═O)SR20, —C(═S)SR20, —SC(═S)SR20, —P(═O)2R20, —P(═O)(R20)2, —OP(═O)(R20)2, —OP(═O)(OR20)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R22 groups, or two geminal R19 substituents can be joined to form ═O or ═S;
each instance of R20 is, independently, selected from C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R22 groups;
each instance of R21 is, independently, selected from hydrogen, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl and 5-10 membered heteroaryl, or two R21 groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R22 groups; and
each instance of R22 is, independently, halogen, —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OC1-6 alkyl, —ON(C1-6 alkyl)2, —N(C1-6 alkyl)2, —N(C1-6 alkyl)3X, —NH(C1-6 alkyl)2X, —NH2(C1-6 alkyl)X, —NH3X, —N(OC1-6 alkyl)(C1-6 alkyl), —N(OH)(C1-6 alkyl), —NH(OH), —SH, —SC1-6 alkyl, —SS(C1-6 alkyl), —C(═O)(C1-6 alkyl), —CO2H, —CO2(C1-6 alkyl), —OC(O)(C1-6 alkyl), —OCO2(C1-6 alkyl), —C(═O)NH2, —C(═O)N(C1-6 alkyl)2, —OC(═O)NH(C1-6 alkyl), —NHC(═OX)(C1-6 alkyl), —N(C1-6 alkyl)C(═O)(C1-6 alkyl), —NHCO2(C1-6 alkyl), —NHC(═O)N(C1-6 alkyl)2, —NHC(═O)NH(C1-6 alkyl), —NHC(═O)NH2, —C(═NH)O(C1-6 alkyl), —OC(═NH)(C1-6 alkyl), —OC(═NH)OC1-6 alkyl, —C(═NH)N(C1-6 alkyl)2, —C(═NH)NH(C1-6 alkyl), —C(═NH)NH2, —OC(═NH)N(C1-6 alkyl)2, —OC(NH)NH(C1-6 alkyl), —OC(NH)NH2, —NHC(NH)N(C1-6 alkyl)2, —NHC(═NH)NH2, —NHSO2(C1-6 alkyl), —SO2N(C1-6 alkyl)2, —SO2NH(C1-6 alkyl), —SO2NH2, —SO2C1-6 alkyl, —SO2OC1-6 alkyl, —OSO2C1-6 alkyl, —SOC1-6 alkyl, —Si(C1-6 alkyl)3, —OSi(C1-6 alkyl)3 —C(═S)N(C1-6 alkyl)2, C(═S)NH(C1-6 alkyl), C(═S)NH2, —C(═O)S(C1-6 alkyl), —C(═S)SC1-6 alkyl, —SC(═S)SC1-6 alkyl, —P(═O)2(C1-6 alkyl), —P(═O)(C1-6 alkyl)2, —OP(═O)(C1-6 alkyl)2, —OP(═O)(OC1-6 alkyl)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two geminal R22 substituents can be joined to form ═O or ═S;
wherein X is a counterion
G is selected from —CN, —NO2, —S(═O)Re, —SO2Re, —SO2NRfRe, —PO2Re, —PO2ORe, —PO2NRfRe, —(C═O)Re, —(C═O)ORe, —(C═O)NRfRe, —Br, —I, —F, —Cl, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)Re, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)Re, —[N(Rf)2Re]30 X; and
each Re is selected from C1-10 alkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocycyl, C6-14 aryl, 3-14 membered heterocyclyl and 5-14 membered heteroaryl: each Rf attached to a nitrogen atom is, independently, selected from —H, C1-10 alkyl, or an amino protecting group: or Re and Rf are joined to form an 3-14 membered heterocyclyl ring or an 5-14 membered heteroaryl ring.
15-19. (canceled)
20. The compound according to claim 14, wherein G is selected from —Cl, —Br, —I, —ORe, —ONRfRe, —ONRf(C═O)Re, —ONRfSO2Re, —ONRfPO2Re, —ONRfPO2ORe, —SRe, —OSO2Re, —NRfSO2Re, —OPO2Re, —OPO2ORe, —NRfPO2Re, —NRfPO2ORe, —OPO2NRfRe, —O(C═O)Re, —O(C═O)ORe, —NRfRe, —NRf(C═O)Re, —NRf(C═O)ORe, —O(C═O)NRfRe, —NRf(C═NRf)NRfRe, —O(C═NRf)NRfRe, —NRf(C═NRf)ORe, and —[N(Rff)2Re]+X wherein X is a counterion.
21. The compound according to claim 20, wherein G is —ORe.
22. The compound according to claim 21, wherein Re is C6-14 aryl.
23. The compound according to claim 22, wherein Re is phenyl.
24. (canceled)
25. The compound according to claim 23, wherein Re is a phenyl group of the formula:
Figure US20150099738A1-20150409-C00239
wherein:
x is 0, 1, 2, 3, 4 or 5, and
each Rh is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORi, —ON(Rk)2, —N(Rk)2, —N(Rk)3 +X, —N(ORj)Rk, —SH, —SRi, —SSRj, —C(═O)Ri, —CO2H, —CHO, —CO2Ri, —OC(═O)Ri, —OCO2Ri, —C(═O)N(Rk)2, —OC(═O)N(Rk)2, —NRk C(═O)Ri, —NRk CO2Ri, —NRk C(═O)N(Rk)2, —C(═NRk) Ri, —C(═NRk)ORi, —OC(═NRk)Ri, —OC(═NRk)ORi, —C(═NRk)N(Rk)2, —OC(═NRk)N(Rk)2, —NRk C(═NRk)N(Rk)2, —C(═O)NRk SO2Ri, —NRk SO2Ri, —SO2N(Rk)2, —SO2Ri, —SO2ORi, —OSO2Ri, —S(═O)Ri, —OS(═O)Ri, —Si(Ri)3, —OSi(Ri)3 —C(═S)N(Rk)2, —C(═O)SRi, —C(═S)SRi, —SC(S)SRi, —P(═O)2Ri, —OP(═O)2Ri, —P(═O)(Ri)2, —OP(═O)(Ri)2, —OP(═O)(ORj)2, —P(═O)2N(Rk)2, —OP(═O)2N(Rk)2, —P(═O)(NRk)2, —OP(═O)(NRk)2, —NRk P(═OX)(ORj)2, —NRk P(═O)(NRk)2, —P(Rj)2, —P(Rj)3, —OP(Rj)2, —OP(Rj)3, —B(ORj)2, —BRi(ORj), C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-14 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
each instance of Ri is, independently, selected from C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
each instance of Rk is, independently, selected from hydrogen, —OH, —ORi, —N(Rj)2, —CN, —C(═O)Ri, —C(═O)N(Rj)2, —CO2Ri, —SO2Ri, —C(═NRj)ORi, —C(═NRj)N(Rj)2, —SO2N(Rj)2, —SO2Rj, —SO2ORj, —SORi, —C(═S)N(Rj)2, —C(═O)SRj, —C(═S)SRj, —P(═O)2Ri, —P(═O)(Ri)2, —P(═O)2N(Rj)2, —P(═O)(NRj)2, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rj groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
each instance of Rj is, independently, selected from hydrogen, C1-10 alkyl, C1-10 perhaloalkyl, C2-10 alkenyl, C2-10 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, and 5-14 membered heteroaryl, or two Rj groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rm groups;
each instance of Rm is, independently, selected from fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —ORo, —ON(Rn)2, —N(Rno)2, —N(Rn)3 X, —N(ORo)Rn, —SH, —SRo, —SSRo, —C(═O)Ro, —CO2H, —CO2Ro, —OC(═O)Ro, —OCO2Ro, —C(═O)N(Rn)2, —OC(═O)N(Ro)2, —NRc (═O)Ro, —NRnCO2Ro, —NRc (═O)N(Rn)2, —C(═NRn)ORo, —OC(═NRn)Ro, —OC(═NRn)ORo, —C(═NRn)N(Rn)2, —OC(═NRn)N(Rn)2, —NRnC(═NRn)N(Rn)2, —NRnSO2Ro, —SO2N(Rn)2, —SO2Ro, —SO2ORo, —OSO2Ro, —S(═O)Ro, —Si(Ro)3, —OSi(Ro)3, —C(═S)N(Rn)2, —C(═O)SRo, —C(═S)SRo, —SC(═S)SRo, —P(═O)2Ro, —P(═O)(Ro)2, —OP(═O)(Ro)2, —OP(═O)(ORo)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C3-10 carbocyclyl, 3-14 membered heterocyclyl, C6-14 aryl, 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups, or two geminal Rm substituents can be joined to form ═O or ═S;
each instance of Ro is, independently, selected from C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, C6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups;
each instance of Rn is, independently, selected from hydrogen, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, C1-10 carbocyclyl, 3-10 membered heterocyclyl, C6-10 aryl and 5-10 membered heteroaryl, or two Rn groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rp groups; and
each instance of Rp is, independently, fluoro (—F), bromo (—Br), chloro (—Cl), and iodo (—I), —CN, —NO2, —N3, —SO2H, —SO3H, —OH, —OC1-6 alkyl, —ON(C1-6 alkyl)2, —N(C1-6 alkyl)2, —N(C1-6 alkyl)3X, —NH(C1-6 alkyl)2X, —NH2(C1-6 alkyl)X, —NH3X, —N(OC1-6 alkyl)(C1-6 alkyl), —N(OH)(C1-6 alkyl), —NH(OH), —SH, —SC1-6 alkyl, —SS(C1-6 alkyl), —C(═O)(C1-6 alkyl), —CO2H, —CO2(C1-6 alkyl), —OC(═O)(C1-6 alkyl), —OCO2(C1-6 alkyl), —C(═O)NH2, —C(═O)N(C1-6 alkyl)2, —OC(═O)NH(C1-6 alkyl), —NHC(═O)(C1-6 alkyl), —N(C1-6 alkyl)C(═O)(C1-6 alkyl), —NHCO2(C1-6 alkyl), —NHC(═O)N(C1-6 alkyl)2, —NHC(═O)NH(C1-6 alkyl), —NHC(═O)NH2, —C(═NH)O(C1-6 alkyl), —OC(═NH)(C1-6 alkyl), —OC(═NH)OC1-6 alkyl, —C(═NH)N(C1-6 alkyl)2, —C(═NH)NH(C1-6 alkyl), —C(═NH)NH2, —OC(═NH)N(C1-6 alkyl)2, —OC(NH)NH(C1-6 alkyl), —OC(NH)NH2, —NHC(NH)N(C1-6 alkyl)2, —NHC(═NH)NH2, —NHSO2(C1-6 alkyl), —SO2N(C1-6 alkyl)2, —SO2NH(C1-6 alkyl), —SO2NH2, —SO2Cl alkyl, —SO2OC1-6 alkyl, —OSO2C1-6 alkyl, —SOC1-6 alkyl, —Si(C1-6 alkyl)3, —OSi(C1-6 alkyl)3 —C(═S)N(C1-6 alkyl)2, C(═S)NH(C1-6 alkyl), C(═S)NH2, —C(═O)S(C1-6 alkyl), —C(═S)SC1-6 alkyl, —SC(═S)SC1-6 alkyl, —P(═O)2(C1-6 alkyl), —P(═O)(C1-6 alkyl)2, —OP(═O)(C1-6 alkyl)2, —OP(═O)(OC1-6 alkyl)2, C1-6 alkyl, C1-6 perhaloalkyl, C2-6 alkenyl, C2 alkynyl, C3-10 carbocyclyl, C6-14 aryl, 3-14 membered heterocyclyl, 5-14 membered heteroaryl; or two geminal Rp substituents can be joined to form ═O or ═S;
wherein X is a counterion.
26-32. (canceled)
33. The compound according to claim 25, wherein Re is a 6-membered heteroaryl.
34. The compound according to claim 33, wherein Re is a pyrindinyl group.
35-42. (canceled)
43. The compound according to claim 14, wherein the compound is substantially enantiomerically pure.
44. A pharmaceutical composition comprising a compound of claim 14, or a pharmaceutically acceptable form thereof, and a pharmaceutically acceptable excipient.
45. A method of treating an FAAH-mediated condition comprising administering to a subject in need thereof a therapeutically effective amount of a compound of claim 14 or a pharmaceutically acceptable form thereof.
46. The method according to claim 45, wherein the FAAH-mediated condition is selected from a painful condition, an inflammatory condition, an immune disorder, a disorder of the central nervous system, a metabolic disorder, a cardiac disorder and glaucoma.
47. The method according to claim 46, wherein the FAAH-mediated condition is a painful condition selected from neuropathic pain, central pain, deafferentiation pain, chronic pain, post-operative pain, pre-operative pain, nociceptive pain, acute pain, non-inflammatory pain, inflammatory pain, pain associated with cancer, wound pain, burn pain, pain associated with medical procedures, pain resulting from pruritus, painful bladder syndrome, pain associated with premenstrual dysphoric disorder, pain associated with premenstrual syndrome, pain associated with chronic fatigue syndrome, pain associated with pre-term labor, pain associated with drawal symptoms from drug addiction, joint pain, arthritic pain, lumbosacral pain, musculo-skeletal pain, headache, migraine, muscle ache, lower back pain, neck pain, toothache dental/maxillofacial pain and visceral pain.
48. The method according to claim 46, wherein the FAAH-mediated condition is an inflammatory condition or an immune disorder.
49. The method according to claim 48, wherein the inflammatory condition or immune disorder is a gastrointestinal disorder.
50. The method according to claim 48, wherein the inflammatory condition or immune disorder is a skin condition.
51. The method according to claim 46, wherein the FAAH-mediated condition is a disorder of the central nervous system selected from neurotoxicity and/or neurotrauma, stroke, multiple sclerosis, spinal cord injury, epilepsy, a mental disorder, a sleep condition, a movement disorder, nausea and/or emesis, amyotrophic lateral sclerosis, Alzheimer's disease and drug addiction.
52. The method according to claim 46, wherein the FAAH-mediated condition is a metabolic disorder selected from a wasting condition or an obesity-related condition or complication thereof.
53. The method according to claim 46, wherein the FAAH-mediated condition is a cardiac disorder selected from hypertension, circulatory shock, myocardial reperfusion injury and atherosclerosis.
54. The method according to claim 46, wherein the FAAH-mediated condition is glaucoma.
55. The compound according to claim 14, wherein the compound is:
Figure US20150099738A1-20150409-C00240
Figure US20150099738A1-20150409-C00241
Figure US20150099738A1-20150409-C00242
Figure US20150099738A1-20150409-C00243
Figure US20150099738A1-20150409-C00244
Figure US20150099738A1-20150409-C00245
56. A compound selected from:
Figure US20150099738A1-20150409-C00246
US14/320,435 2009-05-18 2014-06-30 Isoxazolines as inhibitors of fatty acid amide hydrolase Abandoned US20150099738A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/320,435 US20150099738A1 (en) 2009-05-18 2014-06-30 Isoxazolines as inhibitors of fatty acid amide hydrolase

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US17928509P 2009-05-18 2009-05-18
US12/782,658 US8765735B2 (en) 2009-05-18 2010-05-18 Isoxazolines as inhibitors of fatty acid amide hydrolase
US14/320,435 US20150099738A1 (en) 2009-05-18 2014-06-30 Isoxazolines as inhibitors of fatty acid amide hydrolase

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
US12/782,658 Continuation US8765735B2 (en) 2009-05-18 2010-05-18 Isoxazolines as inhibitors of fatty acid amide hydrolase

Publications (1)

Publication Number Publication Date
US20150099738A1 true US20150099738A1 (en) 2015-04-09

Family

ID=43535284

Family Applications (2)

Application Number Title Priority Date Filing Date
US12/782,658 Expired - Fee Related US8765735B2 (en) 2009-05-18 2010-05-18 Isoxazolines as inhibitors of fatty acid amide hydrolase
US14/320,435 Abandoned US20150099738A1 (en) 2009-05-18 2014-06-30 Isoxazolines as inhibitors of fatty acid amide hydrolase

Family Applications Before (1)

Application Number Title Priority Date Filing Date
US12/782,658 Expired - Fee Related US8765735B2 (en) 2009-05-18 2010-05-18 Isoxazolines as inhibitors of fatty acid amide hydrolase

Country Status (1)

Country Link
US (2) US8765735B2 (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8765735B2 (en) * 2009-05-18 2014-07-01 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase
US8927551B2 (en) * 2009-05-18 2015-01-06 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase
US9149465B2 (en) * 2009-05-18 2015-10-06 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006122769A2 (en) * 2005-05-19 2006-11-23 Grünenthal GmbH Substituted spiro compounds and their use for producing pain-relief drugs
US8765735B2 (en) * 2009-05-18 2014-07-01 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase

Family Cites Families (97)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4270537A (en) 1979-11-19 1981-06-02 Romaine Richard A Automatic hypodermic syringe
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
ZA871860B (en) 1986-03-14 1988-10-26 Syntex Inc Transglutaminase inhibitors
CA1283827C (en) 1986-12-18 1991-05-07 Giorgio Cirelli Appliance for injection of liquid formulations
GB8704027D0 (en) 1987-02-20 1987-03-25 Owen Mumford Ltd Syringe needle combination
US4940460A (en) 1987-06-19 1990-07-10 Bioject, Inc. Patient-fillable and non-invasive hypodermic injection device assembly
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
AU619203B2 (en) 1987-08-28 1992-01-23 Schering Aktiengesellschaft Isoxazole-beta-carboline derivatives
US5339163A (en) 1988-03-16 1994-08-16 Canon Kabushiki Kaisha Automatic exposure control device using plural image plane detection areas
FR2638359A1 (en) 1988-11-03 1990-05-04 Tino Dalto SYRINGE GUIDE WITH ADJUSTMENT OF DEPTH DEPTH OF NEEDLE IN SKIN
JPH0328045A (en) * 1989-06-26 1991-02-06 Zexel Corp Monitoring device
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
EP0440082B1 (en) 1990-02-01 1998-04-15 MERCK PATENT GmbH Method for the conversion of fluorinated aromatic compounds using electrophiles
EP0451790A1 (en) 1990-04-12 1991-10-16 Hoechst Aktiengesellschaft 3,5-disubstituted 2-isoxazolines and isoxazoles, process for their preparation, medicines containing them and their use
US5190521A (en) 1990-08-22 1993-03-02 Tecnol Medical Products, Inc. Apparatus and method for raising a skin wheal and anesthetizing skin
US5527288A (en) 1990-12-13 1996-06-18 Elan Medical Technologies Limited Intradermal drug delivery device and method for intradermal delivery of drugs
DE4118741A1 (en) 1991-06-05 1992-12-10 Schering Ag NEW HETARYLOXY (BETA) CARBOLINES, THEIR PRODUCTION AND USE IN MEDICINAL PRODUCTS
GB9118204D0 (en) 1991-08-23 1991-10-09 Weston Terence E Needle-less injector
SE9102652D0 (en) 1991-09-13 1991-09-13 Kabi Pharmacia Ab INJECTION NEEDLE ARRANGEMENT
US5328483A (en) 1992-02-27 1994-07-12 Jacoby Richard M Intradermal injection device with medication and needle guard
US5541061A (en) 1992-04-29 1996-07-30 Affymax Technologies N.V. Methods for screening factorial chemical libraries
JP3035074B2 (en) 1992-06-12 2000-04-17 塩野義製薬株式会社 Isoxazoline derivatives and antiviral agents containing the same as active ingredients
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
US5569189A (en) 1992-09-28 1996-10-29 Equidyne Systems, Inc. hypodermic jet injector
US5334144A (en) 1992-10-30 1994-08-02 Becton, Dickinson And Company Single use disposable needleless injector
US5576220A (en) 1993-02-19 1996-11-19 Arris Pharmaceutical Corporation Thin film HPMP matrix systems and methods for constructing and displaying ligands
US5849736A (en) 1993-11-24 1998-12-15 The Dupont Merck Pharmaceutical Company Isoxazoline and isoxazole fibrinogen receptor antagonists
WO1995024176A1 (en) 1994-03-07 1995-09-14 Bioject, Inc. Ampule filling device
US5466220A (en) 1994-03-08 1995-11-14 Bioject, Inc. Drug vial mixing and transfer device
US5599302A (en) 1995-01-09 1997-02-04 Medi-Ject Corporation Medical injection system and method, gas spring thereof and launching device using gas spring
GB9505651D0 (en) 1995-03-21 1995-05-10 Agrevo Uk Ltd AgrEvo UK Limited
US5514505A (en) 1995-05-15 1996-05-07 Xerox Corporation Method for obtaining improved image contrast in migration imaging members
US5730723A (en) 1995-10-10 1998-03-24 Visionary Medical Products Corporation, Inc. Gas pressured needle-less injection device and method
US6271015B1 (en) 1995-06-12 2001-08-07 The Scripps Research Institute Fatty-acid amide hydrolase
US5880121A (en) 1996-01-05 1999-03-09 Hoechst Marion Roussel Inc. 4,5-dihydronaphth (1,2-c) isoxazoles and derivatives thereof
US5893397A (en) 1996-01-12 1999-04-13 Bioject Inc. Medication vial/syringe liquid-transfer apparatus
GB9605334D0 (en) 1996-03-13 1996-05-15 British Nuclear Fuels Plc Biodecontamination reactor
AU2151897A (en) 1996-03-15 1997-10-10 Aarhus Universitets Forskningsfond Bis-heterocyclic derivatives
CA2206192A1 (en) 1996-06-13 1997-12-13 F. Hoffmann-La Roche Ag Modulation of lc132 (opioid-like) receptor function
US5856537A (en) 1996-06-26 1999-01-05 The Scripps Research Institute Inhibitors of oleamide hydrolase
HUP9602763A3 (en) 1996-10-09 1999-05-28 Egyt Gyogyszervegyeszeti Gyar 3-phenyl isoxazole derivatives, process for producing them and pharmaceutical compositions containing the same
US5925672A (en) 1996-12-06 1999-07-20 Neurosciences Research Foundation, Inc. Methods of treating mental diseases, inflammation and pain
FR2758723B1 (en) 1997-01-28 1999-04-23 Sanofi Sa USE OF CENTRAL CANNABINOID RECEPTOR ANTAGONISTS FOR THE PREPARATION OF DRUGS
US5993412A (en) 1997-05-19 1999-11-30 Bioject, Inc. Injection apparatus
WO1999021852A1 (en) 1997-10-27 1999-05-06 Nippon Soda Co., Ltd. Novel benzoylpyrazole derivatives and herbicides
IT1298087B1 (en) 1998-01-08 1999-12-20 Fiderm S R L DEVICE FOR CHECKING THE PENETRATION DEPTH OF A NEEDLE, IN PARTICULAR APPLICABLE TO A SYRINGE FOR INJECTIONS
ES2191435T3 (en) 1998-06-09 2003-09-01 Basf Ag HERBICIDE MIXTURE CONTAINING A BENZOYL 3-HETEROCICLIL-SUBSTITUTED DERIVATIVE.
EP1087664B1 (en) 1998-06-16 2003-05-28 Basf Aktiengesellschaft Herbicidal mixtures having a synergistic effect
JP2000247953A (en) 1999-02-26 2000-09-12 Nippon Soda Co Ltd Substituted piperidinedione derivative and herbicide
AU772265B2 (en) 1999-03-05 2004-04-22 Basf Aktiengesellschaft Herbicidal mixture containing a 3-heterocyclyl-substituted benzoyl derivative and an adjuvant
US6841519B1 (en) * 1999-08-10 2005-01-11 Kumiai Chemical Industry Co., Ltd. Isoxazoline derivatives and herbicides containing the same as the active ingredient
US6309406B1 (en) 1999-11-24 2001-10-30 Hamit-Darwin-Fresh, Inc. Apparatus and method for inducing epileptic seizures in test animals for anticonvulsant drug screening
JP4768948B2 (en) 1999-12-22 2011-09-07 ビーエーエスエフ ソシエタス・ヨーロピア 3- (4,5-Dihydroisoxazol-5-yl) benzoylpyrazole
WO2001056979A1 (en) 2000-01-31 2001-08-09 Nippon Soda Co., Ltd. Substituted cyanoacetamide derivatives and herbicides
WO2001056994A1 (en) 2000-02-04 2001-08-09 Biogen, Inc. Integrin antagonists
CA2409762A1 (en) 2000-06-23 2002-01-03 Donald J.P. Pinto Heteroaryl-phenyl substituted factor xa inhibitors
AU2001273040A1 (en) 2000-06-27 2002-01-08 Du Pont Pharmaceuticals Company Factor xa inhibitors
ES2266246T3 (en) 2000-07-17 2007-03-01 Basf Aktiengesellschaft PREPARATION OF DERIVATIVES OF 4-TIOALQUILBROMOBENCENO.
WO2002015694A2 (en) 2000-08-25 2002-02-28 Basf Aktiengesellschaft Herbicidal mixtures
WO2002029057A2 (en) 2000-10-05 2002-04-11 Millenium Pharmaceuticals, Inc. 32144, a human fatty acid amide hydrolase and uses thereof
GB0100110D0 (en) 2001-01-04 2001-02-14 Univ Leeds Modulation of calcium channel activity
DE10114597A1 (en) 2001-03-23 2002-10-02 Bayer Cropscience Gmbh Arylisoxazoline derivatives, process for their preparation and their use as pesticides
RS50828B (en) 2001-09-14 2010-08-31 Basf Aktiengesellschaft Herbicidal mixtures based on 3-phenyluracils
US20050113283A1 (en) 2002-01-18 2005-05-26 David Solow-Cordero Methods of treating conditions associated with an EDG-4 receptor
CA2473740A1 (en) 2002-01-18 2003-07-31 David Solow-Cordero Methods of treating conditions associated with an edg receptor
CA2490499C (en) 2002-07-08 2012-01-31 Basf Aktiengesellschaft Synergistically acting herbicidal mixtures
CA2493206C (en) 2002-07-22 2011-09-13 Basf Aktiengesellschaft Synergistically acting herbicidal mixtures
RS51053B (en) 2002-07-23 2010-10-31 Basf Aktiengesellschaft Synergistically acting herbicidal mixtures
WO2004010779A2 (en) 2002-07-24 2004-02-05 Basf Aktiengesellschaft Synergistically acting herbicidal mixtures
ES2339444T3 (en) 2002-08-15 2010-05-20 Janssen Pharmaceutica Nv CONDENSED HETEROCICLIC ISOXAZOLINE DERIVATIVES AND ITS USE AS ANTIDEPRESSANTS.
WO2004018410A1 (en) 2002-08-26 2004-03-04 Nissan Chemical Industries, Ltd. Substituted benzanilide compound and pest control agent
AR043050A1 (en) 2002-09-26 2005-07-13 Rib X Pharmaceuticals Inc BIFunctional HETEROCICLICAL COMPOUNDS AND METHODS TO PREPARE AND USE THE SAME
CA2506026A1 (en) 2002-11-14 2004-05-27 The Scripps Research Institute Crystalline form of fatty acid amine hydrolase (faah)
US20040235925A1 (en) 2002-12-17 2004-11-25 Pharmacia Corporation Method for the treatment, prevention, or inhibition of a CNS disorder and/or pain and inflammation using a combination of duloxetine, venlafaxine or atomoxetine and a cyclooxygenase-2 selective inhibitor and compositions thereof
CN1780846A (en) 2003-03-05 2006-05-31 Rib-X医药品有限公司 Bifunctional heterocyclic compounds and methods of making and using the same
JP2005272443A (en) 2004-02-23 2005-10-06 Nissan Chem Ind Ltd Insecticidal, miticidal, nematocidal, germicidal, or bacteriocidal composition and method for using the same
JP2005272452A (en) 2004-02-23 2005-10-06 Nissan Chem Ind Ltd Substituted benzanilide compound and pesticide
CN101098697B (en) 2004-03-26 2010-11-10 塞托凯恩药物科学公司 Compounds, compositions, processes of making, and methods of use related to inhibiting macrophage migration inhibitory factor
TW200633990A (en) 2004-11-18 2006-10-01 Takeda Pharmaceuticals Co Amide compound
US7553496B2 (en) 2004-12-21 2009-06-30 University Of Kentucky Research Foundation VEGF-A as an inhibitor of angiogenesis and methods of using same
WO2006090234A1 (en) 2005-02-22 2006-08-31 Ranbaxy Laboratories Limited Heterocyclic derivatives as cell adhesion inhibitors
WO2007147828A1 (en) 2006-06-20 2007-12-27 Basf Se Herbicidal compositions comprising a 3-heterocyclyl-substituted benzoyl compound
ITMI20061279A1 (en) * 2006-06-30 2008-01-01 Consiglio Nazionale Ricerche SELECTIVE NICOTINIC AGONISTS FOR THE ALFA7 RECEPTOR SUBTIPLE, PROCEDURE FOR THEIR PREPARATION AND RELATED PHARMACEUTICAL COMPOSITIONS
GB0614691D0 (en) 2006-07-24 2006-08-30 Syngenta Participations Ag Insecticidal compounds
WO2008013622A2 (en) 2006-07-27 2008-01-31 E. I. Du Pont De Nemours And Company Fungicidal azocyclic amides
JO3598B1 (en) 2006-10-10 2020-07-05 Infinity Discovery Inc Boronic acids and esters as inhibitors of fatty acid amide hydrolase
MX2009004233A (en) 2006-10-18 2009-08-12 Pfizer Prod Inc Biaryl ether urea compounds.
EP1992614A1 (en) 2007-05-16 2008-11-19 Bayer CropScience Aktiengesellschaft 3-(2-Alkoxy-phenyl)-substituted tetramates
WO2009011904A1 (en) 2007-07-19 2009-01-22 Renovis, Inc. Compounds useful as faah modulators and uses thereof
GB0720319D0 (en) 2007-10-17 2007-11-28 Syngenta Participations Ag Insecticidal compounds
TWI428091B (en) 2007-10-23 2014-03-01 Du Pont Fungicidal mixtures
US8637513B2 (en) 2007-10-24 2014-01-28 Merck Sharp & Dohme Corp. Heterocycle phenyl amide T-type calcium channel antagonists
JP5339250B2 (en) 2008-07-28 2013-11-13 独立行政法人産業技術総合研究所 Method for producing enzyme solution and method for producing sugar
US8927551B2 (en) 2009-05-18 2015-01-06 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase
US9149465B2 (en) 2009-05-18 2015-10-06 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006122769A2 (en) * 2005-05-19 2006-11-23 Grünenthal GmbH Substituted spiro compounds and their use for producing pain-relief drugs
US20080214807A1 (en) * 2005-05-19 2008-09-04 Gruenenthal Gmbh Substituted Spiro Compounds and their Use for Producing Drugs
US8765735B2 (en) * 2009-05-18 2014-07-01 Infinity Pharmaceuticals, Inc. Isoxazolines as inhibitors of fatty acid amide hydrolase

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
Tsukamoto et al. Synthesis and structure-activity studies of a series of 1-oxa-2,8-diazaspiro[4.5]decan-3-ones and related compound as M1 muscarinic agonists. Chemical and Pharmaceutical Bulletin, Vol. 43, No.9, 1523-1529, 1995. *

Also Published As

Publication number Publication date
US8765735B2 (en) 2014-07-01
US20110034437A1 (en) 2011-02-10

Similar Documents

Publication Publication Date Title
US20220024923A1 (en) Mitragynine analogs and uses thereof
US10975055B2 (en) Inhibitors of interleukin-1 receptor-associated kinases and uses thereof
JP2012527467A (en) Isoxazolines as fatty acid amide hydrolase inhibitors
US20220402869A1 (en) Transcriptional enhanced associate domain (tead) transcription factor inhibitors and uses thereof
AU2007322268B2 (en) Boronic acids and esters as inhibitors of fatty acid amide hydrolase
US20170198006A1 (en) Prmt5 inhibitors and uses thereof
US11905285B2 (en) Inhibitors of plasma kallikrein and uses thereof
US20130150314A1 (en) Trioxacarcins and uses thereof
US11603349B2 (en) Anti-fibrotic compounds
US8927551B2 (en) Isoxazolines as inhibitors of fatty acid amide hydrolase
US9149465B2 (en) Isoxazolines as inhibitors of fatty acid amide hydrolase
US11098021B2 (en) Phenylsulfonamido-benzofuran derivatives and uses thereof in the treatment of proliferative diseases
US8765735B2 (en) Isoxazolines as inhibitors of fatty acid amide hydrolase
US10273264B2 (en) Cortistatin analogues and syntheses and uses thereof
US20240083936A1 (en) Steroidal compound derivatives as therapeutic agents
CA3218510A1 (en) Small molecule modulators of glucocerebrosidase activity and uses thereof
WO2022226133A1 (en) Multifaceted approach to novel interleukin-6 inhibitors
US20200062776A1 (en) Hedgehog acyltransferase inhibitors and uses thereof

Legal Events

Date Code Title Description
AS Assignment

Owner name: INFINITY PHARMACEUTICALS, INC., MASSACHUSETTS

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BEHNKE, MARK L.;CASTRO, ALFREDO C.;CHAN, LAWRENCE K.;AND OTHERS;SIGNING DATES FROM 20100712 TO 20100716;REEL/FRAME:034218/0852

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION