US20140379094A1 - Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials - Google Patents
Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials Download PDFInfo
- Publication number
- US20140379094A1 US20140379094A1 US14/280,324 US201414280324A US2014379094A1 US 20140379094 A1 US20140379094 A1 US 20140379094A1 US 201414280324 A US201414280324 A US 201414280324A US 2014379094 A1 US2014379094 A1 US 2014379094A1
- Authority
- US
- United States
- Prior art keywords
- organic
- inorganic composite
- composite material
- seq
- domain
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 102000034240 fibrous proteins Human genes 0.000 title claims abstract description 52
- 108091005899 fibrous proteins Proteins 0.000 title claims abstract description 52
- 230000015572 biosynthetic process Effects 0.000 title claims abstract description 25
- 229910003471 inorganic composite material Inorganic materials 0.000 title claims description 25
- 230000012743 protein tagging Effects 0.000 title abstract description 4
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 65
- 230000033558 biomineral tissue development Effects 0.000 claims abstract description 42
- 230000004927 fusion Effects 0.000 claims abstract description 32
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 32
- 229920001184 polypeptide Polymers 0.000 claims abstract description 29
- 239000003814 drug Substances 0.000 claims abstract description 17
- 108090000623 proteins and genes Proteins 0.000 claims description 63
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 claims description 58
- 102000004169 proteins and genes Human genes 0.000 claims description 57
- 210000004027 cell Anatomy 0.000 claims description 42
- 239000000835 fiber Substances 0.000 claims description 41
- 210000001519 tissue Anatomy 0.000 claims description 30
- 101710105839 Dentin matrix acidic phosphoprotein 1 Proteins 0.000 claims description 28
- 102100022375 Dentin matrix acidic phosphoprotein 1 Human genes 0.000 claims description 28
- 230000001089 mineralizing effect Effects 0.000 claims description 28
- 239000000377 silicon dioxide Substances 0.000 claims description 26
- 102000016921 Integrin-Binding Sialoprotein Human genes 0.000 claims description 23
- 108010028750 Integrin-Binding Sialoprotein Proteins 0.000 claims description 23
- 101150108455 Sil1 gene Proteins 0.000 claims description 23
- 229910052588 hydroxylapatite Inorganic materials 0.000 claims description 22
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 claims description 22
- 210000000988 bone and bone Anatomy 0.000 claims description 13
- 239000006260 foam Substances 0.000 claims description 13
- 229910010272 inorganic material Inorganic materials 0.000 claims description 12
- 239000011147 inorganic material Substances 0.000 claims description 12
- 229940124597 therapeutic agent Drugs 0.000 claims description 11
- 239000003795 chemical substances by application Substances 0.000 claims description 10
- 108010028210 spidroin 1 Proteins 0.000 claims description 9
- 108010035532 Collagen Proteins 0.000 claims description 8
- 102000008186 Collagen Human genes 0.000 claims description 8
- 229920001436 collagen Polymers 0.000 claims description 8
- 239000003102 growth factor Substances 0.000 claims description 7
- 230000001939 inductive effect Effects 0.000 claims description 7
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 claims description 6
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 claims description 6
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims description 6
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 6
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 6
- 108050007372 Fibroblast Growth Factor Proteins 0.000 claims description 5
- 102000018233 Fibroblast Growth Factor Human genes 0.000 claims description 5
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 claims description 5
- WUPHOULIZUERAE-UHFFFAOYSA-N 3-(oxolan-2-yl)propanoic acid Chemical compound OC(=O)CCC1CCCO1 WUPHOULIZUERAE-UHFFFAOYSA-N 0.000 claims description 4
- 229910052980 cadmium sulfide Inorganic materials 0.000 claims description 4
- SZVJSHCCFOBDDC-UHFFFAOYSA-N iron(II,III) oxide Inorganic materials O=[Fe]O[Fe]O[Fe]=O SZVJSHCCFOBDDC-UHFFFAOYSA-N 0.000 claims description 4
- 150000007523 nucleic acids Chemical class 0.000 claims description 4
- 102000007469 Actins Human genes 0.000 claims description 3
- 108010085238 Actins Proteins 0.000 claims description 3
- 102100026398 Cyclic AMP-responsive element-binding protein 3 Human genes 0.000 claims description 3
- 108010014258 Elastin Proteins 0.000 claims description 3
- 102000016942 Elastin Human genes 0.000 claims description 3
- 101000855520 Homo sapiens Cyclic AMP-responsive element-binding protein 3 Proteins 0.000 claims description 3
- 108010076876 Keratins Proteins 0.000 claims description 3
- 102000011782 Keratins Human genes 0.000 claims description 3
- 101710182756 Silaffin-1 Proteins 0.000 claims description 3
- 102000013275 Somatomedins Human genes 0.000 claims description 3
- 239000002246 antineoplastic agent Substances 0.000 claims description 3
- GEHJBWKLJVFKPS-UHFFFAOYSA-N bromochloroacetic acid Chemical compound OC(=O)C(Cl)Br GEHJBWKLJVFKPS-UHFFFAOYSA-N 0.000 claims description 3
- 229920002549 elastin Polymers 0.000 claims description 3
- 239000012634 fragment Substances 0.000 claims description 3
- 230000000921 morphogenic effect Effects 0.000 claims description 3
- 108020004707 nucleic acids Proteins 0.000 claims description 3
- 102000039446 nucleic acids Human genes 0.000 claims description 3
- 108091023037 Aptamer Proteins 0.000 claims description 2
- 101001007348 Arachis hypogaea Galactose-binding lectin Proteins 0.000 claims description 2
- 102000003886 Glycoproteins Human genes 0.000 claims description 2
- 108090000288 Glycoproteins Proteins 0.000 claims description 2
- 108090001030 Lipoproteins Proteins 0.000 claims description 2
- 102000004895 Lipoproteins Human genes 0.000 claims description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 claims description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 claims description 2
- 230000000202 analgesic effect Effects 0.000 claims description 2
- 229940035676 analgesics Drugs 0.000 claims description 2
- 239000000730 antalgic agent Substances 0.000 claims description 2
- 230000002924 anti-infective effect Effects 0.000 claims description 2
- 239000002260 anti-inflammatory agent Substances 0.000 claims description 2
- 229940121363 anti-inflammatory agent Drugs 0.000 claims description 2
- 230000003409 anti-rejection Effects 0.000 claims description 2
- 229960005475 antiinfective agent Drugs 0.000 claims description 2
- 229940127089 cytotoxic agent Drugs 0.000 claims description 2
- 150000004676 glycans Chemical class 0.000 claims description 2
- 229940088597 hormone Drugs 0.000 claims description 2
- 239000005556 hormone Substances 0.000 claims description 2
- 102000006495 integrins Human genes 0.000 claims description 2
- 108010044426 integrins Proteins 0.000 claims description 2
- 229920001282 polysaccharide Polymers 0.000 claims description 2
- 239000005017 polysaccharide Substances 0.000 claims description 2
- 150000003384 small molecules Chemical class 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 7
- 108010066486 EGF Family of Proteins Proteins 0.000 claims 1
- 102000018386 EGF Family of Proteins Human genes 0.000 claims 1
- 239000013543 active substance Substances 0.000 claims 1
- 239000002975 chemoattractant Substances 0.000 claims 1
- 239000000463 material Substances 0.000 abstract description 31
- 239000002131 composite material Substances 0.000 abstract description 15
- 229940079593 drug Drugs 0.000 abstract description 5
- 102000004190 Enzymes Human genes 0.000 abstract description 4
- 108090000790 Enzymes Proteins 0.000 abstract description 4
- 150000001875 compounds Chemical class 0.000 abstract description 4
- 239000000975 dye Substances 0.000 abstract description 2
- 239000010408 film Substances 0.000 description 64
- 108020001507 fusion proteins Proteins 0.000 description 52
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 51
- 102000037865 fusion proteins Human genes 0.000 description 51
- 235000018102 proteins Nutrition 0.000 description 43
- 238000000034 method Methods 0.000 description 38
- 150000001413 amino acids Chemical group 0.000 description 34
- 239000013598 vector Substances 0.000 description 30
- 229920001872 Spider silk Polymers 0.000 description 26
- 239000012620 biological material Substances 0.000 description 25
- 235000001014 amino acid Nutrition 0.000 description 22
- 239000000243 solution Substances 0.000 description 19
- 239000012890 simulated body fluid Substances 0.000 description 18
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 17
- 230000014509 gene expression Effects 0.000 description 16
- 230000008569 process Effects 0.000 description 15
- 238000006243 chemical reaction Methods 0.000 description 14
- 239000000203 mixture Substances 0.000 description 12
- 238000000746 purification Methods 0.000 description 12
- 238000000576 coating method Methods 0.000 description 11
- 239000013604 expression vector Substances 0.000 description 10
- 239000000126 substance Substances 0.000 description 10
- 241000206750 Cylindrotheca fusiformis Species 0.000 description 9
- 239000000499 gel Substances 0.000 description 9
- 238000000338 in vitro Methods 0.000 description 9
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 8
- 108091034117 Oligonucleotide Proteins 0.000 description 8
- 238000004458 analytical method Methods 0.000 description 8
- 210000004899 c-terminal region Anatomy 0.000 description 8
- 229910001424 calcium ion Inorganic materials 0.000 description 8
- 238000010367 cloning Methods 0.000 description 8
- 239000011248 coating agent Substances 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- VSIIXMUUUJUKCM-UHFFFAOYSA-D pentacalcium;fluoride;triphosphate Chemical compound [F-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O VSIIXMUUUJUKCM-UHFFFAOYSA-D 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 7
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 7
- 229910052586 apatite Inorganic materials 0.000 description 7
- 239000007864 aqueous solution Substances 0.000 description 7
- 230000001413 cellular effect Effects 0.000 description 7
- 230000000295 complement effect Effects 0.000 description 7
- 238000000151 deposition Methods 0.000 description 7
- 238000002791 soaking Methods 0.000 description 7
- BYEAHWXPCBROCE-UHFFFAOYSA-N 1,1,1,3,3,3-hexafluoropropan-2-ol Chemical compound FC(F)(F)C(O)C(F)(F)F BYEAHWXPCBROCE-UHFFFAOYSA-N 0.000 description 6
- 241000239290 Araneae Species 0.000 description 6
- 241000588724 Escherichia coli Species 0.000 description 6
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 6
- 241000238902 Nephila clavipes Species 0.000 description 6
- 230000008021 deposition Effects 0.000 description 6
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 6
- 238000002513 implantation Methods 0.000 description 6
- 239000011159 matrix material Substances 0.000 description 6
- 230000006911 nucleation Effects 0.000 description 6
- 238000010899 nucleation Methods 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 5
- 108010022355 Fibroins Proteins 0.000 description 5
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 5
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 229920000249 biocompatible polymer Polymers 0.000 description 5
- 239000012153 distilled water Substances 0.000 description 5
- -1 e.g. Substances 0.000 description 5
- 210000002744 extracellular matrix Anatomy 0.000 description 5
- 229910052500 inorganic mineral Inorganic materials 0.000 description 5
- 239000011707 mineral Substances 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 239000002243 precursor Substances 0.000 description 5
- 239000000047 product Substances 0.000 description 5
- 230000001954 sterilising effect Effects 0.000 description 5
- 238000004659 sterilization and disinfection Methods 0.000 description 5
- 238000004627 transmission electron microscopy Methods 0.000 description 5
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical group C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 4
- BHPQYMZQTOCNFJ-UHFFFAOYSA-N Calcium cation Chemical compound [Ca+2] BHPQYMZQTOCNFJ-UHFFFAOYSA-N 0.000 description 4
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 4
- 239000011543 agarose gel Substances 0.000 description 4
- 229960000723 ampicillin Drugs 0.000 description 4
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 4
- 238000012258 culturing Methods 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 238000001523 electrospinning Methods 0.000 description 4
- 229940126864 fibroblast growth factor Drugs 0.000 description 4
- 239000011888 foil Substances 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 238000001556 precipitation Methods 0.000 description 4
- 238000004626 scanning electron microscopy Methods 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 108091035707 Consensus sequence Proteins 0.000 description 3
- 241000282414 Homo sapiens Species 0.000 description 3
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 3
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 3
- 229910052782 aluminium Inorganic materials 0.000 description 3
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 239000013578 denaturing buffer Substances 0.000 description 3
- 238000012377 drug delivery Methods 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 239000002159 nanocrystal Substances 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000008929 regeneration Effects 0.000 description 3
- 238000011069 regeneration method Methods 0.000 description 3
- 238000001878 scanning electron micrograph Methods 0.000 description 3
- 229910052710 silicon Inorganic materials 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- LFQCEHFDDXELDD-UHFFFAOYSA-N tetramethyl orthosilicate Chemical compound CO[Si](OC)(OC)OC LFQCEHFDDXELDD-UHFFFAOYSA-N 0.000 description 3
- 238000002054 transplantation Methods 0.000 description 3
- 235000012431 wafers Nutrition 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- 101710098738 Acidic phosphoprotein Proteins 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 241000255789 Bombyx mori Species 0.000 description 2
- 238000001712 DNA sequencing Methods 0.000 description 2
- 108090000204 Dipeptidase 1 Proteins 0.000 description 2
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 2
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 2
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 2
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 238000012181 QIAquick gel extraction kit Methods 0.000 description 2
- 101800004620 Silaffin-1A1 Proteins 0.000 description 2
- 101800004615 Silaffin-1A2 Proteins 0.000 description 2
- 101800004765 Silaffin-1B Proteins 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 238000003917 TEM image Methods 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 230000000975 bioactive effect Effects 0.000 description 2
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 210000002421 cell wall Anatomy 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 210000001612 chondrocyte Anatomy 0.000 description 2
- 210000002808 connective tissue Anatomy 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 238000002425 crystallisation Methods 0.000 description 2
- 230000008025 crystallization Effects 0.000 description 2
- 210000004268 dentin Anatomy 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 238000002524 electron diffraction data Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 230000007613 environmental effect Effects 0.000 description 2
- 239000007789 gas Substances 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 210000003041 ligament Anatomy 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- 230000000877 morphologic effect Effects 0.000 description 2
- 230000011164 ossification Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 229920000642 polymer Polymers 0.000 description 2
- 230000001376 precipitating effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000008439 repair process Effects 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 239000013605 shuttle vector Substances 0.000 description 2
- 239000010703 silicon Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000010409 thin film Substances 0.000 description 2
- 230000008467 tissue growth Effects 0.000 description 2
- 230000007704 transition Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- DDFHBQSCUXNBSA-UHFFFAOYSA-N 5-(5-carboxythiophen-2-yl)thiophene-2-carboxylic acid Chemical compound S1C(C(=O)O)=CC=C1C1=CC=C(C(O)=O)S1 DDFHBQSCUXNBSA-UHFFFAOYSA-N 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 241000206761 Bacillariophyta Species 0.000 description 1
- 239000004604 Blowing Agent Substances 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 108010022452 Collagen Type I Proteins 0.000 description 1
- 102000012422 Collagen Type I Human genes 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 101000654453 Cylindrotheca fusiformis Silaffin-1 Proteins 0.000 description 1
- 241001269524 Dura Species 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 238000005033 Fourier transform infrared spectroscopy Methods 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- 108060003393 Granulin Proteins 0.000 description 1
- 102100035379 Growth/differentiation factor 5 Human genes 0.000 description 1
- 101001023988 Homo sapiens Growth/differentiation factor 5 Proteins 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 1
- 244000050403 Iris x germanica Species 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 229910025794 LaB6 Inorganic materials 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 239000006137 Luria-Bertani broth Substances 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 239000007832 Na2SO4 Substances 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 229910005855 NiOx Inorganic materials 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000321765 Quadrula aurea Species 0.000 description 1
- 101000901675 Rattus norvegicus Dentin matrix acidic phosphoprotein 1 Proteins 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000270295 Serpentes Species 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 229910000831 Steel Inorganic materials 0.000 description 1
- 239000004809 Teflon Substances 0.000 description 1
- 229920006362 Teflon® Polymers 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 230000001070 adhesive effect Effects 0.000 description 1
- 125000003158 alcohol group Chemical group 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000009141 biological interaction Effects 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 238000005266 casting Methods 0.000 description 1
- 238000006555 catalytic reaction Methods 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000000262 chemical ionisation mass spectrometry Methods 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 108010049937 collagen type I trimeric cross-linked peptide Proteins 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000000599 controlled substance Substances 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 238000005202 decontamination Methods 0.000 description 1
- 230000003588 decontaminative effect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 239000011363 dried mixture Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000012527 feed solution Substances 0.000 description 1
- 239000003337 fertilizer Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 238000005187 foaming Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000003517 fume Substances 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 230000005251 gamma ray Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000003292 glue Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000002439 hemostatic effect Effects 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 229920006253 high performance fiber Polymers 0.000 description 1
- 238000002173 high-resolution transmission electron microscopy Methods 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 239000011256 inorganic filler Substances 0.000 description 1
- 229910003475 inorganic filler Inorganic materials 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 210000004153 islets of langerhan Anatomy 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 239000008176 lyophilized powder Substances 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- DHRRIBDTHFBPNG-UHFFFAOYSA-L magnesium dichloride hexahydrate Chemical compound O.O.O.O.O.O.[Mg+2].[Cl-].[Cl-] DHRRIBDTHFBPNG-UHFFFAOYSA-L 0.000 description 1
- WRUGWIBCXHJTDG-UHFFFAOYSA-L magnesium sulfate heptahydrate Chemical compound O.O.O.O.O.O.O.[Mg+2].[O-]S([O-])(=O)=O WRUGWIBCXHJTDG-UHFFFAOYSA-L 0.000 description 1
- 238000007734 materials engineering Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 238000000465 moulding Methods 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 210000004165 myocardium Anatomy 0.000 description 1
- 239000002114 nanocomposite Substances 0.000 description 1
- 239000002086 nanomaterial Substances 0.000 description 1
- 239000002077 nanosphere Substances 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 210000000944 nerve tissue Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229920000620 organic polymer Polymers 0.000 description 1
- 210000004409 osteocyte Anatomy 0.000 description 1
- 230000002138 osteoinductive effect Effects 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 210000004738 parenchymal cell Anatomy 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000000825 pharmaceutical preparation Substances 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 238000012514 protein characterization Methods 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 239000012521 purified sample Substances 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000002278 reconstructive surgery Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 238000001338 self-assembly Methods 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 210000002027 skeletal muscle Anatomy 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 210000004927 skin cell Anatomy 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 229910052938 sodium sulfate Inorganic materials 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000009987 spinning Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000010959 steel Substances 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 210000002435 tendon Anatomy 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 239000002407 tissue scaffold Substances 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 108700012359 toxins Proteins 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000008733 trauma Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000037314 wound repair Effects 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/51—Bone morphogenetic factor; Osteogenins; Osteogenic factor; Bone-inducing factor
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L27/00—Materials for grafts or prostheses or for coating grafts or prostheses
- A61L27/40—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material
- A61L27/44—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material having a macromolecular matrix
- A61L27/48—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material having a macromolecular matrix with macromolecular fillers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L27/00—Materials for grafts or prostheses or for coating grafts or prostheses
- A61L27/40—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material
- A61L27/44—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material having a macromolecular matrix
- A61L27/446—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material having a macromolecular matrix with other specific inorganic fillers other than those covered by A61L27/443 or A61L27/46
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L27/00—Materials for grafts or prostheses or for coating grafts or prostheses
- A61L27/40—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material
- A61L27/44—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material having a macromolecular matrix
- A61L27/46—Composite materials, i.e. containing one material dispersed in a matrix of the same or different material having a macromolecular matrix with phosphorus-containing inorganic fillers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L27/00—Materials for grafts or prostheses or for coating grafts or prostheses
- A61L27/50—Materials characterised by their function or physical properties, e.g. injectable or lubricating compositions, shape-memory materials, surface modified materials
- A61L27/54—Biologically active materials, e.g. therapeutic substances
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43513—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae
- C07K14/43518—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from arachnidae from spiders
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61L—METHODS OR APPARATUS FOR STERILISING MATERIALS OR OBJECTS IN GENERAL; DISINFECTION, STERILISATION OR DEODORISATION OF AIR; CHEMICAL ASPECTS OF BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES; MATERIALS FOR BANDAGES, DRESSINGS, ABSORBENT PADS OR SURGICAL ARTICLES
- A61L2430/00—Materials or treatment for tissue regeneration
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- the claimed invention provides a fusion polypeptide comprising a fibrous protein domain and a mineralization domain.
- the fibrous protein domain is obtained from silk, collagens, coiled-coiled leucine zipper proteins, elastins, keratins, actins, and tubulins.
- the fibrous protein domain comprises an amino acid sequence from the silk protein Spidroin 1, such as the fibrous protein domains indicated by (SEQ ID NO: 1) or (SEQ ID NO: 3), which are derived from Spiroidin 1 of Nephila clavipes .
- a recombinant fibrous protein domain can be generated, which has multiple repeats of a fibrous protein domain.
- the fibrous domain sequence of (SEQ ID NO: 1) is repeated 15 times throughout the fibrous protein domain, which is used in the fusion proteins of the invention, i.e., the fibrous protein domain sequence indicated by (SEQ ID NO: 4), referred to herein as 15mer.
- a fibrous domain sequence of (SEQ ID NO: 1) is repeated 15 times throughout the fibrous protein domain that is used in the fusion proteins of the invention and has a CRGD4 (SEQ ID NO: 2) linker sequence, i.e. the fibrous protein domain sequence indicated by (SEQ ID NO: 5), referred to herein as CRGD-15mer.
- the fusion polypeptide of the invention has a mineralizing domain that is capable of inducing the formation of hydroxyapatite, silica, cadmium sulfide or magnetite.
- the mineralization domain is obtained from dentin matrix protein 1 (DMP1), bone sialoprotein (BSP), or silaffin-1 (Sil1) protein.
- DMP1 dentin matrix protein 1
- BSP bone sialoprotein
- Sil1 silaffin-1
- the mineralization domain is derived from dentin matrix protein 1 (DMP1) and is (SEQ ID NO: 6) or (SEQ ID NO: 7).
- the mineralization domain is derived from bone sialoprotein (BSP) and is (SEQ ID NO: 8).
- the mineralizing domain is selected from the group consisting of the 19 amino-acid R5 peptide of the Sil1 protein (SEQ ID NO: 17), the R2 peptide of the Sil1 protein (SEQ ID NO: 18), the 19 amino-acid R3 peptide of the Sil1 protein (SEQ ID NO: 19), the 19 amino-acid R6 peptide of the Sil1 protein (SEQ ID NO: 20) and the 15 amino-acid R1 peptide of the Sil1 protein (SEQ ID NO: 21).
- the invention also provides for the following fusion polypeptides that comprise a fibrous protein domain and a mineralization domain: the fusion polypeptide (SEQ ID NO: 9), the fusion polypeptide (SEQ ID NO: 10), the fusion polypeptide (SEQ ID NO: 11), the fusion polypeptide (SEQ ID NO: 12), a fusion polypeptide comprising a fusion of the 15 mer silk fibrous protein domain (SEQ ID NO: 4) and the R5 peptide of the Sil1 protein (SEQ ID NO: 17) and a fusion polypeptide comprising a fusion of the CRGD-15 mer silk fibrous protein domain (SEQ ID NO: 5) and the R5 peptide of the Sil1 protein (SEQ ID NO: 17).
- a method for forming a fibrous protein inorganic-composite material comprises (a) contacting the fusion proteins of the invention with an inorganic material capable of mineralizing for a sufficient period of time to allow mineralization of the inorganic material.
- the fusion proteins of the invention are formed into a silk film, foam or sponge prior to deposition of inorganic material (mineralization).
- the inorganic material is capable of forming hydroxyapatite or silica.
- the fiber, film, or sponge further comprises an agent.
- the inorganic coating formed on the fibrous protein comprises an agent.
- the agent is selected from the group consisting of a protein, peptide, nucleic acid, PNA, aptamer, antibody or a small molecule.
- the claimed invention also provides for biomaterial products produced by the methods of the invention.
- FIGS. 1A and 1B show diagrammatic illustrations of fibrous protein domain-mineralization domain fusion proteins.
- FIG. 1A shows three claimed fusion proteins composed of a spider silk fibrous protein domain ((CRGD-15mer) (See (SEQ ID NO: 5)) and a dentin matrix protein 1 (DMP 1) mineralization domain.
- CRGD-15mer spider silk fibrous protein domain
- DMP 1 dentin matrix protein 1
- the fusion proteins contain a mineralization domain of either 1) the full length amino acid sequence of DMP 1 (See (SEQ ID NO: 7)), 2) the C-terminal end of DMP1, (See (SEQ ID NO: 6)) or a composite sequence based on DMP1, which contains the collagen binding domain 1 (CD 1) of DMP1, two acidic clusters in DMP1 that are responsible for hydroxyapatite nucleation (pA and pB) and the collagen binding domain 2 (CD2) of DMP1.
- FIG. 1B shows a diagram of two fusion proteins, 1) fusion of a spider silk fibrous protein domain (CRGD-15mer (See (SEQ ID NO: 5)) and a bone sialoprotein mineralizing domain (BSP) (See (SEQ ID NO: 8)) and 2) fusion of a spider silk fibrous protein domain 15-mer (without CRGD linker) (See (SEQ ID NO: 4)) and a bone sialoprotein mineralizing domain (BSP) (See SEQ ID NO: 8).
- CRGD-15mer See (SEQ ID NO: 5)
- BSP bone sialoprotein mineralizing domain
- BSP bone sialoprotein mineralizing domain
- FIG. 2 shows the sequence of the fusion protein CRGD-15mer-CDMP1 (SEQ ID NO: 9).
- CRGD-15mer-CDMP1 is a fusion protein of a spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the C-terminal end of DMP1 mineralizing domain (See, SEQ ID NO: 6), which is indicated with light grey highlight.
- FIG. 3 shows the sequence of the fusion protein CRGD-15mer-DMP1 (SEQ ID NO: 10).
- CRGD-15mer-DMP1 is a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the full length sequence of DMP1 mineralizing domain (See, SEQ ID NO: 7), which is indicated with light grey highlight.
- FIG. 4 shows the sequence of the fusion protein 15mer-BSP (SEQ ID NO: 11).
- 15mer-BSP is a fusion protein of spider silk fibrous protein domain ((15mer) (See, SEQ ID NO: 4), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight.
- FIG. 5 shows the sequence of the fusion protein CRGD-15mer-BSP (SEQ ID NO: 12).
- CRGD-15mer-BSP a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight.
- BSP bone sialoprotein
- FIGS. 6A to 6C show scanning electron microscope (SEM) images of recombinant silk film made from CRGD-15mer-CDMP1, See Example 1.
- FIG. 6A image of silk film morphology prior to mineralization (HFIP+MeOH).
- FIG. 6B image of silk film morphology after one round of mineralization.
- FIG. 6C image of silk film morphology after three rounds of mineralization.
- FIGS. 7A to 7B show the sequence of the fusion proteins CRGD15mer-R5 (SEQ ID NO: 25) and 15mer-R5 (SEQ ID NO: 25) as described in Example II.
- the underlined sequence represents the monomeric repeat unit selected and used in the design of the recombinant proteins based on the consensus sequence of spidroin1 (Maspl) native sequence of Nephila clavipes (Accession #P19837).
- FIG. 8 shows a grid of SEM of untreated and methanol treated silk films formed from the four different genetically engineered silk proteins CRGD15mer, 15mer, CRGD15mer-R5, and 15mer-R5 as described in Example 2. Images of the control films and the films that underwent silicification reactions are shown.
- FIGS. 9A to 9E show SEM images of untreated and methanol treated electropun CRGD15mer-R5 silk fibers before, during and after silicification reactions, as described in Example 2.
- FIG. 9A untreated electrospun CRGD15mer-R5 silk fibers.
- FIG. 9B electrospun CRGD15mer-R5 silk fibers methanol treated before silification.
- FIGS. 9C , 9 D and 9 E electrospun CRGD15mer-R5 silk fibers during silification at 20 um and 2 um scale.
- FIGS. 10A to 10B show XPS analysis, as described in Example 2, of CRGD15mer-R5 and silicified CRGD15mer-R5 on A1 foil and on silicon chip at the characteristic binding energies of ( FIG. 10A ) 153 eV and ( FIG. 10B ) 102 eV for electrons found in the 2s and 2p3 electron shells of the silicon atom respectively.
- FIG. 11 shows Fourier transform infared spectroscopy (FTIR) analysis of the structure of CRGD-15mer-CDMP1 before and after Ca ion binding, as described in Example 1.
- FTIR Fourier transform infared spectroscopy
- FIG. 12 shows FTIR analysis of structure of CRGD-15mer-CDMP1 before and after treatment with methanol, as described in Example 1.
- FIGS. 13 (A 1 ) to 13 (A 5 ) and 13 (B 1 ) to 13 (B 5 ) show Scanning Electron Microscopy (SEM) surface morphologies of recombinant spider silk films after soaking in 1.5 ⁇ SBF for various periods of time, as described in Example 1.
- FIG. 13 (B 1 )-FIG. 13 (B 5 ) SS15m soaked in 1.5 ⁇ SBF for 0, 3,7,14 and 21 days: FIG. 13 (B 1 )-FIG. 13 (B 5 ) respectively.
- Scale bars are 2 ⁇ m.
- FIGS. 14A to 14C show Transmission Electron Microscopy (TEM) images of crystals grown on CRGD-15mer-CDMP1 after soaking in 1.5 ⁇ SBF for 21 days, as described in Example 1.
- FIG. 14A image of flake-like apatite
- FIG. 14B electron diffraction pattern
- FIG. 14C high-resolution image of apatite crystal.
- Fibrous proteins represent an important category of proteins in biology, forming native structural entities both internally in organisms (e.g., collagens) and externally (such as spun silk fibers for webs and cocoons).
- silk proteins from spiders and insects provide a number of valuable materials features.
- functional domains When combined with functional domains, then the materials properties available from silks become significantly expanded.
- various domains from biology known to promote the formation of inorganic structures e.g., promote formation of minerals, have been combined with a fibrous protein domain.
- these new fusion (composite) materials offer the benefits of the fibrous protein material features (e.g, silks) plus the benefit of the inorganic mineralization domains (e.g., hardness).
- the present invention provides a fusion polypeptide comprising a fibrous protein domain and a mineralization domain.
- the fusion is used to form an organic-inorganic composite.
- organic-inorganic composites can be constructed from the nano- to the macro-scale depending on the size of the fibrous protein fusion domain used.
- the composites can also be loaded with other compounds (e.g., dyes, drugs, enzymes) depending on the goal for the materials, to further enhance function. This can be achieved during assembly of the material or during the mineralization step in materials formation.
- the fusion polypeptides of the present invention can be used for production of silk biomaterials, e.g., fibers, films, foams and mats. See, WO 03/022909. An all-aqueous process may be used. See, WO 03/022909.
- the invention provides a method for forming a composite material.
- the method comprises contacting a template formed from a fusion polypeptide of the invention with a suitable inorganic material for a sufficient period of time to allow mineralization of the inorganic material thus forming an inorganic coating on the template.
- the template is in the form of a fiber, film, or sponge.
- growth factors, biological components or others agents, including therapeutic agents are incorporated into the inorganic coating.
- the growth factors, biological components or other agents can be incorporated during the formation of the template or during the crystallization process.
- Such composites can be used to deliver such components to cells and tissues.
- the ability to incorporate growth factors, biological regulators, enzymes, therapeutics, or cells in the construct of the present invention provides for stabilization of these components for long term release and stability, as well as better control of activity and release.
- the products produced by these methods offer new options in the formation of scaffolds for biomaterials, tissue engineering applications and drug delivery. While the templates are useful in and of themselves, the ability to form inorganic coatings with controlled thickness leads to control of mechanical properties (e.g., stiffness) and biological interactions, such as for bone formation. Furthermore, the ability to control these processes allows one to match structural and functional performance of scaffolds for specific tissue targets and needs.
- the underlying template e.g., fusion polypeptide formed into a film etc.
- the underlying template can be removed or etched away to generate porous networks, tubes, or lamellar sheets of inorganic material.
- These materials are useful directly as biomaterial scaffolds, for control of cell and tissue growth (e.g., as nerve conduits, bone conduits) and for nonbiological applications (e.g., filtration and separation media, catalysis, decontamination (directly or if filled with appropriate chemical or enzymes), radar chaff, coatings in general, and many related needs, for example, inorganic fillers to toughen materials that can also be filled with a second component.
- the fusion polypeptides may be created, for example, by chemical synthesis, or by creating and translation a polynucleotide in which the peptide regions are encoded in the desired relationship.
- Silks are unique in their self-assembly, formation of robust materials in the form of fibers, films and 3D matrices, and are polymorphic (the structure can be controlled among many assembly states). For example, silk fibers are the strongest known fibers and rival even high performance fibers. They are also effective in resisting compression. In 3D porous matrices the compressive resistance exceeds other commonly used organic polymers as biomaterial matrices. Inorganic domains, including silica and hydroxyapatite are prominent in biological systems as key inorganic components found associated with proteins. These mineral phases dominate skeletal components of most systems.
- the fibrous protein domain can include short to long versions, with the size in part influencing the scale of the composite from the nano to the macro level.
- the size can range from a single sized hydrophobic block of 50 amino acids, up to multiple blocks as large as desired including up to proteins of sizes in the 100,000s of Daltons.
- the fibrous protein fusion domain could include other proteins such as collagens, coiled-coiled leucine zipper proteins, elastins, keratins, actins, and tubulins.
- the silk protein suitable for use in the present invention is preferably fibroin or related proteins (i.e., silks from spiders).
- the silkworm silk is obtained, for example, from Bombyx mori .
- Spider silk may be obtained from Nephila clavipes See, for example, WO 97/08315 and U.S. Pat. No. 5,245,012.
- Mineralizing domains include those that can induce the formation of hydroxyapatite (Example 1), silica (Example 2), cadmium sulfide, and magnetite.
- a mineralizing domain that can induce hydroxyapatite nucleation is obtained from dentin matrix protein 1 or bone sialoprotein (G. He, T. Dahl, A. Veis and A. George. Connective Tissue Res. 2003, 44 (Suppl. 1): 240-245; and G. He, T. Dahl, A. Veis and A. George. Nature materials. 2003, 2(8): 552-558; Stubbs et al. J Bone Miner Res. 1997 August; 12(8):1210-22).
- the full molecule or a minimum portion that can induce mineralization can be used, for example, a 37 amino acid segment from DMP (C-terminus) will induce controlled mineralization of hydroxyapatite.
- the mineralization domains were fused to a sequence derived from spider silk having the following silk fibrous domain repeated 15 times (SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT) (SEQ ID NO: 1) in order to generate functional recombinant silks that possess both robust mechanical properties of the spider silk and the ability to promote mineralization.
- the recombinant proteins were cloned in pET21a(+) vector and expressed in E. coli .
- the functional recombinant silks (silk fusion proteins) of the present invention have potential application in biomaterials, tissue engineering, advanced material composites and biosensors.
- the mineralizing domain is capable of inducing the formation of hydroxyapatite, silica, cadmium sulfide, magnetite and other metal salts pending choice of peptide domain utilized.
- Preferred mineralizing domains include, for example, dentin matrix protein 1 (DMP1), bone sialoprotein, and fragments of these proteins, and the 19 amino-acid R5 peptide of the Sil1 protein.
- fibrous proteins and mineralizing domains can also be included in this system using the template provided.
- peptides identified from other native proteins or identified by combinatorial screening methods can be used. Screening methods can involve any mineralization assay known in the art, for example the hydroxyapatite and silicification assays described herein.
- fusion proteins containing a mineralization domain and a fibrous protein domain can be made using standard molecular biology methods well known to those skilled in the art (See for example, Sambrook et al., Molecular Biology: A laboratory Approach , Cold Spring Harbor, N.Y. 1989; Ausubel, et al., Current protocols in Molecular Biology , Greene Publishing, Y, 1995).
- the fusion proteins of the invention are made using linker sequences.
- linker sequence refers to a short (e.g., about 1-20 amino acids) sequence of amino acids that is not part of the sequence of either of two polypeptides being joined.
- a linker sequence is attached on its amino-terminal end to one polypeptide or polypeptide domain and on its carboxyl-terminal end to another polypeptide or polypeptide domain.
- vector refers to a discrete element that is used to introduce heterologous DNA into cells for the expression and/or replication thereof. Methods by which to select or construct and, subsequently, use such vectors are well known to one of skill in the art. Numerous vectors are publicly available, including bacterial plasmids, bacteriophage, artificial chromosomes, episomal vectors and gene expression vectors. A vector of use according to the invention may be selected to accommodate a polypeptide coding sequence of a desired size.
- Host cells may be prokaryotic, such as any of a number of bacterial strains, or may be eukaryotic, such as yeast or other fungal cells, insect or amphibian cells, or mammalian cells including, for example, rodent, simian or human cells.
- Each vector contains various functional components, which generally include a cloning (or “polylinker”) site, an origin of replication and at least one selectable marker gene.
- given vector is an expression vector, it additionally possesses one or more of the following: enhancer element, promoter, transcription termination and signal sequences, each positioned in the vicinity of the cloning site, such that they are operatively linked to the gene encoding a polypeptide repertoire member according to the invention.
- Both cloning and expression vectors generally contain nucleic acid sequences that enable the vector to replicate in one or more selected host cells.
- this sequence is one that enables the vector to replicate independently of the host chromosomal DNA and includes origins of replication or autonomously replicating sequences.
- origins of replication or autonomously replicating sequences are well known for a variety of bacteria, yeast and viruses.
- the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria
- the 2 micron plasmid origin is suitable for yeast
- various viral origins e.g. SV 40, adenovirus
- the origin of replication is not needed for mammalian expression vectors unless these are used in mammalian cells able to replicate high levels of DNA, such as COS cells.
- a cloning or expression vector may contain a selection gene also referred to as a selectable marker.
- This gene encodes a protein necessary for the survival or growth of transformed host cells grown in a selective culture medium. Host cells not transformed with the vector containing the selection gene will therefore not survive in the culture medium.
- Typical selection genes encode proteins that confer resistance to antibiotics and other toxins, e.g. ampicillin, neomycin, methotrexate or tetracycline, complement auxotrophic deficiencies, or supply critical nutrients not available in the growth media.
- an E. coli - selectable marker for example, the ⁇ -lactamase gene that confers resistance to the antibiotic ampicillin, is of use.
- E. coli plasmids such as pBR322 or a pUC plasmid such as pUC18 or pUC19, or pUC119.
- Expression vectors usually contain a promoter that is recognized by the host organism and is operably linked to the coding sequence of interest. Such a promoter may be inducible or constitutive.
- operably linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
- a control sequence “operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
- Promoters suitable for use with prokaryotic hosts include, for example, the ⁇ -lactamase and lactose promoter systems, alkaline phosphatase, the tryptophan (trp) promoter system and hybrid promoters such as the tac promoter. Promoters for use in bacterial systems will also generally contain a Shine-Delgarno sequence operably linked to the coding sequence. Preferred promoters for use in the present invention are the isopropylthiogalactoside (IPTG)-regulatable promoters.
- IPTG isopropylthiogalactoside
- the fusion protein of the invention further comprises a tag, e.g. Flag, His, Myc, HA, VSV, or V5, to aid in purification of the protein by standard means.
- a tag e.g. Flag, His, Myc, HA, VSV, or V5
- the fusion protein can be lyophilized or suspended in aqueous solution for preparation of silk materials, such as films, foams or fibers.
- silk fusion proteins of the invention can be processed into films, foams or fibers.
- silk fibroin or “silk protein” refers to a silk fusion protein of the invention.
- Fibers can be formed by electrospinning Electrospinning can be performed by any means known in the art (see, for example, U.S. Pat. No. 6,110,590).
- a steel capillary tube with a 1.0 mm internal diameter tip is mounted on an adjustable, electrically insulated stand.
- the capillary tube is maintained at a high electric potential and mounted in the parallel plate geometry.
- the capillary tube is preferably connected to a syringe filled with silk/biocompatible polymer solution.
- a constant volume flow rate is maintained using a syringe pump, set to keep the solution at the tip of the tube without dripping.
- the electric potential, solution flow rate, and the distance between the capillary tip and the collection screen are adjusted so that a stable jet is obtained. Dry or wet fibers are collected by varying the distance between the capillary tip and the collection screen.
- a collection screen suitable for collecting silk fibers can be a wire mesh, a polymeric mesh, or a water bath.
- the collection screen is an aluminum foil.
- the aluminum foil can be coated with Teflon fluid to make peeling off the silk fibers easier.
- Teflon fluid to make peeling off the silk fibers easier.
- One skilled in the art will be able to readily select other means of collecting the fiber solution as it travels through the electric field.
- the electric potential difference between the capillary tip and the aluminum foil counter electrode is, preferably, gradually increased to about 12 kV, however, one skilled in the art should be able to adjust the electric potential to achieve suitable jet stream.
- the process of the present invention may further comprise steps of immersing the spun fiber into an alcohol/water solution to induce crystallization of silk.
- the composition of alcohol/water solution is preferably 90/10 (v/v).
- the alcohol is preferably methanol, ethanol, isopropyl alcohol (2-propanol) or n-butanol. Methanol is most preferred.
- the process may further comprise the step of washing the fibroin fiber in water.
- the biomaterial is a film.
- the process for forming the film comprises, for example, the steps of (a) preparing an aqueous silk fibroin solution comprising silk protein; (b) adding a biocompatible polymer to the aqueous solution; (c) drying the mixture; and (d) contacting the dried mixture with an alcohol (preferred alcohols are listed above) and water solution to crystallize a silk blend film.
- the biocompatible polymer is poly(ethylene oxide) (PEO).
- the process for producing the film may further include step (e) of drawing or mono-axially stretching the resulting silk blend film to alter or enhance its mechanical properties. The stretching of a silk blend film induces molecular alignment in the fiber structure of the film and thereby improves the mechanical properties of the film.
- the biomaterial is a foam.
- Foams may be made from methods known in the art, including, for example, freeze-drying and gas foaming in which water is the solvent or nitrogen or other gas is the blowing agent, respectively.
- the foam is a micropatterned foam.
- Micropatterned foams can be prepared using, for example, the method set forth in U.S. Pat. No. 6,423,252, the disclosure of which is incorporated herein by reference.
- the claimed invention provides a method for forming an organic-inorganic composite material.
- the method comprises contacting a template (such as recombinant silk films, sponges or fibers) formed from a fusion polypeptide of the invention with a suitable inorganic material for a sufficient period of time to allow mineralization of the inorganic material.
- Mineralized material is deposited onto the silk forming an inorganic coating on the template.
- the procedure for mineralization of the coating is dependent upon the mineralization domain that is part of the fusion polypeptide of the invention.
- the mineralizing domain of dentin matrix protein 1 (DMP1) an acidic phosphoprotein secreted into the extracellular matrix during the formation and mineralization of bone and dentin, is involved in the precipitation of hydroxyapatite, the main inorganic component in calcified hard tissue such as bone and teeth of vertebrates (Koutsopoulos, S. J Biomed Mater Res. 2002, 62: 600-612).
- the mineralizing domain of Silaffin protein is involved in the precipitation of silica.
- the biomaterial products produced by the processes of the present invention may be used in a variety of medical applications such as wound closure systems, including vascular wound repair devices, hemostatic dressings, patches and glues, sutures, drug delivery and in tissue engineering applications, such as, for example, scaffolding, ligament prosthetic devices and in products for long-term or bio-degradable implantation into the human body.
- tissue engineering applications such as, for example, scaffolding, ligament prosthetic devices and in products for long-term or bio-degradable implantation into the human body.
- a preferred tissue engineered scaffold is a non-woven network of electrospun fibers.
- these biomaterials can be used for organ repair replacement or regeneration strategies that may benefit from these unique scaffolds, including but are not limited to, spine disc, cranial tissue, dura, nerve tissue, liver, pancreas, kidney, bladder, spleen, cardiac muscle, skeletal muscle, tendons, ligaments and breast tissues.
- silk biomaterials can contain therapeutic agents.
- the polymer would be mixed with a therapeutic agent prior to forming the material or loaded into the material after it is formed.
- the agent can be incorporated into the inorganic coating formed by the silk fusion protein mineralization domain by mixing it with the mineralization solution.
- therapeutic agents which may be administered via the pharmaceutical compositions of the invention include, without limitation: antiinfectives such as antibiotics and antiviral agents; chemotherapeutic agents (i.e.
- anticancer agents anti-rejection agents; analgesics and analgesic combinations; anti-inflammatory agents; hormones such as steroids; growth factors (bone morphogenic proteins (i.e. BMP's 1-7), bone morphogenic-like proteins (i.e. GFD-5, GFD-7 and GFD-8), epidermal growth factor (EGF), fibroblast growth factor (i.e. FGF 1-9), platelet derived growth factor (PDGF), insulin like growth factor (IGF-I and IGF-II), transforming growth factors (i.e. TGF-.beta.I-III), vascular endothelial growth factor (VEGF)); and other naturally derived or genetically engineered proteins, polysaccharides, glycoproteins, or lipoproteins.
- growth factors are described in The Cellular and Molecular Basis of Bone Formation and Repair by Vicki Rosen and R. Scott Thies, published by R. G. Landes Company hereby incorporated herein by reference.
- Silk biomaterials containing bioactive materials may be formulated by mixing one or more therapeutic agents with the polymer used to make the material.
- a therapeutic agent could be coated on to the material preferably with a pharmaceutically acceptable carrier. Any pharmaceutical carrier can be used that does not dissolve the foam.
- the therapeutic agents may be present as a liquid, a finely divided solid, or any other appropriate physical form.
- the matrix will include one or more additives, such as diluents, carriers, excipients, stabilizers or the like.
- the amount of therapeutic agent will depend on the particular drug being employed and medical condition being treated. Typically, the amount of drug represents about 0.001 percent to about 70 percent, more typically about 0.001 percent to about 50 percent, most typically about 0.001 percent to about 20 percent by weight of the material. Upon contact with body fluids the drug will be released.
- the biocompatible polymer may be extracted from the biomaterial prior to use. This is particularly desirable for tissue engineering applications. Extraction of the biocompatible polymer may be accomplished, for example, by soaking the biomaterial in water prior to use.
- the tissue engineering scaffolds biomaterials can be further modified after fabrication.
- the scaffolds can be coated with bioactive substances that function as receptors or chemoattractors for a desired population of cells.
- the coating can be applied through absorption or chemical bonding.
- Additives suitable for use with the present invention include biologically or pharmaceutically active compounds.
- biologically active compounds include cell attachment mediators, such as the peptide containing variations of the “RGD” integrin binding sequence known to affect cellular attachment, biologically active ligands, and substances that enhance or exclude particular varieties of cellular or tissue ingrowth.
- Such substances include, for example, osteoinductive substances, such as bone morphogenic proteins (BMP), epidermal growth factor (EGF), fibroblast growth factor (FGF), platelet-derived growth factor (PDGF), vascular endothelial growth factor (VEGF), insulin-like growth factor (IGF-I and II), TGF-and the like.
- BMP bone morphogenic proteins
- EGF epidermal growth factor
- FGF fibroblast growth factor
- PDGF platelet-derived growth factor
- VEGF vascular endothelial growth factor
- IGF-I and II insulin-like growth factor
- the scaffolds are shaped into articles for tissue engineering and tissue guided regeneration applications, including reconstructive surgery.
- the structure of the scaffold allows generous cellular ingrowth, eliminating the need for cellular preseeding.
- the scaffolds may also be molded to form external scaffolding for the support of in vitro culturing of cells for the creation of external support organs.
- the scaffold functions to mimic the extracellular matrices (ECM) of the body.
- ECM extracellular matrices
- the scaffold serves as both a physical support and an adhesive substrate for isolated cells during in vitro culture and subsequent implantation. As the transplanted cell populations grow and the cells function normally, they begin to secrete their own ECM support.
- tissue shape is integral to function, requiring the molding of the scaffold into articles of varying thickness and shape. Any crevices, apertures or refinements desired in the three-dimensional structure can be created by removing portions of the matrix with scissors, a scalpel, a laser beam or any other cutting instrument.
- Scaffold applications include the regeneration of tissues such as nervous, musculoskeletal, cartilaginous, tendenous, hepatic, pancreatic, ocular, integumenary, arteriovenous, urinary or any other tissue forming solid or hollow organs.
- the scaffold may also be used in transplantation as a matrix for dissociated cells, e.g., chondrocytes or hepatocytes, to create a three-dimensional tissue or organ.
- Any type of cell can be added to the scaffold for culturing and possible implantation, including cells of the muscular and skeletal systems, such as chondrocytes, fibroblasts, muscle cells and osteocytes, parenchymal cells such as hepatocytes, pancreatic cells (including Islet cells), cells of intestinal origin, and other cells such as nerve cells, bone marrow cells, skin cells and stem cells, and combination thereof, either as obtained from donors, from established cell culture lines, or even before or after genetic engineering.
- Pieces of tissue can also be used, which may provide a number of different cell types in the same structure.
- the cells are obtained from a suitable donor, or the patient into which they are to be implanted, dissociated using standard techniques and seeded onto and into the scaffold.
- In vitro culturing optionally may be performed prior to implantation.
- the scaffold is implanted, allowed to vascularize, then cells are injected into the scaffold.
- Methods and reagents for culturing cells in vitro and implantation of a tissue scaffold are known to those skilled in the art.
- the biomaterials of the claimed invention may be sterilized using conventional sterilization process such as radiation based sterilization (i.e. gamma-ray), chemical based sterilization (ethylene oxide) or other appropriate procedures.
- radiation based sterilization i.e. gamma-ray
- chemical based sterilization ethylene oxide
- the sterilization process will be with ethylene oxide at a temperature between 52-55° C. for a time of 8 hours or less.
- the biomaterials may be packaged in an appropriate sterilize moisture resistant package for shipment and use in hospitals and other health care facilities.
- Hydroxyapatite (HAP, Ca 5 (PO 4 ) 3 (OH)) is the most stable calcium phosphate salt at normal temperature and pH between 4 and 12 (Aaron, S. Posner Physiological review, 1969, 49(4): 760-792). Hydroxyapatite is the main inorganic component in calcified hard tissue such as bone and teeth of vertebrates (Koutsopoulos, S. J Biomed Mater Res. 2002, 62: 600-612). In addition, hydroxyapatite also has many applications in protein chromatography, water treatment processes, fertilizer and pharmaceutical products (Bailliez, S.; Nzihou, A.; Beche, E.; Flamant, G.
- hydroxyapatite contributes to its stiffness, while organic matrix contributes to its plasticity (Landis, W. J. Bone, 16(5): 533-544).
- the inherent strength and other mechanical properties of the skeletal system are thought to depend on an interaction between its organic and inorganic matrix strength, here hydroxyapatite.
- hydroxyapatite One example is the composite formed between the normal mineral salt, hydroxyapatite, and collagen, the principal organic component of the vertebrate skeleton, able to resist a wide range of compressive or tensile forces whereas either material alone can not (Chen, Q. Z.; Wong, C. T.; Lu, W. W.; Cheung, K. M. C.; Leong, J. C. Y. and Luk, K. D. K. Biomaterials, 2004, 25: 4243-4254).
- DMP dental matrix protein
- DMP1 Dentin matrix protein 1
- DMP1 is an acidic phosphoprotein secreted into the extracellular matrix during the formation and mineralization of bone and dentin, therefore, it is believed that DMP 1 plays an important role in the initiation of mineralization (J. Q. Feng, H. Huang, Y. Lu, L. Ye, Y. Xie, T. w. Tsutsui, T. Kunieda, T. Castranio, G. Scott, L. B. Bonewald, and Y. Mishina. J Dent Res. 2003, 82(10): 776-780; W. T. Butler, H. Ritchie. Int J Dev Biol, 1995, 39: 169-179; George, B. Sabsay, P.A.L.
- FIG. 2 shows the sequence of CRGD-15mer-CDMP1, a fusion protein of a spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the C-terminal end of DMP 1 mineralizing domain (See, SEQ ID NO: 6), which is indicated with light grey highlight.
- FIG. 3 shows the sequence of the fusion protein CRGD-15mer-DMP1 (SEQ ID NO: 10).
- CRGD-15mer-DMP1 is a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the full length sequence of DMP1 mineralizing domain (See, SEQ ID NO: 7), which is indicated with light grey highlight.
- FIG. 4 shows the sequence of the fusion protein 15mer-BSP (SEQ ID NO: 11).
- 15mer-BSP is a fusion protein of spider silk fibrous protein domain ((15mer) (See, SEQ ID NO: 4), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight.
- FIG. 5 shows the sequence of the fusion protein CRGD-15mer-BSP (SEQ ID NO: 12).
- CRGD-15mer-BSP a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight.
- the consensus repeat unit of spider silk (-SGRGGLGGQGAGAAAAAGGAGQGGY GGLGSQGT-) (SEQ ID NO: 1) was derived from the native sequence of the spidroin 1 of N. clavipes (accession P19837).
- the construction of the expression vector pET30a (+) containing 15 repeats of the silk was previously described (Bini et al., 2005) and was termed pET30a (+)-15mer.
- Plasmid containing the rat dentin matrix protein 1 cDNA (pGEX-DMP1) was previously described (Feng et al., J. Dent. Res. 2003, 82(10):776-780).
- Primers with BamHI and XhoI restriction enzyme sites were designed in order to copy the C-terminal portion of rat DMP 1 from pGEX-DMP 1 by PCR: BamH I site, C-DMP1f: 5′-CAG GATCC AGGGGTGACAACCCAGAT-3′ (SEQ ID NO: 26) and Xho I site, C-DMP1r: 5′-GCC TCGAGG TAGCCATCTTGGCAATC-3′ (SEQ ID NO: 27).
- PCR products were double digested with BamHI and XhoI before running on a 1% agarose gel.
- the band of C-terminal DMP1 DNA were cut from gel and purified using a MinElute gel extraction kit.
- Expression vector pET21a (+) was also double digested with BamHI and XhoI before running on a 0.8% agarose gel.
- the band of linearized pET21a (+) was purified using a QIAquick gel extraction kit.
- pET21a (+)-CDMP 1 After determining the DNA concentration of the vector pET21a (+) and insert of C-terminal DMP1 based on intensities of 1 ⁇ l of each in a 1% gel against 1 ⁇ l of high mass DNA ladder, the ligation reactions were performed using a Quick ligation KitTM based on an insert to vector molar ratio of 5:1. Fifty ⁇ l of one Shot® Mach1TM T1 phage-resistant cells were transformed with 1 ⁇ l of ligation reaction. The correct clone of vector pET21a (+) containing C-terminal DMP 1, named as pET21a (+)-CDMP 1 was determined by DNA sequencing with forward and reverse T7 primers.
- pET21a (+)-CDMP1 was digested with BamHI and dephosphorylated with CIP before running on 0.8% agarose gel.
- the linearized vector was purified using a QIAquick gel extraction kit.
- pET30a (+)-15mer was digested with BamHI before running on 1% agarose gel and the DNA encoding the repeat unit of spider silk was purified using a MinElute gel extraction kit.
- the DNA concentrations of the vector pET21a (+)-CDMP1 and the insert: spider silk 15 mer were determined using the same method as described above.
- the spider silk 15 mer was then inserted into pET21a (+)-CDMP1 at the BamHI site by ligation reaction and the resulting vector was named as pET21a (+)-SS15m-CDMP1.
- DNA sequencing with forward and reverse T7 primers was performed to check the sequences of the vector.
- Expression plasmid pET21a (+)-SS15m-CDMP1 was transformed into Escherichia coli RY-3041 strain, kindly provided by Professor Ry Young (Texas A&M University, College Station, Tex.). High cell density cultivation using a 1.25 liter jar fermentor (Bioflo 3000; New Brunswick Scientific Co., Edison, N.J.) was performed as described previously (Butler et al. Int. J. Dev. Biol. 1995, 39: 169-179). Expression was induced by adding isopropyl- ⁇ -D-thiogalactoside to a final concentration of 2 mM at the early log phase when A 600 was about 30.
- 0.2 mg/mL protein aqueous solution was prepared by the method described in protein expression and purification. Calcium chloride solution (1M) was added such that a molar ratio of protein to Ca ion was maintained at 1:1000. Protein secondary structures before and after adding Ca ion were studied by Fourier Transform Infrared Spectroscopy (FTIR). FTIR studies were performed using a Bruker Tensor 27 FTIR spectrometer with a BioATR accessory.
- FTIR Fourier Transform Infrared Spectroscopy
- Recombinant proteins were dissolved in hexafluoroisopropanol (HFIP) to a final concentration of 2% w/v.
- HFIP hexafluoroisopropanol
- One-hundred ⁇ l of silk HFIP solution was loaded onto a silica wafer and dried in hood. Dried silk film was treated with 90% methanol to induce the transition of secondary structure from random coil to beta sheet. Concentrated silk aqueous solution was then loaded onto silk film and incubated at 37° C. overnight to dry.
- 1.5 ⁇ SBF 1.5 ⁇ simulated body fluid
- 1.5 ⁇ SBF was prepared as described previously (3) by dissolving reagent grade CaCl 2 , KH 2 PO 4 , NaCl, KCl, MgCl 2 .6H 2 O, NaHCO 3 , Na 2 SO 4 in distilled water and buffering at pH 7.3 with tris-hydroxymethyl aminomethane and hydrochloric acid (HCl).
- a 1.5 ⁇ SBF solution contains 1.5 times higher ion concentration than the SBF solution with ion concentrations close to human blood plasma.
- Fresh 1.5 ⁇ SBF was prepared daily to replace the 1.5 ⁇ SBF. After the silk coated silica wafers were soaked in 1.5 ⁇ SBF for 3, 7, 14 and 21 days, they were removed, gently rinsed with distilled water and dried at room temperature.
- Samples for transmission electron microscopy (TEM) analysis were prepared by ultrasonicating of the silk films after incubation in 1.5 ⁇ SBF in 200 ⁇ L of absolute ethanol for 10 min and then depositing a few drops of the suspension onto a standard TEM copper grid with a holey carbon support film.
- TEM images were obtained with a JOEL 2100 TEM operating at 200 kV with a LaB 6 filament and recorded with a slow scan CCD camera. The diffraction patterns were obtained at calibrated camera lengths using a NiO x test specimen as a reference.
- CRGD-15mer molecular weight of which is 48.56 kDa, migrated to the right position on SDS-PAGE gel, while the apparent molecular weight of CRGD-15mer-CDMP1 indicated by SDS-PAGE electrophoresis was higher than the calculated molecular weight, which is 58.89 kDa. This is due to high content of acidic amino acids such as aspartic acid and glutamic acid in CRGD-15mer-CDMP1. Western blot analysis of CRGD-15mer-CDMP1 and CRGD-15mer-CDMP1 was detected based on the His tag (data not shown).
- CRGD-15mer-CDMP1 was unordered random coil in water before adding CaCl 2 , indicated by amide I peak at 1649 cm ⁇ 1 and amide II peak at 1548 cm ⁇ 1 . After Ca ion binding, a helix and ⁇ sheet structures showed up, demonstrated by amide I peak at 1659 cm ⁇ 1 ( ⁇ helix) and 1632 cm ⁇ 1 ( ⁇ sheet) ( FIG. 11 ).
- the apatite nucleation ability of the functional recombinant silks was studied using the method of alternate soaking process.
- Silk films of the recombinant fusion proteins were cast using standard methods. Lyophilized fusion proteins were dissolved in HFIP solvent at a concentration of 2.5% w/v overnight at 4° C. The silk-HFIP solutions were then pipetted into 24-well culture plates and left in the hood for about 3 hours for the silk films to form and dry out. The silk films were then treated with 90% v/v methanol to induce ⁇ -sheet formation and prevent resolubilization of the films in aqueous solutions.
- the cast recombinant silk film was first soaked in 200 mM aqueous calcium chloride solution buffered with tris(hydroxymethyl) aminomethane and HCl (pH 7.4) (Ca solution) for 1 hr at 37° C., then Ca solution was aspirated and the film was washed with abundant distilled water to wash way any unbound Ca 2+ , then 120 mM aqueous disodium hydrogenphosphate (P solution) was added to immerse the silk film for 1 hr at 37° C. After soaking in P solution for 1 hr, the film was washed again by distilled water. This is one round of mineralization. Three rounds of the soaking were carried out.
- FIGS. 6A-6C show mineral deposition on silk film cast using CRGD-15mer-CDMP1. Deposition began to occur as in round one ( FIG. 6B ) and continued through round three ( FIG. 6C ). Control films made from CRGD-15mer and 15mer showed no deposition (data not shown).
- the SEM images indicate that the functional fusion silk proteins are capable of inducing apatite nucleation and growth, while silk proteins that so not contain mineralizing domains do not promote apatite nucleation.
- FIG. 14A The high-magnification image of the crystals grew on CRGD-15mer-CDMP1 ( FIG. 14A ) showed that the apatite, which appeared flake-like in the SEM, is composed of aggregates of nanocrystals with need shapes 100-200 nm in length.
- the electron diffraction pattern of the nanocrystals ( FIG. 14B ) showed diffraction rings.
- the spacings of the rings agreed with the characteristic x-ray diffraction spacing of hydroxyapatite (JCPDS 09-0432).
- the rings could be assigned to the (002), (211) planes.
- a high-resolution TEM image FIG. 14C ) showed the lattice fringes of apatite nanocrystals. The average distance between fringes is 0.82 nm, which is consistent with the value of teh (100) inerplanar spacing in the apatite structure (0.817 nm).
- Silica is widespread in biological systems and serves different functions, among which the most essential ones include support and protection in single-celled organisms, such as diatoms, to higher plants and animals. Despite its widespread occurrence and importance of function, little is known about biosilica and the mechanisms used to produce controlled microscopic and macroscopic silica structures with such nanoscale precision and symmetry. The remarkable control in vivo of the morphology of these beautiful intricate patterns at small length scales are species-specific and has attracted a great deal of interest in recent years as these features exceed the capabilities of present-day synthetic and technological approaches to materials engineering in vitro.
- Silaffins 1;2;3;4;5 form part of three families of proteins identified to date in the organic matrix of the cell wall of the diatom Cylindrotheca fusiformis. Silaffins are highly post-translationally modified peptides and have received the most attention because of their ability to induce and regulate silica precipitation at ambient temperature and pressure. Silaffins are low-molecular weight polypeptides: natSil-1A (6.5 kDa) 4 , natSil-1B (10 kDa) 5 , and natSil-2 (40 kDa) 5 , isolated by treating the diatom cell wall with ammonium fluoride. A gene sil 1 has been isolated from a C.
- R1 to R7 1 corresponds to the precursor of Silaffin-1B, while R3 to R7 and R2 correspond to the precursors of the Silaffin-1A1 and Silaffin-1A2, respectively.
- Applicants have genetically cloned the R5 peptide unit of Sil1 protein to a 15mer spider silk clone of the consensus sequence of the golden orb spider Nephila clavipes , expressed the fusion protein and performed the same silicification reactions on silk films made from the expressed protein.
- the purpose of fusing this silicification-inducing peptide unit to our genetically engineered silk is to combine the properties of our silk whether in the form of films or other such as spun fibers to the silica precipitating properties of R5 under ambient conditions to produce biomaterials with controlled silica morphologies on the surface. These biomaterials are especially useful in such fields as controlled drug delivery.
- the repeat unit was selected used in the design of the 15mer and CRGD15mer was based on the consensus sequence of spidroin1 native sequence of Nephila clavipes (accession P19837) (-SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT-) (SEQ ID NO: 1). Multimers encoding the repeat were cloned through the transfer of cloned inserts between two shuttle vectors based on pUC19 and pCR-Script (Novagen, Wis.), which were ampicillin and chloramphenicol resistant respectively 10;11 .
- the expression vector pET-30a (Novagen, Madison, Wis.) was modified with a linker carrying the SpeI site flanked by sequences encoding the amino acids CRGD (SEQ ID NO: 2) to obtain pET30-link.
- the two complementary oligonucleotide sequences for the linker were: GGATCCTGTCGCGGTGACACTAGTCGCGGTGACTGTG (SEQ ID NO: 13) and GGATCCACAGTCACCGCGACTAGTGTCACCGCGACAG (SEQ ID NO: 14).
- the restriction sites of BamHI and SpeI are underlined.
- the 15mer sequence obtained by multimerization was inserted into pET30-link to generate pET30-CRGD15mer.
- the construct pET30-15mer was obtained by subcloning the NcoI-NotI fragment of pCR-15 into pET-30a vector.
- the polylinker of pET-21a(+) shuttle vector was redesigned to contain a His-Tag and the CRGD15mer was digested with the restriction enzyme BamHI from pET-30a vector and inserted into the pET-21a(+)-link vector.
- Two complementary oligonucleotide sequences for the R5 peptide were designed with EcoRI and NotI sites at the 5′ and 3′ ends respectively:
- the synthetic oligonucleotides were ligated into the NotI and XhoI restriction sites of pET-21a(+) vector right next to the 15mer clone.
- This fusion protein has a His-Tag at the N-terminus.
- the amino acid sequence of the R5 peptide of Sil1 protein is: SSKKSGSYSGSKGSKRRIL (SEQ ID NO: 17).
- Sil1 protein sequences are also contemplated, for example, the R2 peptide SSKKSGSYSGYSTKKSGSRRIL (SEQ ID NO: 18), the R3 peptide SSKKSGSYSGYSKGSKRRIL (SEQ ID NO: 19), the R4/R6 peptide SSKKSGSYSGYSKGSKRRNL (SEQ ID NO: 20), the R1 peptide SSKKSGSYYSYGTKK (SEQ ID NO:21).
- the constructs pET-21(a)+ ⁇ 15mer-R5 and pET-30a-CRGD15mer-R5 were used to transform the E. coli host strains RY-3041, a mutant strain defective in the expression of SlyD protein, for expression 12;13 .
- Cells were cultivated in LB broth at 37° C. Protein expression was induced by the addition of 1 mM IPTG (Fisher Scientific, Hampton, N.H.) when the OD 600 was between 0.6 and 0.8. After approximately 6 hours of protein expression, the cells were harvested by centrifugation at 9500 rpm. For large scale expression, E.
- coli was grown in a fermentor (Bioflo 3000, New Brunswick Scientific Co., Edison, N.J.) in minimal medium supplemented with 1% yeast extract. Ammonia was used as the base to maintain the pH at 6.8. When the pH exceeded 6.88, as a result of glucose exhaustion in the culture, a feed solution (50% glucose, 10% Yeast Extract, 2% MgSO 4 .7H 2 O) was added. Pure O 2 was also provided to the culture to sustain the level of dissolved oxygen above 40%. All culture media contained kanamycin (50 ⁇ g/ml) or ampicillin (100 ⁇ g/ml) for selectivity. For the fermentor grown cells, expression was induced when the absorbance was between 25 and 30 at OD 600 .
- kanamycin 50 ⁇ g/ml
- ampicillin 100 ⁇ g/ml
- the cell pellets were resuspended by adding denaturing buffer (100 mM NaH 2 PO 4 , 10 mM Tris HCl, 8 M urea, pH 8.0) containing 10 mM imidazole.
- denaturing buffer 100 mM NaH 2 PO 4 , 10 mM Tris HCl, 8 M urea, pH 8.0
- the cells were lysed by stirring for 30 min and were then centrifuged at 9500 rpm at 4° C. for 30 min. His-tag purification of the proteins was performed by addition of Ni-NTA agarose resin (Qiagen, Valencia, Calif.) to the supernatant (batch purification) under denaturing conditions. After washing the column with denaturing buffer at pH 6.3, the proteins were eluted with denaturing buffer at pH 4.5 (without imidazole).
- SDS-polyacrylamide gel electrophoresis was performed using 4-12% precast NuPage Bis-Tris gels (Invitrogen, Carlsbad, Calif.). Electrophoresis was performed in MOPS buffer for 50 min at 200V. Purified samples were extensively dialyzed against several changes of H 2 O. For dialysis, Snake Skin membranes (Pierce, Rockford, Ill.) with MWCO of 7000 or lower were used. The dialyzed samples were lyophilized using a LabConco lyophilizer. For determination of the amino acid composition, the samples were submitted to the W. M. Keck Foundation Biotechnology Resource Laboratory (Yale University, New Haven, Conn.).
- FIGS. 7A and 7B show the sequence of CRGD15mer-R5 ( FIG. 7A ) and 15mer-R5 ( FIG. 7B )
- the lyophilized fusion proteins were then dissolved in HFIP solvent at a concentration of 2.5% w/v overnight at 4° C.
- the silk-HFIP solutions were then pipetted into 24-well culture plates and left in the hood for about 3 hours for the silk films to form and dry out.
- the silk films were then either left as is or treated with 90% v/v methanol to induce ⁇ -sheet formation and prevent resolubilization of the films in aqueous solutions.
- 100 mM phosphate buffer at pH 5.5 was added to the silk films and leave to sit for about 30 minutes before 1M tetramethoxysilane (TMOS) dissolved in 1 mM hydrochloric acid was added to the mixture for about 10 minutes.
- TMOS tetramethoxysilane
- the films were then washed with MilliQ water three times and left to dry overnight in the fume hood. These films were then analyzed using a LEO 982 Scanning Electron Microscope at the CIMS
- silica deposition was induced in and on the fibers and elliptically shaped silica particles fused to the fibers were observed ( FIG. 9 ).
- XPS analysis of the resulting fibers confirmed the presence of elemental silicon ( FIG. 10 ).
- Fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes ) ⁇
- a linker sequence CRGD (SEQ ID NO: 2)
- the consensus fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes ) with CRGD linker
- 15 mer An amino acid sequence that contains a repeat of a fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes ) The fibrous protein domain sequence is repeated 15 times.
- CRGD-15mer an amino acid sequence that contains a repeat of a fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes ) The fibrous protein domain sequence is repeated 15 times with a CRGD linking sequence
- CDMP1 the C-Terminal Sequence of DMP1, a Mineralizing domain
- DMP1 the full length sequence of DMP1, a Mineralizing domain
- BSP Bone sialoprotein, a Mineralizing domain
- CRGD-15mer-CDMP1 (SEQ ID NO: 9): a fusion protein of (SEQ ID NO: 5) and (SEQ ID NO: 6) ⁇
- CRGD-15mer-DMP1 (SEQ ID NO: 10): a fusion protein of (SEQ ID NO: 5) and SEQ ID NO: 7) ⁇
- 15mer-BSP (SEQ ID NO: 11): a fusion protein of (SEQ ID NO: 4) and (SEQ ID NO: 8)
- CRGD-15mer-BSP (SEQ ID NO: 12): a fusion protein of (SEQ ID NO: 5) and (SEQ ID NO: 8) with linker
- R5 peptide contains the 19 amino-acid R5 peptide of the Sil1 protein
- EcoRI and NotI sites were designed with EcoRI and NotI sites at the 5′ and 3′ ends respectively
- R5 peptide contains the 19 amino-acid R5 peptide of the Sil1 protein
- EcoRI and NotI sites were designed with EcoRI and NotI sites at the 5′ and 3′ ends respectively.
- the amino acid sequence of the R5 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGSKGSKRRIL (SEQ ID NO: 17)
- the amino acid sequence of the R2 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGYSTKKSGSRRIL (SEQ ID NO: 18),
- the amino acid sequence of the R3 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGYSKGSKRRIL (SEQ ID NO: 19),
- the amino acid sequence of the R4/R6 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGYSKGSKRRNL (SEQ ID NO: 20).
- the amino acid sequence of the R1 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYYSYGTKK (SEQ ID NO:21).
- Bone Sialoprotein Precursor [ Homo sapiens ] Accession AAC95490 is:
- Silaffin 1 precursor (natSil-1) [Contains: Silaffin-1B; Silaffin-1A2; Silaffin-1A1] Accession Q9SE35: MKLTAIFPLL FTAVGYCAAQ SIADLAAANL STEDSKSAQL ISADSSDDAS DSSVESVDAA SSDVSGSSVE SVDVSGSSLE SVDVSGSSLE SVDDSSEDSE EEELRILSSK KSGSYYSYGT KKSGSYSGYS TKKSASRRIL SSKKSGSYSG YSTKKSGSRR ILSSKKSGSY SGSKGSKRR1 LSSKKSGSYS GSKGSKRRNL SSKKSGSYSG SKGSKRRILS SKKSGSYSGS KGSKRRNLSS KKSGSYSGSK GSKRRILSGG LRGSM (SEQ ID NO: 23)
- CRGD15mer-R5 Sequence of fusion protein; fusion of CRGD15mer to the amino acid sequence of the R5 peptide of Sil1 protein from C. fusiformis .
- 15mer-R5 Sequence of fusion protein; fusion of 15mer to the amino acid sequence of the R5 peptide of Sil1 protein from C. fusiformis .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oral & Maxillofacial Surgery (AREA)
- Dermatology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Transplantation (AREA)
- Insects & Arthropods (AREA)
- Materials Engineering (AREA)
- Composite Materials (AREA)
- Inorganic Chemistry (AREA)
- Tropical Medicine & Parasitology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Biomedical Technology (AREA)
- Peptides Or Proteins (AREA)
- Materials For Medical Uses (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
- This application is a continuation of U.S. Ser. No. 13/347,801 filed Jan. 11, 2012, which is a continuation of U.S. Ser. No. 13/097,538 filed Apr. 29, 2011, now U.S. Pat. No. 8,129,141, issued Mar. 6, 2012, which is a continuation of U.S. Ser. No. 11/794,934 filed on Jan. 14, 2008, now U.S. Pat. No. 7,960,509, issued Jun. 14, 2011, which is a 371 National Phase Entry Application of International Application No. PCT/US2006/01536, filed Jan. 17, 2006, which designates the U.S., and which claims the benefit under 35 U.S.C. §119(e) of U.S. Provisional Patent Application No. 60/644,264, filed Jan. 14, 2005, the contents of all of which are incorporated herein by reference in their entireties.
- This invention was supported by FA9550041-0363 awarded by the U.S. Air Force and EB003210-01 awarded by the National Institutes of Health. The government has certain rights in the invention.
- Many biomedical procedures require the provision of healthy tissue to counteract the disease process or trauma being treated. This work is often hampered by the tremendous shortage of tissues available for transplantation and/or grafting. Tissue engineering may ultimately provide alternatives to whole organ or tissue transplantation. In order to generate engineered tissues, various combinations of biomaterials and living cells are currently being investigated. Although attention is often focused on the cellular aspects of the engineering process, the design characteristics of the biomaterials also constitute a major challenge in this field.
- In recent years, the ability to regenerate tissues and to control the properties of the regenerated tissue have been investigated by trying to specifically tune the mechanical or chemical properties of the biomaterial scaffold (Kim et al., 1997; Kohn et al. 1997). The majority of work has involved the incorporation of chemical factors into the material during processing, or the tuning of mechanical properties by altering the constituents of the material.
- The foregoing methods have been used in an attempt to utilize chemical or mechanical signaling to affect changes in the proliferation and/or differentiation of cells during tissue regeneration. Despite such efforts there remains in the art a need for improved biomaterials, including composite materials, particularly those with a better capacity to support complex tissue growth in vitro (in cell culture) and in vivo (upon implantation).
- The claimed invention provides a fusion polypeptide comprising a fibrous protein domain and a mineralization domain.
- In one embodiment the fibrous protein domain is obtained from silk, collagens, coiled-coiled leucine zipper proteins, elastins, keratins, actins, and tubulins.
- For example, in one preferred embodiment, the fibrous protein domain comprises an amino acid sequence from the silk protein Spidroin 1, such as the fibrous protein domains indicated by (SEQ ID NO: 1) or (SEQ ID NO: 3), which are derived from Spiroidin 1 of Nephila clavipes. A recombinant fibrous protein domain can be generated, which has multiple repeats of a fibrous protein domain.
- In one embodiment, the fibrous domain sequence of (SEQ ID NO: 1) is repeated 15 times throughout the fibrous protein domain, which is used in the fusion proteins of the invention, i.e., the fibrous protein domain sequence indicated by (SEQ ID NO: 4), referred to herein as 15mer.
- In one embodiment, a fibrous domain sequence of (SEQ ID NO: 1) is repeated 15 times throughout the fibrous protein domain that is used in the fusion proteins of the invention and has a CRGD4 (SEQ ID NO: 2) linker sequence, i.e. the fibrous protein domain sequence indicated by (SEQ ID NO: 5), referred to herein as CRGD-15mer.
- In one embodiment, the fusion polypeptide of the invention has a mineralizing domain that is capable of inducing the formation of hydroxyapatite, silica, cadmium sulfide or magnetite.
- In one embodiment, the mineralization domain is obtained from dentin matrix protein 1 (DMP1), bone sialoprotein (BSP), or silaffin-1 (Sil1) protein.
- In one embodiment, the mineralization domain is derived from dentin matrix protein 1 (DMP1) and is (SEQ ID NO: 6) or (SEQ ID NO: 7).
- In one embodiment, the mineralization domain is derived from bone sialoprotein (BSP) and is (SEQ ID NO: 8).
- In one embodiment, the mineralizing domain is selected from the group consisting of the 19 amino-acid R5 peptide of the Sil1 protein (SEQ ID NO: 17), the R2 peptide of the Sil1 protein (SEQ ID NO: 18), the 19 amino-acid R3 peptide of the Sil1 protein (SEQ ID NO: 19), the 19 amino-acid R6 peptide of the Sil1 protein (SEQ ID NO: 20) and the 15 amino-acid R1 peptide of the Sil1 protein (SEQ ID NO: 21).
- The invention also provides for the following fusion polypeptides that comprise a fibrous protein domain and a mineralization domain: the fusion polypeptide (SEQ ID NO: 9), the fusion polypeptide (SEQ ID NO: 10), the fusion polypeptide (SEQ ID NO: 11), the fusion polypeptide (SEQ ID NO: 12), a fusion polypeptide comprising a fusion of the 15 mer silk fibrous protein domain (SEQ ID NO: 4) and the R5 peptide of the Sil1 protein (SEQ ID NO: 17) and a fusion polypeptide comprising a fusion of the CRGD-15 mer silk fibrous protein domain (SEQ ID NO: 5) and the R5 peptide of the Sil1 protein (SEQ ID NO: 17).
- A method for forming a fibrous protein inorganic-composite material is also provided. The method comprises (a) contacting the fusion proteins of the invention with an inorganic material capable of mineralizing for a sufficient period of time to allow mineralization of the inorganic material.
- In one preferred embodiment, the fusion proteins of the invention are formed into a silk film, foam or sponge prior to deposition of inorganic material (mineralization).
- In one embodiment, the inorganic material is capable of forming hydroxyapatite or silica.
- In one embodiment, the fiber, film, or sponge further comprises an agent.
- In one embodiment, the inorganic coating formed on the fibrous protein comprises an agent.
- In one embodiment, the agent is selected from the group consisting of a protein, peptide, nucleic acid, PNA, aptamer, antibody or a small molecule.
- The claimed invention also provides for biomaterial products produced by the methods of the invention.
-
FIGS. 1A and 1B show diagrammatic illustrations of fibrous protein domain-mineralization domain fusion proteins.FIG. 1A shows three claimed fusion proteins composed of a spider silk fibrous protein domain ((CRGD-15mer) (See (SEQ ID NO: 5)) and a dentin matrix protein 1 (DMP 1) mineralization domain. The fusion proteins contain a mineralization domain of either 1) the full length amino acid sequence of DMP 1 (See (SEQ ID NO: 7)), 2) the C-terminal end of DMP1, (See (SEQ ID NO: 6)) or a composite sequence based on DMP1, which contains the collagen binding domain 1 (CD 1) of DMP1, two acidic clusters in DMP1 that are responsible for hydroxyapatite nucleation (pA and pB) and the collagen binding domain 2 (CD2) of DMP1.FIG. 1B shows a diagram of two fusion proteins, 1) fusion of a spider silk fibrous protein domain (CRGD-15mer (See (SEQ ID NO: 5)) and a bone sialoprotein mineralizing domain (BSP) (See (SEQ ID NO: 8)) and 2) fusion of a spider silk fibrous protein domain 15-mer (without CRGD linker) (See (SEQ ID NO: 4)) and a bone sialoprotein mineralizing domain (BSP) (See SEQ ID NO: 8). -
FIG. 2 shows the sequence of the fusion protein CRGD-15mer-CDMP1 (SEQ ID NO: 9). CRGD-15mer-CDMP1 is a fusion protein of a spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the C-terminal end of DMP1 mineralizing domain (See, SEQ ID NO: 6), which is indicated with light grey highlight. -
FIG. 3 shows the sequence of the fusion protein CRGD-15mer-DMP1 (SEQ ID NO: 10). CRGD-15mer-DMP1 is a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the full length sequence of DMP1 mineralizing domain (See, SEQ ID NO: 7), which is indicated with light grey highlight. -
FIG. 4 shows the sequence of the fusion protein 15mer-BSP (SEQ ID NO: 11). 15mer-BSP is a fusion protein of spider silk fibrous protein domain ((15mer) (See, SEQ ID NO: 4), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight. -
FIG. 5 shows the sequence of the fusion protein CRGD-15mer-BSP (SEQ ID NO: 12). CRGD-15mer-BSP a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight. A linker sequence between the two domains is also present. -
FIGS. 6A to 6C show scanning electron microscope (SEM) images of recombinant silk film made from CRGD-15mer-CDMP1, See Example 1.FIG. 6A , image of silk film morphology prior to mineralization (HFIP+MeOH).FIG. 6B , image of silk film morphology after one round of mineralization.FIG. 6C , image of silk film morphology after three rounds of mineralization. -
FIGS. 7A to 7B show the sequence of the fusion proteins CRGD15mer-R5 (SEQ ID NO: 25) and 15mer-R5 (SEQ ID NO: 25) as described in Example II. The underlined sequence represents the monomeric repeat unit selected and used in the design of the recombinant proteins based on the consensus sequence of spidroin1 (Maspl) native sequence of Nephila clavipes (Accession #P19837). -
FIG. 8 shows a grid of SEM of untreated and methanol treated silk films formed from the four different genetically engineered silk proteins CRGD15mer, 15mer, CRGD15mer-R5, and 15mer-R5 as described in Example 2. Images of the control films and the films that underwent silicification reactions are shown. -
FIGS. 9A to 9E show SEM images of untreated and methanol treated electropun CRGD15mer-R5 silk fibers before, during and after silicification reactions, as described in Example 2.FIG. 9A , untreated electrospun CRGD15mer-R5 silk fibers.FIG. 9B , electrospun CRGD15mer-R5 silk fibers methanol treated before silification.FIGS. 9C , 9D and 9E, electrospun CRGD15mer-R5 silk fibers during silification at 20 um and 2 um scale. -
FIGS. 10A to 10B show XPS analysis, as described in Example 2, of CRGD15mer-R5 and silicified CRGD15mer-R5 on A1 foil and on silicon chip at the characteristic binding energies of (FIG. 10A ) 153 eV and (FIG. 10B ) 102 eV for electrons found in the 2s and 2p3 electron shells of the silicon atom respectively. -
FIG. 11 shows Fourier transform infared spectroscopy (FTIR) analysis of the structure of CRGD-15mer-CDMP1 before and after Ca ion binding, as described in Example 1. -
FIG. 12 shows FTIR analysis of structure of CRGD-15mer-CDMP1 before and after treatment with methanol, as described in Example 1. - FIGS. 13(A1) to 13(A5) and 13(B1) to 13(B5) show Scanning Electron Microscopy (SEM) surface morphologies of recombinant spider silk films after soaking in 1.5×SBF for various periods of time, as described in Example 1. FIG. 13(A1)-FIG. 13(A5), SS15m-CDMP1 soaked in 1.5×SBF for 0, 3, 7, 14 and 21 days: FIG. 13(A1)-FIG. 13(A5) respectively. FIG. 13(B1)-FIG. 13(B5), SS15m soaked in 1.5×SBF for 0, 3,7,14 and 21 days: FIG. 13(B1)-FIG. 13(B5) respectively. Scale bars are 2 μm.
-
FIGS. 14A to 14C show Transmission Electron Microscopy (TEM) images of crystals grown on CRGD-15mer-CDMP1 after soaking in 1.5×SBF for 21 days, as described in Example 1. (FIG. 14A ) image of flake-like apatite; (FIG. 14B ) electron diffraction pattern; (FIG. 14C ) high-resolution image of apatite crystal. - Fibrous proteins represent an important category of proteins in biology, forming native structural entities both internally in organisms (e.g., collagens) and externally (such as spun silk fibers for webs and cocoons). As an example, silk proteins from spiders and insects provide a number of valuable materials features. When combined with functional domains, then the materials properties available from silks become significantly expanded. In accordance with the present invention, various domains from biology known to promote the formation of inorganic structures, e.g., promote formation of minerals, have been combined with a fibrous protein domain. Thus, these new fusion (composite) materials offer the benefits of the fibrous protein material features (e.g, silks) plus the benefit of the inorganic mineralization domains (e.g., hardness).
- In one embodiment, the present invention provides a fusion polypeptide comprising a fibrous protein domain and a mineralization domain. The fusion is used to form an organic-inorganic composite. These organic-inorganic composites can be constructed from the nano- to the macro-scale depending on the size of the fibrous protein fusion domain used. In one embodiment, the composites can also be loaded with other compounds (e.g., dyes, drugs, enzymes) depending on the goal for the materials, to further enhance function. This can be achieved during assembly of the material or during the mineralization step in materials formation.
- The fusion polypeptides of the present invention can be used for production of silk biomaterials, e.g., fibers, films, foams and mats. See, WO 03/022909. An all-aqueous process may be used. See, WO 03/022909.
- In another embodiment, the invention provides a method for forming a composite material. The method comprises contacting a template formed from a fusion polypeptide of the invention with a suitable inorganic material for a sufficient period of time to allow mineralization of the inorganic material thus forming an inorganic coating on the template.
- In one embodiment the template is in the form of a fiber, film, or sponge.
- In an additional embodiment, growth factors, biological components or others agents, including therapeutic agents, are incorporated into the inorganic coating. The growth factors, biological components or other agents, can be incorporated during the formation of the template or during the crystallization process. Such composites can be used to deliver such components to cells and tissues. The ability to incorporate growth factors, biological regulators, enzymes, therapeutics, or cells in the construct of the present invention provides for stabilization of these components for long term release and stability, as well as better control of activity and release.
- The products produced by these methods offer new options in the formation of scaffolds for biomaterials, tissue engineering applications and drug delivery. While the templates are useful in and of themselves, the ability to form inorganic coatings with controlled thickness leads to control of mechanical properties (e.g., stiffness) and biological interactions, such as for bone formation. Furthermore, the ability to control these processes allows one to match structural and functional performance of scaffolds for specific tissue targets and needs.
- In another embodiment, the underlying template (e.g., fusion polypeptide formed into a film etc.) can be removed or etched away to generate porous networks, tubes, or lamellar sheets of inorganic material. These materials are useful directly as biomaterial scaffolds, for control of cell and tissue growth (e.g., as nerve conduits, bone conduits) and for nonbiological applications (e.g., filtration and separation media, catalysis, decontamination (directly or if filled with appropriate chemical or enzymes), radar chaff, coatings in general, and many related needs, for example, inorganic fillers to toughen materials that can also be filled with a second component.
- The fusion polypeptides may be created, for example, by chemical synthesis, or by creating and translation a polynucleotide in which the peptide regions are encoded in the desired relationship.
- It is to be understood that while the invention has been described in conjunction with the preferred specific embodiments thereof that the foregoing description as well as the examples that follow are intended to illustrate and not limit the scope of the invention. Other aspects, advantages and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.
- Silks are unique in their self-assembly, formation of robust materials in the form of fibers, films and 3D matrices, and are polymorphic (the structure can be controlled among many assembly states). For example, silk fibers are the strongest known fibers and rival even high performance fibers. They are also effective in resisting compression. In 3D porous matrices the compressive resistance exceeds other commonly used organic polymers as biomaterial matrices. Inorganic domains, including silica and hydroxyapatite are prominent in biological systems as key inorganic components found associated with proteins. These mineral phases dominate skeletal components of most systems.
- The fibrous protein domain can include short to long versions, with the size in part influencing the scale of the composite from the nano to the macro level. For example, the size can range from a single sized hydrophobic block of 50 amino acids, up to multiple blocks as large as desired including up to proteins of sizes in the 100,000s of Daltons. In addition, the fibrous protein fusion domain could include other proteins such as collagens, coiled-coiled leucine zipper proteins, elastins, keratins, actins, and tubulins.
- The silk protein suitable for use in the present invention is preferably fibroin or related proteins (i.e., silks from spiders). The silkworm silk is obtained, for example, from Bombyx mori. Spider silk may be obtained from Nephila clavipes See, for example, WO 97/08315 and U.S. Pat. No. 5,245,012.
- Mineralizing domains include those that can induce the formation of hydroxyapatite (Example 1), silica (Example 2), cadmium sulfide, and magnetite. In one embodiment, a mineralizing domain that can induce hydroxyapatite nucleation is obtained from
dentin matrix protein 1 or bone sialoprotein (G. He, T. Dahl, A. Veis and A. George. Connective Tissue Res. 2003, 44 (Suppl. 1): 240-245; and G. He, T. Dahl, A. Veis and A. George. Nature materials. 2003, 2(8): 552-558; Stubbs et al. J Bone Miner Res. 1997 August; 12(8):1210-22). The full molecule or a minimum portion that can induce mineralization can be used, for example, a 37 amino acid segment from DMP (C-terminus) will induce controlled mineralization of hydroxyapatite. In one example, the mineralization domains were fused to a sequence derived from spider silk having the following silk fibrous domain repeated 15 times (SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT) (SEQ ID NO: 1) in order to generate functional recombinant silks that possess both robust mechanical properties of the spider silk and the ability to promote mineralization. The recombinant proteins were cloned in pET21a(+) vector and expressed in E. coli. As demonstrated below, the identities of these recombinant silks were confirmed by amino acid composition analysis and the mineralization study was carried out on the surfaces of the cast functional recombinant silk films using recombinant protein containing only spider silk sequence as control. It was demonstrated that the functional recombinant silks exhibit an ability to promote the nucleation of hydroxyapatite. The functional recombinant silks (silk fusion proteins) of the present invention have potential application in biomaterials, tissue engineering, advanced material composites and biosensors. - Preferably, the mineralizing domain is capable of inducing the formation of hydroxyapatite, silica, cadmium sulfide, magnetite and other metal salts pending choice of peptide domain utilized.
- Preferred mineralizing domains include, for example, dentin matrix protein 1 (DMP1), bone sialoprotein, and fragments of these proteins, and the 19 amino-acid R5 peptide of the Sil1 protein.
- Alternative fibrous proteins and mineralizing domains can also be included in this system using the template provided. For example, peptides identified from other native proteins or identified by combinatorial screening methods can be used. Screening methods can involve any mineralization assay known in the art, for example the hydroxyapatite and silicification assays described herein.
- The fusion proteins containing a mineralization domain and a fibrous protein domain can be made using standard molecular biology methods well known to those skilled in the art (See for example, Sambrook et al., Molecular Biology: A laboratory Approach, Cold Spring Harbor, N.Y. 1989; Ausubel, et al., Current protocols in Molecular Biology, Greene Publishing, Y, 1995).
- In some embodiments, the fusion proteins of the invention are made using linker sequences. As used herein, the term “linker sequence” refers to a short (e.g., about 1-20 amino acids) sequence of amino acids that is not part of the sequence of either of two polypeptides being joined. For example, a linker sequence is attached on its amino-terminal end to one polypeptide or polypeptide domain and on its carboxyl-terminal end to another polypeptide or polypeptide domain.
- The manipulation of nucleic acids that encode the protein domains in the present invention is typically carried out in recombinant vectors. Herein, both phagemid and non-phagemid vectors can be used. As used herein, vector refers to a discrete element that is used to introduce heterologous DNA into cells for the expression and/or replication thereof. Methods by which to select or construct and, subsequently, use such vectors are well known to one of skill in the art. Numerous vectors are publicly available, including bacterial plasmids, bacteriophage, artificial chromosomes, episomal vectors and gene expression vectors. A vector of use according to the invention may be selected to accommodate a polypeptide coding sequence of a desired size. A suitable host cell is transformed with the vector after in vitro cloning manipulations. Host cells may be prokaryotic, such as any of a number of bacterial strains, or may be eukaryotic, such as yeast or other fungal cells, insect or amphibian cells, or mammalian cells including, for example, rodent, simian or human cells. Each vector contains various functional components, which generally include a cloning (or “polylinker”) site, an origin of replication and at least one selectable marker gene. If given vector is an expression vector, it additionally possesses one or more of the following: enhancer element, promoter, transcription termination and signal sequences, each positioned in the vicinity of the cloning site, such that they are operatively linked to the gene encoding a polypeptide repertoire member according to the invention.
- Both cloning and expression vectors generally contain nucleic acid sequences that enable the vector to replicate in one or more selected host cells. Typically in cloning vectors, this sequence is one that enables the vector to replicate independently of the host chromosomal DNA and includes origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast and viruses. For example, the origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2 micron plasmid origin is suitable for yeast, and various viral origins (e.g. SV 40, adenovirus) are useful for cloning vectors in mammalian cells. Generally, the origin of replication is not needed for mammalian expression vectors unless these are used in mammalian cells able to replicate high levels of DNA, such as COS cells.
- Advantageously, a cloning or expression vector may contain a selection gene also referred to as a selectable marker. This gene encodes a protein necessary for the survival or growth of transformed host cells grown in a selective culture medium. Host cells not transformed with the vector containing the selection gene will therefore not survive in the culture medium. Typical selection genes encode proteins that confer resistance to antibiotics and other toxins, e.g. ampicillin, neomycin, methotrexate or tetracycline, complement auxotrophic deficiencies, or supply critical nutrients not available in the growth media.
- Since the replication of vectors according to the present invention is most conveniently performed in E. coli (e.g., strain TB1 or TG1), an E. coli-selectable marker, for example, the β-lactamase gene that confers resistance to the antibiotic ampicillin, is of use. These can be obtained from E. coli plasmids, such as pBR322 or a pUC plasmid such as pUC18 or pUC19, or pUC119.
- Expression vectors usually contain a promoter that is recognized by the host organism and is operably linked to the coding sequence of interest. Such a promoter may be inducible or constitutive. The term “operably linked” refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. A control sequence “operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences.
- Promoters suitable for use with prokaryotic hosts include, for example, the β-lactamase and lactose promoter systems, alkaline phosphatase, the tryptophan (trp) promoter system and hybrid promoters such as the tac promoter. Promoters for use in bacterial systems will also generally contain a Shine-Delgarno sequence operably linked to the coding sequence. Preferred promoters for use in the present invention are the isopropylthiogalactoside (IPTG)-regulatable promoters.
- In one preferred embodiment of the invention, the fusion protein of the invention further comprises a tag, e.g. Flag, His, Myc, HA, VSV, or V5, to aid in purification of the protein by standard means. After purification, the fusion protein can be lyophilized or suspended in aqueous solution for preparation of silk materials, such as films, foams or fibers.
- The silk fusion proteins of the invention can be processed into films, foams or fibers. As used herein, “silk fibroin” or “silk protein” refers to a silk fusion protein of the invention.
- Fibers can be formed by electrospinning Electrospinning can be performed by any means known in the art (see, for example, U.S. Pat. No. 6,110,590). Preferably, a steel capillary tube with a 1.0 mm internal diameter tip is mounted on an adjustable, electrically insulated stand. Preferably, the capillary tube is maintained at a high electric potential and mounted in the parallel plate geometry. The capillary tube is preferably connected to a syringe filled with silk/biocompatible polymer solution. Preferably, a constant volume flow rate is maintained using a syringe pump, set to keep the solution at the tip of the tube without dripping. The electric potential, solution flow rate, and the distance between the capillary tip and the collection screen are adjusted so that a stable jet is obtained. Dry or wet fibers are collected by varying the distance between the capillary tip and the collection screen.
- A collection screen suitable for collecting silk fibers can be a wire mesh, a polymeric mesh, or a water bath. Alternatively and preferably, the collection screen is an aluminum foil. The aluminum foil can be coated with Teflon fluid to make peeling off the silk fibers easier. One skilled in the art will be able to readily select other means of collecting the fiber solution as it travels through the electric field. As is described in more detail in the Examples section below, the electric potential difference between the capillary tip and the aluminum foil counter electrode is, preferably, gradually increased to about 12 kV, however, one skilled in the art should be able to adjust the electric potential to achieve suitable jet stream.
- The process of the present invention may further comprise steps of immersing the spun fiber into an alcohol/water solution to induce crystallization of silk. The composition of alcohol/water solution is preferably 90/10 (v/v). The alcohol is preferably methanol, ethanol, isopropyl alcohol (2-propanol) or n-butanol. Methanol is most preferred. Additionally, the process may further comprise the step of washing the fibroin fiber in water.
- In another embodiment, the biomaterial is a film. The process for forming the film comprises, for example, the steps of (a) preparing an aqueous silk fibroin solution comprising silk protein; (b) adding a biocompatible polymer to the aqueous solution; (c) drying the mixture; and (d) contacting the dried mixture with an alcohol (preferred alcohols are listed above) and water solution to crystallize a silk blend film. Preferably, the biocompatible polymer is poly(ethylene oxide) (PEO). The process for producing the film may further include step (e) of drawing or mono-axially stretching the resulting silk blend film to alter or enhance its mechanical properties. The stretching of a silk blend film induces molecular alignment in the fiber structure of the film and thereby improves the mechanical properties of the film.
- In a further embodiment, the biomaterial is a foam. Foams may be made from methods known in the art, including, for example, freeze-drying and gas foaming in which water is the solvent or nitrogen or other gas is the blowing agent, respectively.
- In one embodiment, the foam is a micropatterned foam. Micropatterned foams can be prepared using, for example, the method set forth in U.S. Pat. No. 6,423,252, the disclosure of which is incorporated herein by reference.
- The claimed invention provides a method for forming an organic-inorganic composite material. The method comprises contacting a template (such as recombinant silk films, sponges or fibers) formed from a fusion polypeptide of the invention with a suitable inorganic material for a sufficient period of time to allow mineralization of the inorganic material. Mineralized material is deposited onto the silk forming an inorganic coating on the template.
- The procedure for mineralization of the coating is dependent upon the mineralization domain that is part of the fusion polypeptide of the invention. For example, the mineralizing domain of dentin matrix protein 1 (DMP1), an acidic phosphoprotein secreted into the extracellular matrix during the formation and mineralization of bone and dentin, is involved in the precipitation of hydroxyapatite, the main inorganic component in calcified hard tissue such as bone and teeth of vertebrates (Koutsopoulos, S. J Biomed Mater Res. 2002, 62: 600-612). Further, the mineralizing domain of Silaffin protein is involved in the precipitation of silica.
- Those in the art are skilled to select the appropriate buffer for precipitation of inorganic material. The formation of inorganic coatings is further described in Examples 1 and 2.
- The biomaterial products produced by the processes of the present invention may be used in a variety of medical applications such as wound closure systems, including vascular wound repair devices, hemostatic dressings, patches and glues, sutures, drug delivery and in tissue engineering applications, such as, for example, scaffolding, ligament prosthetic devices and in products for long-term or bio-degradable implantation into the human body. A preferred tissue engineered scaffold is a non-woven network of electrospun fibers.
- Additionally, these biomaterials can be used for organ repair replacement or regeneration strategies that may benefit from these unique scaffolds, including but are not limited to, spine disc, cranial tissue, dura, nerve tissue, liver, pancreas, kidney, bladder, spleen, cardiac muscle, skeletal muscle, tendons, ligaments and breast tissues.
- In another embodiment of the present invention, silk biomaterials can contain therapeutic agents. To form these materials, the polymer would be mixed with a therapeutic agent prior to forming the material or loaded into the material after it is formed. In addition, the agent can be incorporated into the inorganic coating formed by the silk fusion protein mineralization domain by mixing it with the mineralization solution. The variety of different therapeutic agents that can be used in conjunction with the biomaterials of the present invention is vast. In general, therapeutic agents which may be administered via the pharmaceutical compositions of the invention include, without limitation: antiinfectives such as antibiotics and antiviral agents; chemotherapeutic agents (i.e. anticancer agents); anti-rejection agents; analgesics and analgesic combinations; anti-inflammatory agents; hormones such as steroids; growth factors (bone morphogenic proteins (i.e. BMP's 1-7), bone morphogenic-like proteins (i.e. GFD-5, GFD-7 and GFD-8), epidermal growth factor (EGF), fibroblast growth factor (i.e. FGF 1-9), platelet derived growth factor (PDGF), insulin like growth factor (IGF-I and IGF-II), transforming growth factors (i.e. TGF-.beta.I-III), vascular endothelial growth factor (VEGF)); and other naturally derived or genetically engineered proteins, polysaccharides, glycoproteins, or lipoproteins. These growth factors are described in The Cellular and Molecular Basis of Bone Formation and Repair by Vicki Rosen and R. Scott Thies, published by R. G. Landes Company hereby incorporated herein by reference.
- Silk biomaterials containing bioactive materials may be formulated by mixing one or more therapeutic agents with the polymer used to make the material. Alternatively, a therapeutic agent could be coated on to the material preferably with a pharmaceutically acceptable carrier. Any pharmaceutical carrier can be used that does not dissolve the foam. The therapeutic agents, may be present as a liquid, a finely divided solid, or any other appropriate physical form. Typically, but optionally, the matrix will include one or more additives, such as diluents, carriers, excipients, stabilizers or the like.
- The amount of therapeutic agent will depend on the particular drug being employed and medical condition being treated. Typically, the amount of drug represents about 0.001 percent to about 70 percent, more typically about 0.001 percent to about 50 percent, most typically about 0.001 percent to about 20 percent by weight of the material. Upon contact with body fluids the drug will be released.
- The biocompatible polymer may be extracted from the biomaterial prior to use. This is particularly desirable for tissue engineering applications. Extraction of the biocompatible polymer may be accomplished, for example, by soaking the biomaterial in water prior to use.
- The tissue engineering scaffolds biomaterials can be further modified after fabrication. For example, the scaffolds can be coated with bioactive substances that function as receptors or chemoattractors for a desired population of cells. The coating can be applied through absorption or chemical bonding.
- Additives suitable for use with the present invention include biologically or pharmaceutically active compounds. Examples of biologically active compounds include cell attachment mediators, such as the peptide containing variations of the “RGD” integrin binding sequence known to affect cellular attachment, biologically active ligands, and substances that enhance or exclude particular varieties of cellular or tissue ingrowth. Such substances include, for example, osteoinductive substances, such as bone morphogenic proteins (BMP), epidermal growth factor (EGF), fibroblast growth factor (FGF), platelet-derived growth factor (PDGF), vascular endothelial growth factor (VEGF), insulin-like growth factor (IGF-I and II), TGF-and the like.
- The scaffolds are shaped into articles for tissue engineering and tissue guided regeneration applications, including reconstructive surgery. The structure of the scaffold allows generous cellular ingrowth, eliminating the need for cellular preseeding. The scaffolds may also be molded to form external scaffolding for the support of in vitro culturing of cells for the creation of external support organs.
- The scaffold functions to mimic the extracellular matrices (ECM) of the body. The scaffold serves as both a physical support and an adhesive substrate for isolated cells during in vitro culture and subsequent implantation. As the transplanted cell populations grow and the cells function normally, they begin to secrete their own ECM support.
- In the reconstruction of structural tissues like cartilage and bone, tissue shape is integral to function, requiring the molding of the scaffold into articles of varying thickness and shape. Any crevices, apertures or refinements desired in the three-dimensional structure can be created by removing portions of the matrix with scissors, a scalpel, a laser beam or any other cutting instrument. Scaffold applications include the regeneration of tissues such as nervous, musculoskeletal, cartilaginous, tendenous, hepatic, pancreatic, ocular, integumenary, arteriovenous, urinary or any other tissue forming solid or hollow organs.
- The scaffold may also be used in transplantation as a matrix for dissociated cells, e.g., chondrocytes or hepatocytes, to create a three-dimensional tissue or organ. Any type of cell can be added to the scaffold for culturing and possible implantation, including cells of the muscular and skeletal systems, such as chondrocytes, fibroblasts, muscle cells and osteocytes, parenchymal cells such as hepatocytes, pancreatic cells (including Islet cells), cells of intestinal origin, and other cells such as nerve cells, bone marrow cells, skin cells and stem cells, and combination thereof, either as obtained from donors, from established cell culture lines, or even before or after genetic engineering. Pieces of tissue can also be used, which may provide a number of different cell types in the same structure.
- The cells are obtained from a suitable donor, or the patient into which they are to be implanted, dissociated using standard techniques and seeded onto and into the scaffold. In vitro culturing optionally may be performed prior to implantation. Alternatively, the scaffold is implanted, allowed to vascularize, then cells are injected into the scaffold. Methods and reagents for culturing cells in vitro and implantation of a tissue scaffold are known to those skilled in the art.
- The biomaterials of the claimed invention may be sterilized using conventional sterilization process such as radiation based sterilization (i.e. gamma-ray), chemical based sterilization (ethylene oxide) or other appropriate procedures. Preferably the sterilization process will be with ethylene oxide at a temperature between 52-55° C. for a time of 8 hours or less. After sterilization the biomaterials may be packaged in an appropriate sterilize moisture resistant package for shipment and use in hospitals and other health care facilities.
- The invention will be further characterized by the following examples which are intended to be exemplary of the invention.
- Hydroxyapatite (HAP, Ca5(PO4)3(OH)) is the most stable calcium phosphate salt at normal temperature and pH between 4 and 12 (Aaron, S. Posner Physiological review, 1969, 49(4): 760-792). Hydroxyapatite is the main inorganic component in calcified hard tissue such as bone and teeth of vertebrates (Koutsopoulos, S. J Biomed Mater Res. 2002, 62: 600-612). In addition, hydroxyapatite also has many applications in protein chromatography, water treatment processes, fertilizer and pharmaceutical products (Bailliez, S.; Nzihou, A.; Beche, E.; Flamant, G. Process Safety and Environmental Protection, 2004, 82(B2): 175-180). For calcified hard tissue, hydroxyapatite contributes to its stiffness, while organic matrix contributes to its plasticity (Landis, W. J. Bone, 16(5): 533-544). The inherent strength and other mechanical properties of the skeletal system are thought to depend on an interaction between its organic and inorganic matrix strength, here hydroxyapatite. One example is the composite formed between the normal mineral salt, hydroxyapatite, and collagen, the principal organic component of the vertebrate skeleton, able to resist a wide range of compressive or tensile forces whereas either material alone can not (Chen, Q. Z.; Wong, C. T.; Lu, W. W.; Cheung, K. M. C.; Leong, J. C. Y. and Luk, K. D. K. Biomaterials, 2004, 25: 4243-4254). In the present disclosure, we demonstrate a proof of concept with dental matrix protein (DMP).
- Dentin matrix protein 1 (DMP1) is an acidic phosphoprotein secreted into the extracellular matrix during the formation and mineralization of bone and dentin, therefore, it is believed that
DMP 1 plays an important role in the initiation of mineralization (J. Q. Feng, H. Huang, Y. Lu, L. Ye, Y. Xie, T. w. Tsutsui, T. Kunieda, T. Castranio, G. Scott, L. B. Bonewald, and Y. Mishina. J Dent Res. 2003, 82(10): 776-780; W. T. Butler, H. Ritchie. Int J Dev Biol, 1995, 39: 169-179; George, B. Sabsay, P.A.L. Simonian, and A. Veis. J Biol Chem, 1993, 268(17):12624-12630). It has been reported that DMP1 nucleates the formation of hydroxyapatite in vitro (G. He, T. Dahl, A. Veis and A. George. Connective Tissue Res. 2003, 44 (Suppl. 1): 240-245; and G. He, T. Dahl, A. Veis and A. George. Nature materials. 2003, 2(8): 552-558) by binding calcium ions and initiating mineral deposition. It has also been reported thatDMP 1 binds to the N-telopeptide region of type I collagen and the collagen-binding domains involved in this interaction have been identified (G. He and A. George. J Biol. Chem. 2004, 279(12): 11649-11656). - We generated various fibrous protein domain-mineralizing domain fusion proteins. See for example
FIGS. 1-5 .FIG. 2 shows the sequence of CRGD-15mer-CDMP1, a fusion protein of a spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the C-terminal end ofDMP 1 mineralizing domain (See, SEQ ID NO: 6), which is indicated with light grey highlight. -
FIG. 3 shows the sequence of the fusion protein CRGD-15mer-DMP1 (SEQ ID NO: 10). CRGD-15mer-DMP1 is a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by a dark grey highlight, and the full length sequence of DMP1 mineralizing domain (See, SEQ ID NO: 7), which is indicated with light grey highlight. -
FIG. 4 shows the sequence of the fusion protein 15mer-BSP (SEQ ID NO: 11). 15mer-BSP is a fusion protein of spider silk fibrous protein domain ((15mer) (See, SEQ ID NO: 4), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight. -
FIG. 5 shows the sequence of the fusion protein CRGD-15mer-BSP (SEQ ID NO: 12). CRGD-15mer-BSP a fusion protein of spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is indicated by light grey highlight, and a mineralizing domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with dark grey highlight. - Construction of Expression Vector for Recombinant Spider Silks:
- The consensus repeat unit of spider silk (-SGRGGLGGQGAGAAAAAGGAGQGGY GGLGSQGT-) (SEQ ID NO: 1) was derived from the native sequence of the
spidroin 1 of N. clavipes (accession P19837). The construction of the expression vector pET30a (+) containing 15 repeats of the silk was previously described (Bini et al., 2005) and was termed pET30a (+)-15mer. Plasmid containing the ratdentin matrix protein 1 cDNA (pGEX-DMP1) was previously described (Feng et al., J. Dent. Res. 2003, 82(10):776-780). Primers with BamHI and XhoI restriction enzyme sites were designed in order to copy the C-terminal portion ofrat DMP 1 from pGEX-DMP 1 by PCR: BamH I site, C-DMP1f: 5′-CAGGATCCAGGGGTGACAACCCAGAT-3′ (SEQ ID NO: 26) and Xho I site, C-DMP1r: 5′-GCCTCGAGGTAGCCATCTTGGCAATC-3′ (SEQ ID NO: 27). - PCR products were double digested with BamHI and XhoI before running on a 1% agarose gel. The band of C-terminal DMP1 DNA were cut from gel and purified using a MinElute gel extraction kit. Expression vector pET21a (+) was also double digested with BamHI and XhoI before running on a 0.8% agarose gel. The band of linearized pET21a (+) was purified using a QIAquick gel extraction kit. After determining the DNA concentration of the vector pET21a (+) and insert of C-terminal DMP1 based on intensities of 1 μl of each in a 1% gel against 1 μl of high mass DNA ladder, the ligation reactions were performed using a Quick ligation Kit™ based on an insert to vector molar ratio of 5:1. Fifty μl of one Shot® Mach1™ T1 phage-resistant cells were transformed with 1 μl of ligation reaction. The correct clone of vector pET21a (+) containing C-
terminal DMP 1, named as pET21a (+)-CDMP 1 was determined by DNA sequencing with forward and reverse T7 primers. pET21a (+)-CDMP1 was digested with BamHI and dephosphorylated with CIP before running on 0.8% agarose gel. The linearized vector was purified using a QIAquick gel extraction kit. pET30a (+)-15mer was digested with BamHI before running on 1% agarose gel and the DNA encoding the repeat unit of spider silk was purified using a MinElute gel extraction kit. The DNA concentrations of the vector pET21a (+)-CDMP1 and the insert: spider silk 15 mer were determined using the same method as described above. The spider silk 15 mer was then inserted into pET21a (+)-CDMP1 at the BamHI site by ligation reaction and the resulting vector was named as pET21a (+)-SS15m-CDMP1. DNA sequencing with forward and reverse T7 primers was performed to check the sequences of the vector. - Protein Expression and Purification:
- Expression plasmid pET21a (+)-SS15m-CDMP1 was transformed into Escherichia coli RY-3041 strain, kindly provided by Professor Ry Young (Texas A&M University, College Station, Tex.). High cell density cultivation using a 1.25 liter jar fermentor (Bioflo 3000; New Brunswick Scientific Co., Edison, N.J.) was performed as described previously (Butler et al. Int. J. Dev. Biol. 1995, 39: 169-179). Expression was induced by adding isopropyl-β-D-thiogalactoside to a final concentration of 2 mM at the early log phase when A600 was about 30. Cells were harvested after 3 h of induction by centrifuging the culture at 4° C., 6000×g, for 10 min. The cells were then sonicated on ice using sonicator equipped with a microtip. Ten second burst at 100 W with a 10 second cooling period between each burst was applied. The lysate was centrifuged at 10,000×g for 30 min at 4° C. to pellet the cellular debris. The recombinant silk protein was purified using Ni-NTA agarose resin from supernatant at 4° C. The purification fractions that contain the target protein were dialyzed against distilled water for 2 days and dry proteins were prepared by lyophilizing the aqueous solution. Dialyzed purification fractions were also concentrated and desalted by using Centricon plus 70 (NMW=10 kDa).
- Protein Characterization:
- SDS-PAGE was performed to analyze purification fractions and Western blot was performed using His-tag monoclonal antibody to further confirm the expression of the target proteins. Western blot analysis of CRGD-15mer-CDMP1 showed expression of the protein (data not shown). The target protein bands on 4-12% Bis-Tris PAGE gel were analyzed at the Yale University W. M. Keck Biotechnology Resource Laboratory to determine amino acid compositions. A Bruker Proflex™ mass spectrometer (Bruker, Billerica, Mass.) was used for molecular weight determination.
- Change of Protein Secondary Structure by Calcium Ion Binding:
- 0.2 mg/mL protein aqueous solution was prepared by the method described in protein expression and purification. Calcium chloride solution (1M) was added such that a molar ratio of protein to Ca ion was maintained at 1:1000. Protein secondary structures before and after adding Ca ion were studied by Fourier Transform Infrared Spectroscopy (FTIR). FTIR studies were performed using a Bruker Tensor 27 FTIR spectrometer with a BioATR accessory.
- Film Formation:
- Recombinant proteins were dissolved in hexafluoroisopropanol (HFIP) to a final concentration of 2% w/v. One-hundred μl of silk HFIP solution was loaded onto a silica wafer and dried in hood. Dried silk film was treated with 90% methanol to induce the transition of secondary structure from random coil to beta sheet. Concentrated silk aqueous solution was then loaded onto silk film and incubated at 37° C. overnight to dry.
- In vitro Mineralization:
- The silk films formed on silica wafer were then incubated in 1.5× simulated body fluid (SBF). 1.5×SBF was prepared as described previously (3) by dissolving reagent grade CaCl2, KH2PO4, NaCl, KCl, MgCl2.6H2O, NaHCO3, Na2SO4 in distilled water and buffering at pH 7.3 with tris-hydroxymethyl aminomethane and hydrochloric acid (HCl). A 1.5×SBF solution contains 1.5 times higher ion concentration than the SBF solution with ion concentrations close to human blood plasma. Fresh 1.5×SBF was prepared daily to replace the 1.5×SBF. After the silk coated silica wafers were soaked in 1.5×SBF for 3, 7, 14 and 21 days, they were removed, gently rinsed with distilled water and dried at room temperature.
- Scanning Electron Microscopy:
- Morphological investigation of the dried films before and after incubating in 1.5×SBF was performed using LEO 982 Field Emission Scanning Electron Microscope (SEM) (LEO Electron Microscopy, Inc., Thornwood, N.Y.) at 3.0 kV. The sample was sputter coated with gold prior to examination.
- Transmission Electron Microscopy:
- Samples for transmission electron microscopy (TEM) analysis were prepared by ultrasonicating of the silk films after incubation in 1.5×SBF in 200 μL of absolute ethanol for 10 min and then depositing a few drops of the suspension onto a standard TEM copper grid with a holey carbon support film. TEM images were obtained with a JOEL 2100 TEM operating at 200 kV with a LaB6 filament and recorded with a slow scan CCD camera. The diffraction patterns were obtained at calibrated camera lengths using a NiOx test specimen as a reference.
- Protein Expression and Purification:
- CRGD-15mer, molecular weight of which is 48.56 kDa, migrated to the right position on SDS-PAGE gel, while the apparent molecular weight of CRGD-15mer-CDMP1 indicated by SDS-PAGE electrophoresis was higher than the calculated molecular weight, which is 58.89 kDa. This is due to high content of acidic amino acids such as aspartic acid and glutamic acid in CRGD-15mer-CDMP1. Western blot analysis of CRGD-15mer-CDMP1 and CRGD-15mer-CDMP1 was detected based on the His tag (data not shown).
- Amino Acid Composition Analysis:
- Amino acid composition analysis confirmed the correct composition for the purified CRGD-15mer-CDMP1.
- Functional Change of Protein Secondary Structure by Calcium Ion Binding:
- CRGD-15mer-CDMP1 was unordered random coil in water before adding CaCl2, indicated by amide I peak at 1649 cm−1 and amide II peak at 1548 cm−1. After Ca ion binding, a helix and β sheet structures showed up, demonstrated by amide I peak at 1659 cm−1 (α helix) and 1632 cm−1 (β sheet) (
FIG. 11 ). - Film Formation:
- Silk secondary structure changed from random coil to 13 sheet after treated with 90% methanol (
FIG. 12 ) so that the film was more robust in solution. - The apatite nucleation ability of the functional recombinant silks was studied using the method of alternate soaking process. Silk films of the recombinant fusion proteins were cast using standard methods. Lyophilized fusion proteins were dissolved in HFIP solvent at a concentration of 2.5% w/v overnight at 4° C. The silk-HFIP solutions were then pipetted into 24-well culture plates and left in the hood for about 3 hours for the silk films to form and dry out. The silk films were then treated with 90% v/v methanol to induce β-sheet formation and prevent resolubilization of the films in aqueous solutions.
- Scanning Electron Microscopy:
- To asses the ability for mineralization, the cast recombinant silk film was first soaked in 200 mM aqueous calcium chloride solution buffered with tris(hydroxymethyl) aminomethane and HCl (pH 7.4) (Ca solution) for 1 hr at 37° C., then Ca solution was aspirated and the film was washed with abundant distilled water to wash way any unbound Ca2+, then 120 mM aqueous disodium hydrogenphosphate (P solution) was added to immerse the silk film for 1 hr at 37° C. After soaking in P solution for 1 hr, the film was washed again by distilled water. This is one round of mineralization. Three rounds of the soaking were carried out. The film surface was then observed by SEM. See
FIGS. 6A-6C , which show mineral deposition on silk film cast using CRGD-15mer-CDMP1. Deposition began to occur as in round one (FIG. 6B ) and continued through round three (FIG. 6C ). Control films made from CRGD-15mer and 15mer showed no deposition (data not shown). The SEM images indicate that the functional fusion silk proteins are capable of inducing apatite nucleation and growth, while silk proteins that so not contain mineralizing domains do not promote apatite nucleation. - In addition, scanning electron microscopy (SEM) surface morphologies of recombinant spider silk films after soaking in 1.5×SBF for various periods of time were assessed see
FIG. 13 . FIG. 13(A1)-FIG. 13(A5), SS15m-CDMP1 soaked in 1.5×SBF for 0, 3, 7, 14 and 21 days: FIG. 13(A1)-FIG. 13(A5) respectively. FIG. 13(B1)-FIG. 13(B5), SS15m soaked in 1.5×SBF for 0,3,7,14 and 21 days: FIG. 13(B1)-FIG. 13(B5) respectively. - The surfaces of the films made of CRGD-15mer-CDMP1 and CRGD-15mer were smooth after casting and there was no big difference between two films (FIG. 13A1 and FIG. 13B1). However, after immersing in 1.5×SBF for 3 days, the surface morphologies of the films were different (FIG. 13A2 and FIG. 13B2).
- Transmission Electron Microscopy:
- The high-magnification image of the crystals grew on CRGD-15mer-CDMP1 (
FIG. 14A ) showed that the apatite, which appeared flake-like in the SEM, is composed of aggregates of nanocrystals with need shapes 100-200 nm in length. The electron diffraction pattern of the nanocrystals (FIG. 14B ) showed diffraction rings. The spacings of the rings agreed with the characteristic x-ray diffraction spacing of hydroxyapatite (JCPDS 09-0432). The rings could be assigned to the (002), (211) planes. In addition, a high-resolution TEM image (FIG. 14C ) showed the lattice fringes of apatite nanocrystals. The average distance between fringes is 0.82 nm, which is consistent with the value of teh (100) inerplanar spacing in the apatite structure (0.817 nm). - Silica is widespread in biological systems and serves different functions, among which the most essential ones include support and protection in single-celled organisms, such as diatoms, to higher plants and animals. Despite its widespread occurrence and importance of function, little is known about biosilica and the mechanisms used to produce controlled microscopic and macroscopic silica structures with such nanoscale precision and symmetry. The remarkable control in vivo of the morphology of these beautiful intricate patterns at small length scales are species-specific and has attracted a great deal of interest in recent years as these features exceed the capabilities of present-day synthetic and technological approaches to materials engineering in vitro.
- Silaffins1;2;3;4;5 form part of three families of proteins identified to date in the organic matrix of the cell wall of the diatom Cylindrotheca fusiformis. Silaffins are highly post-translationally modified peptides and have received the most attention because of their ability to induce and regulate silica precipitation at ambient temperature and pressure. Silaffins are low-molecular weight polypeptides: natSil-1A (6.5 kDa)4, natSil-1B (10 kDa)5, and natSil-2 (40 kDa)5, isolated by treating the diatom cell wall with ammonium fluoride. A
gene sil 1 has been isolated from a C. fusiformis genomic library and it encodes a polypeptide of 265 amino acids. Seven repeated sequences were identified in this sequence and named R1 to R71. R1 corresponds to the precursor of Silaffin-1B, while R3 to R7 and R2 correspond to the precursors of the Silaffin-1A1 and Silaffin-1A2, respectively. - Controlled formation of biosilica structures by different proteins and peptides under various physical reaction environments has also been reported6;7;8;9. The 19 amino-acid R5 peptide of the Sil1 protein was utilized to obtain silica nanostructures with different morphologies including spheres, arch-shaped morphologies and even elongated fibers'. These results suggest that through careful manipulation of the environmental conditions and the application of a linear shear force, distinct morphologies can be attained. These opportunities for control of materials outcomes in biosilica morphology establish important links to device fabrication from these materials with regularity in process and outcomes to achieve technological relevance in the future, such as for silica based micro- and nano-devices.
- Applicants have genetically cloned the R5 peptide unit of Sil1 protein to a 15mer spider silk clone of the consensus sequence of the golden orb spider Nephila clavipes, expressed the fusion protein and performed the same silicification reactions on silk films made from the expressed protein. The purpose of fusing this silicification-inducing peptide unit to our genetically engineered silk is to combine the properties of our silk whether in the form of films or other such as spun fibers to the silica precipitating properties of R5 under ambient conditions to produce biomaterials with controlled silica morphologies on the surface. These biomaterials are especially useful in such fields as controlled drug delivery.
- The repeat unit was selected used in the design of the 15mer and CRGD15mer was based on the consensus sequence of spidroin1 native sequence of Nephila clavipes (accession P19837) (-SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT-) (SEQ ID NO: 1). Multimers encoding the repeat were cloned through the transfer of cloned inserts between two shuttle vectors based on pUC19 and pCR-Script (Novagen, Wis.), which were ampicillin and chloramphenicol resistant respectively10;11.
- The expression vector pET-30a (Novagen, Madison, Wis.) was modified with a linker carrying the SpeI site flanked by sequences encoding the amino acids CRGD (SEQ ID NO: 2) to obtain pET30-link. The two complementary oligonucleotide sequences for the linker were: GGATCCTGTCGCGGTGACACTAGTCGCGGTGACTGTG (SEQ ID NO: 13) and GGATCCACAGTCACCGCGACTAGTGTCACCGCGACAG (SEQ ID NO: 14). The restriction sites of BamHI and SpeI are underlined. The 15mer sequence obtained by multimerization was inserted into pET30-link to generate pET30-CRGD15mer. For the production of a spider silk protein without CRGD (SEQ ID NO: 2), the construct pET30-15mer was obtained by subcloning the NcoI-NotI fragment of pCR-15 into pET-30a vector.
- To construct the fusion protein CRGD15mer-R5, the polylinker of pET-21a(+) shuttle vector was redesigned to contain a His-Tag and the CRGD15mer was digested with the restriction enzyme BamHI from pET-30a vector and inserted into the pET-21a(+)-link vector. Two complementary oligonucleotide sequences for the R5 peptide were designed with EcoRI and NotI sites at the 5′ and 3′ ends respectively:
-
(SEQ ID NO: 15) 5′ aattcagcagcaaaaaaagcggcagctattcgggcagcaaaggca gcaaacgccgcatcctcgc 3′ and (SEQ ID NO: 16) 3′ gtcgtcgtttttttcgccgtcgataagcccgtcgtttccgtcgtt tgcggcgtaggagcgccgg 5′ - These synthetic oligonucleotides were annealed and ligated into the pET-21a(+)-link vector right next to the CRGD15mer clone to create the fusion protein with the His-Tag at the C-terminus.
- To construct the fusion protein 15mer-R5, the synthetic oligonucleotides were ligated into the NotI and XhoI restriction sites of pET-21a(+) vector right next to the 15mer clone. This fusion protein has a His-Tag at the N-terminus. The amino acid sequence of the R5 peptide of Sil1 protein is: SSKKSGSYSGSKGSKRRIL (SEQ ID NO: 17). Use of other Sil1 protein sequences are also contemplated, for example, the R2 peptide SSKKSGSYSGYSTKKSGSRRIL (SEQ ID NO: 18), the R3 peptide SSKKSGSYSGYSKGSKRRIL (SEQ ID NO: 19), the R4/R6 peptide SSKKSGSYSGYSKGSKRRNL (SEQ ID NO: 20), the R1 peptide SSKKSGSYYSYGTKK (SEQ ID NO:21).
- The constructs pET-21(a)+−15mer-R5 and pET-30a-CRGD15mer-R5 were used to transform the E. coli host strains RY-3041, a mutant strain defective in the expression of SlyD protein, for expression12;13. Cells were cultivated in LB broth at 37° C. Protein expression was induced by the addition of 1 mM IPTG (Fisher Scientific, Hampton, N.H.) when the OD600 was between 0.6 and 0.8. After approximately 6 hours of protein expression, the cells were harvested by centrifugation at 9500 rpm. For large scale expression, E. coli was grown in a fermentor (Bioflo 3000, New Brunswick Scientific Co., Edison, N.J.) in minimal medium supplemented with 1% yeast extract. Ammonia was used as the base to maintain the pH at 6.8. When the pH exceeded 6.88, as a result of glucose exhaustion in the culture, a feed solution (50% glucose, 10% Yeast Extract, 2% MgSO4.7H2O) was added. Pure O2 was also provided to the culture to sustain the level of dissolved oxygen above 40%. All culture media contained kanamycin (50 μg/ml) or ampicillin (100 μg/ml) for selectivity. For the fermentor grown cells, expression was induced when the absorbance was between 25 and 30 at OD600.
- The cell pellets were resuspended by adding denaturing buffer (100 mM NaH2PO4, 10 mM Tris HCl, 8 M urea, pH 8.0) containing 10 mM imidazole. The cells were lysed by stirring for 30 min and were then centrifuged at 9500 rpm at 4° C. for 30 min. His-tag purification of the proteins was performed by addition of Ni-NTA agarose resin (Qiagen, Valencia, Calif.) to the supernatant (batch purification) under denaturing conditions. After washing the column with denaturing buffer at pH 6.3, the proteins were eluted with denaturing buffer at pH 4.5 (without imidazole).
- SDS-polyacrylamide gel electrophoresis (PAGE) was performed using 4-12% precast NuPage Bis-Tris gels (Invitrogen, Carlsbad, Calif.). Electrophoresis was performed in MOPS buffer for 50 min at 200V. Purified samples were extensively dialyzed against several changes of H2O. For dialysis, Snake Skin membranes (Pierce, Rockford, Ill.) with MWCO of 7000 or lower were used. The dialyzed samples were lyophilized using a LabConco lyophilizer. For determination of the amino acid composition, the samples were submitted to the W. M. Keck Foundation Biotechnology Resource Laboratory (Yale University, New Haven, Conn.). The samples were analyzed from bands of interest cut out from the gel or lyophilized powder after purification and dialysis. Determination of protein concentration was performed by BCA assay (Pierce, Rockford, Ill.) or the molar absorptivity at 280 nm.
FIGS. 7A and 7B show the sequence of CRGD15mer-R5 (FIG. 7A ) and 15mer-R5 (FIG. 7B ) - The lyophilized fusion proteins were then dissolved in HFIP solvent at a concentration of 2.5% w/v overnight at 4° C. The silk-HFIP solutions were then pipetted into 24-well culture plates and left in the hood for about 3 hours for the silk films to form and dry out. The silk films were then either left as is or treated with 90% v/v methanol to induce β-sheet formation and prevent resolubilization of the films in aqueous solutions. 100 mM phosphate buffer at pH 5.5 was added to the silk films and leave to sit for about 30 minutes before 1M tetramethoxysilane (TMOS) dissolved in 1 mM hydrochloric acid was added to the mixture for about 10 minutes. The films were then washed with MilliQ water three times and left to dry overnight in the fume hood. These films were then analyzed using a LEO 982 Scanning Electron Microscope at the CIMS facility at Harvard University.
- In order to exploit the self-assembling properties of silk in developing silk-silica nanocomposites, experiments were performed using TMOS alone as the precursor. Four genetically engineered variants of the spider silk protein (two controls, one with and one without RGD but both without R5, two chimeric versions of the controls but with R5) were cast into films that were either left untreated or were treated with methanol to induce a structural transition to β-sheet and thus decrease film solubility in aqueous buffer. Silicification reactions were performed on the films yielding spherical silica structures with diameters ranging from ˜0.5 to 2.0 um only when the silica precipitating domain, R5 peptide, was fused to the C-terminus of the silk proteins (
FIG. 8 ). The silk proteins that did not contain R5, CRGD15mer and 15mer, did not yield significant changes in surface morphology of the films upon exposure to the silicification reactions. - Fusion proteins were assembled into fibers by electrospinning. SEM images of the electropun fibers formed from the chimeric proteins (
FIGS. 9A-9D ), and the morphological characteristics observed when the fibers were treated with methanol, were similar to those we observed previously for electrospun silk fibroin with polyethylene oxide15. Upon silicification on electrospun mats formed from the chimeric protein CRGD15mer+R5 without methanol treatment, similar spherical silica structures were observed as in the reactions on the cast films. However, the dimensions of the silica spheres were slightly smaller, ranging from 200 to 400 nm (FIG. 9 ). When the electrospun fibers consisting of the chimera CRGD15mer+R5 were not treated with methanol, the fibers fused together on the surface. Without the β-sheet inducing methanol treatment, the fibers are prone to partially solubilize on the surface yielding a thin film upon which the mineralization reaction takes place. However, upon treatment of the chimera CRGD15mer+R5 electrospun mats with methanol before silicification, a thin film formed from the solubilized and then fused fibers at the surface and silica nanospheres did not form as in the sample above. Instead, the fibers fused with each other as expected15 and although mineralization occurred as confirmed by XPS, silica deposited around the fibers providing a non-uniform coating instead of the spheres (FIG. 9 ). When the chimera CRGD15mer+R5 was electrospun during the silica polymerization process (concurrent processing), silica deposition was induced in and on the fibers and elliptically shaped silica particles fused to the fibers were observed (FIG. 9 ). XPS analysis of the resulting fibers confirmed the presence of elemental silicon (FIG. 10 ). Thus, the concurrent processing approach, fiber spinning and silicification reactions, resulted in a different morphology of the silica in terms of location within the fibers and shape, compared to the silicification reactions conducted post electrospinning. - Fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes)<
-
(SEQ ID NO: 1) SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT - A linker sequence CRGD (SEQ ID NO: 2)
- The consensus fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes) with CRGD linker
-
(SEQ ID NO: 3) CRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT - 15 mer: An amino acid sequence that contains a repeat of a fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes) The fibrous protein domain sequence is repeated 15 times.
-
(SEQ ID NO: 4) MASMTGGQQMGRGSAMASGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQG TSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQ GTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGS QGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGA AAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAG AAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGA GAAAAAGGAGQGGYGGLGSQGTSHHHHH - CRGD-15mer: an amino acid sequence that contains a repeat of a fibrous protein domain sequence derived from Spidroin1 (the native sequence of the goldon orb spider Nephilia clavipes) The fibrous protein domain sequence is repeated 15 times with a CRGD linking sequence
-
(SEQ ID NO: 5) MASMTGGQQMGRGSCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGS QGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGA AAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAG AAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGA GAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG LGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQG AGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYG GLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ GAGAAAAAGGAGQGGYGGLGSQGTSRGDCGSHHHHHH - CDMP1, the C-Terminal Sequence of DMP1, a Mineralizing domain
-
(SEQ ID NO: 6) RGDNPDNTSQTGDQRDSESSEEDRLNTFSSSESQSTEEQGDSESNESLS LSEESQESAQDEDSSSQEGLQSQSASRESRSQESQSEEDSRSEENRDSD SQDSSRSKEESNSTGSTSSSEEDNHPKNIEADNRKLIVDAYHNKPIGDQ DDNDCQDGY - DMP1, the full length sequence of DMP1, a Mineralizing domain
-
(SEQ ID NO: 7) LPVARYQNTESESSEERTGNLAQSPPPPMANSDHTDSSESGEELGSDR SQYRPAGGLSKSAGMDADKEEDEDDSGDDTFGDEDNGPGPEERQWGGP SRLDSDEDSADTTQSSEDSTSQENSAQDTPSDSKDHHSDEADSRPEAG DSTQDSESEEYRVGGGSEGESSHGDGSEFDDEGMQSDDPGSTRSDRGH TRMSSADISSEESKGDHEPTSTQDSDDSQDVEFSSRKSFRRSRVSEED DRGELADSNSRETQSVSTEDFRSKEESRSETQEDTAETQSQEDSPEGQ DPSSESSEEAGEPSQESSSESQEGVASESRGDNPDNTSQTGDQRDSES SEEDRLNTFSSSESQSTEEQGDSESNESLSLSEESQESAQDEDSSSQE GLQSQSASRESRSQESQSEEDSRSEENRDSDSQDSSRSKEESNSTGST SSSEEDNHPKNIEADNRKLIVDAYHNKPIGDQDDNDCQDGY - BSP: Bone sialoprotein, a Mineralizing domain
-
(SEQ ID NO: 8) SEFPVQSSSDSSEENGNGDSSEEEEEEEENSNEEENNEENED SDGNED - CRGD-15mer-CDMP1: (SEQ ID NO: 9): a fusion protein of (SEQ ID NO: 5) and (SEQ ID NO: 6)<
-
(SEQ ID NO: 9) MASMTGGQQMGRCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ GAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQ GGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSG RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGG QGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAG QGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTS GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG LGSQGTSRGDCGSRGDNPDNTSQTGDQRDSESSEEDRLNTFSSSES QSTEEQGDSESNESLSLSEESQESAQDEDSSSQEGLQSQSASRESR SQESQSEEDSRSEENRDSDSQDSSRSKEESNSTGSTSSSEEDNHPK NIEADNRKLIVDAYHNKPIGDQDDNDCQDGY - CRGD-15mer-DMP1 (SEQ ID NO: 10): a fusion protein of (SEQ ID NO: 5) and SEQ ID NO: 7)<
-
(SEQ ID NO: 10) MASMTGGQQMGRCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ GAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQ GGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSG RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL GGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGLGSQGTSGRGGLGG QGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAG QGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTS GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG LGSQGTSRGDCGSLPVARYQNTESESSEERTGNLAQSPPPPMANSD HTDSSESGEELGSDRSQYRPAGGLSKSAGMDADKEEDEDDSGDDTF GDEDNGPGPEERQWGGPSRLDSDEDSADTTQSSEDSTSQENSAQDT PSDSKDHHSDEADSRPEAGDSTQDSESEEYRVGGGSEGESSHGDGS EFDDEGMQSDDPGSTRSDRGHTRMSSADISSEESKGDHEPTSTQDS DDSQDVEFSSRKSFRRSRVSEEDDRGELADSNSRETQSVSTEDFRS KEESRSETQEDTAETQSQEDSPEGQDPSSESSEEAGEPSQESSSES QEGVASESRGDNPDNTSQTGDQRDSESSEEDRLNTFSSSESQSTEE QGDSESNESLSLSEESQESAQDEDSSSQEGLQSQSASRESRSQESQ SEEDSRSEENRDSDSQDSSRSKEESNSTGSTSSSEEDNHPKNIEAD NRKLIVDAYHNKPIGDQDDNDCQDGY - 15mer-BSP (SEQ ID NO: 11): a fusion protein of (SEQ ID NO: 4) and (SEQ ID NO: 8)
-
(SEQ ID NO: 11) MASMTGGQQMGRGSAMASGRGGLGGQGAGAAAAAGGAGQGGYGGLG SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ GAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQ GGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSG RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGG QGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAG QGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTS GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG LGSQGTSEFPVQSSSDSSEENGNGDSSEEEEEEEENSNEEENNEEN EDSDGNEDKLHHHHHH - CRGD-15mer-BSP (SEQ ID NO: 12): a fusion protein of (SEQ ID NO: 5) and (SEQ ID NO: 8) with linker
-
(SEQ ID NO: 12) MASMTGGQQMGRGSCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGG LGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLG GQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGA GQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGA AAAAGGAGQGGYGGLGSQGTSGRGGLGGOGAGAAAAAGGAGOGGYG GTGSOGTSGRGGTGGOGAGAAAAAGGAGOGGYGGLGSQGTSGRGGL GGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGG AGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQG TSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAG AAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGY GGLGSQGTSRGDCGSESEFPVQSSSDSSEENGNGDSSEEEEEEEEN SNEEENNEENEDSDGNEDKLHHHHHH - One of two complementary oligonucleotide sequences for the linker carrying the SpeI site flanked by sequences encoding the amino acids CRGD to obtain pET30-link
-
(SEQ ID NO: 13) GGATCCTGTCGCGGTGACACTAGTCGCGGTGACTGTG - One of two complementary oligonucleotide sequences for the linker carrying the SpeI site flanked by sequences encoding the amino acids CRGD to obtain pET30-link
-
(SEQ ID NO: 14) GGATCCACAGTCACCGCGACTAGTGTCACCGCGACAG - One of two complementary oligonucleotide sequences for the R5 peptide (contains the 19 amino-acid R5 peptide of the Sil1 protein) which were designed with EcoRI and NotI sites at the 5′ and 3′ ends respectively
-
(SEQ ID NO: 15) 5′ aattcagcagcaaaaaaagcggcagctattcgggcagcaaaggca gcaaacgccgcatcctcgc 3′ - One of two complementary oligonucleotide sequences for the R5 peptide (contains the 19 amino-acid R5 peptide of the Sil1 protein) which were designed with EcoRI and NotI sites at the 5′ and 3′ ends respectively.
-
(SEQ ID NO: 16) 3′ gtcgtcgtttttttcgccgtcgataagcccgtcgtttccgtcgttt gcggcgtaggagcgccgg 5′ - The amino acid sequence of the R5 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGSKGSKRRIL (SEQ ID NO: 17)
- The amino acid sequence of the R2 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGYSTKKSGSRRIL (SEQ ID NO: 18),
- The amino acid sequence of the R3 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGYSKGSKRRIL (SEQ ID NO: 19),
- The amino acid sequence of the R4/R6 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYSGYSKGSKRRNL (SEQ ID NO: 20).
- The amino acid sequence of the R1 peptide of Sil1 protein from C. fusiformis is: SSKKSGSYYSYGTKK (SEQ ID NO:21).
- Bone Sialoprotein Precursor [Homo sapiens] Accession AAC95490 is:
-
(SEQ ID NO: 22) MKTALILLSI LGMACAFSMK NLHRRVKIED SEENGVFKYR PRYYLYKHAY FYPHLKRFPV QGSSDSSEEN GDDSSEEEEE EEETSNEGEN NEESNEDEDS EAENTTLSAT TLGYGEDATP GTGYTGLAAI QLPKKAGDIT NKATKEKESD EEEEEEEEGN ENEESEAEVD ENEQGINGTS TNSTEAENGN GSSGGDNGEE GEEESVTGAN AEGTTETGGQ GKGTSKTTTS PNGGFEPTTP PQVYRTTSPP FGKTTTVEYE GEYEYTGVNE YDNGYEIYES ENGEPRGDNY RAYEDEYSYF KGQGYDGYDG QNYYHHQ -
Silaffin 1 precursor (natSil-1) [Contains: Silaffin-1B; Silaffin-1A2; Silaffin-1A1] Accession Q9SE35: MKLTAIFPLL FTAVGYCAAQ SIADLAAANL STEDSKSAQL ISADSSDDAS DSSVESVDAA SSDVSGSSVE SVDVSGSSLE SVDVSGSSLE SVDDSSEDSE EEELRILSSK KSGSYYSYGT KKSGSYSGYS TKKSASRRIL SSKKSGSYSG YSTKKSGSRR ILSSKKSGSY SGSKGSKRR1 LSSKKSGSYS GSKGSKRRNL SSKKSGSYSG SKGSKRRILS SKKSGSYSGS KGSKRRNLSS KKSGSYSGSK GSKRRILSGG LRGSM (SEQ ID NO: 23) - CRGD15mer-R5: Sequence of fusion protein; fusion of CRGD15mer to the amino acid sequence of the R5 peptide of Sil1 protein from C. fusiformis.
-
(SEQ ID NO: 24) MASMTGGQQM GRGSCRGDTS GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG TSGRGGLGGQ GAGAAAAAGG AGQGGYGGLG SQGTSGRGGL GGQGAGAAAA AGGAGQGGYG GLGSQGTSGR GGLGGQGAGA AAAAGGAGQG GYGGLGSQGT SGRGGLGGQG AGAAAAAGGA GQGGYGGLGS QGTSGRGGLG GQGAGAAAAA GGAGQGGYGG LGSQGTSGRG GLGGQGAGAA AAAGGAGQGG YGGLGSQGTS GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG TSGRGGLGGQ GAGAAAAAGG AGQGGYGGLG SQGTSRGDCG SEFSSKKSGS YSGSKGSKRR ILCGRHHHHH H - 15mer-R5: Sequence of fusion protein; fusion of 15mer to the amino acid sequence of the R5 peptide of Sil1 protein from C. fusiformis. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMASGRG GLGGQGAGAA AAAGGAGQGG YGGLGSQGTS GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG TSGRGGLGGQ GAGAAAAAGG AGQGGYGGLG SQGTSGRGGL GGQGAGAAAA AGGAGQGGYG GLGSQGTSGR GGLGGQGAGA AAAAGGAGQG GYGGLGSQGT SGRGGLGGQG AGAAAAAGGA GQGGYGGLGS QGTSGRGGLG GQGAGAAAAA GGAGQGGYGG LGSQGTSGRG GLGGQGAGAA AAAGGAGQGG YGGLGSQGTS GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG TSSSKKSGSY SGSKGSKRRI L (SEQ ID NO: 25)
- PCR PRIMER BamH I site, C-DMPlf: 5′-CAGGATCCAGGGGTGACAACCCAGAT-3′ (SEQ ID NO: 26)
- PCR PRIMER Xho I site, C-DMP1r: 5′ GCCTCGAGGTAGCCATCTTGGCAATC-3′ (SEQ ID NO: 27).
- The references cited herein and throughout the application are incorporated by reference.
-
- 1. Kroger, N., Deutzmann, R. & Sumper, M. (1999). Polycationic peptides from diatom biosilica that direct silica nanosphere formation. Science 286, 1129-32.
- 2. Kroger, N., Deutzmann, R. & Sumper, M. (2001). Silica-precipitating peptides from diatoms. The chemical structure of silaffin-A from Cylindrotheca fusiformis. J Biol Chem 276, 26066-70.
- 3. Kroger, N., Deutzmann, R., Bergsdorf, C. & Sumper, M. (2000). Species-specific polyamines from diatoms control silica morphology. Proc Natl Acad Sci USA 97, 14133-8.
- 4. Kroger, N., Lorenz, S., Brunner, E. & Sumper, M. (2002). Self-assembly of highly phosphorylated silaffins and their function in biosilica morphogenesis. Science 298, 584-6.
- 5. Poulsen, N., Sumper, M. & Kroger, N. (2003). Biosilica formation in diatoms: characterization of native silaffin-2 and its role in silica morphogenesis. Proc Natl
Acad Sci USA 100, 12075-80. - 6. Rodriguez, F., Glawe, D. D., Naik, R. R., Hallinan, K. P. & Stone, M. O. (2004). Study of the chemical and physical influences upon in vitro peptide-mediated silica formation.
Biomacromolecules 5, 261-5. - 7. Naik, R. R., Whitlock, P. W., Rodriguez, F., Brott, L. L., Glawe, D. D., Clarson, S. J. & Stone, M. O. (2003). Controlled formation of biosilica structures in vitro. Chem Commun (Camb), 238-9.
- 8. Patwardhan, S. V. & Clarson, S. J. (2002). Silicification and biosilicification. Part 4. Effect of template size on the formation of silica. Journal of Inorganic and Organometallic Polymers 12, 109-116.
- 9. Patwardhan, S. V. & Clarson, S. J. (2003). Silicification and biosilicification:
Part 5. An investigation of the silica structures formed at weakly acidic pH and neutral pH as facilitated by cationically charged macromolecules. Materials Science and Engineering C 23, 495-499. - 10. Prince, J. T., McGrath, K. P., DiGirolamo, C. M. & Kaplan, D. L. (1995). Construction, cloning, and expression of synthetic genes encoding spider dragline silk. Biochemistry 34, 10879-85.
- 11. Winkler, S., Wilson, D. & Kaplan, D. L. (2000). Controlling beta-sheet assembly in genetically engineered silk by enzymatic Phosphorylation/Dephosphorylation, by. Biochemistry 39, 14002.
- 12. Yan, S. Z., Beeler, J. A., Chen, Y., Shelton, R. K. & Tang, W. J. (2001). The regulation of type 7 adenylyl cyclase by its C1b region and Escherichia coli peptidylprolyl isomerase, SlyD. J Biol Chem 276, 8500-6.
- 13. Huang, J., Valluzzi, R., Bini, E., Vernaglia, B. & Kaplan, D. L. (2003). Cloning, expression, and assembly of sericin-like protein. J Biol Chem 278, 46117-23.
- 14. Sumper, M. & Kroger, N. (2004). Silica formation in diatoms: the function of long-chain polyamines and silaffins. J Mater Chem 14, 2059-2065.
- 15. Jin, H. J., Fridrikh, S. V., Rutledge, G. C. & Kaplan, D. L. (2002). Electrospinning Bombyx mori silk with poly(ethylene oxide).
Biomacromolecules 3, 1233-1239.
Claims (20)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/280,324 US20140379094A1 (en) | 2005-01-14 | 2014-05-16 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US64426405P | 2005-01-14 | 2005-01-14 | |
PCT/US2006/001536 WO2006076711A2 (en) | 2005-01-14 | 2006-01-17 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US79493408A | 2008-01-14 | 2008-01-14 | |
US13/097,538 US8129141B2 (en) | 2005-01-14 | 2011-04-29 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/347,801 US8501437B2 (en) | 2005-01-14 | 2012-01-11 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/934,828 US8772456B2 (en) | 2005-01-14 | 2013-07-03 | Fibrous protein fusion and use thereof in the formation of advanced organic/inorganic composite materials |
US14/280,324 US20140379094A1 (en) | 2005-01-14 | 2014-05-16 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/934,828 Continuation US8772456B2 (en) | 2005-01-14 | 2013-07-03 | Fibrous protein fusion and use thereof in the formation of advanced organic/inorganic composite materials |
Publications (1)
Publication Number | Publication Date |
---|---|
US20140379094A1 true US20140379094A1 (en) | 2014-12-25 |
Family
ID=36678281
Family Applications (5)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/794,934 Active 2027-07-07 US7960509B2 (en) | 2005-01-14 | 2006-01-17 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/097,538 Active US8129141B2 (en) | 2005-01-14 | 2011-04-29 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/347,801 Active US8501437B2 (en) | 2005-01-14 | 2012-01-11 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/934,828 Active US8772456B2 (en) | 2005-01-14 | 2013-07-03 | Fibrous protein fusion and use thereof in the formation of advanced organic/inorganic composite materials |
US14/280,324 Abandoned US20140379094A1 (en) | 2005-01-14 | 2014-05-16 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
Family Applications Before (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US11/794,934 Active 2027-07-07 US7960509B2 (en) | 2005-01-14 | 2006-01-17 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/097,538 Active US8129141B2 (en) | 2005-01-14 | 2011-04-29 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/347,801 Active US8501437B2 (en) | 2005-01-14 | 2012-01-11 | Fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials |
US13/934,828 Active US8772456B2 (en) | 2005-01-14 | 2013-07-03 | Fibrous protein fusion and use thereof in the formation of advanced organic/inorganic composite materials |
Country Status (2)
Country | Link |
---|---|
US (5) | US7960509B2 (en) |
WO (1) | WO2006076711A2 (en) |
Families Citing this family (72)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP4638735B2 (en) * | 2002-06-24 | 2011-02-23 | タフツ ユニバーシティー | Silk biomaterial and method of using the same |
WO2004062697A2 (en) | 2003-01-07 | 2004-07-29 | Tufts University | Silk fibroin materials and use thereof |
CA2562415C (en) * | 2003-04-10 | 2015-10-27 | Tufts University | Concentrated aqueous silk fibroin solutions free of organic solvents and uses thereof |
WO2005000483A1 (en) * | 2003-06-06 | 2005-01-06 | Tufts University | Method for forming inorganic coatings |
CN103646848B (en) | 2004-06-04 | 2018-06-05 | 伊利诺伊大学评议会 | The method of assembling printable semiconductor elements and manufacture electronic device |
US20070238808A1 (en) * | 2006-03-09 | 2007-10-11 | Goldberg A J | Dental materials, methods of making and using the same, and articles formed therefrom |
DE102006036653A1 (en) * | 2006-08-03 | 2008-02-07 | Philipps-Universität Marburg | Polymer fibers containing bacteria |
JP2010522583A (en) | 2007-02-27 | 2010-07-08 | トラスティーズ オブ タフツ カレッジ | Silk organs made by tissue engineering |
US8187616B2 (en) | 2007-05-29 | 2012-05-29 | Trustees Of Tufts College | Method for silk fibroin gelation using sonication |
CN101970023A (en) * | 2008-02-07 | 2011-02-09 | 塔夫茨大学信托人 | 3-dimensional silk hydroxyapatite compositions |
WO2009140588A1 (en) * | 2008-05-15 | 2009-11-19 | Trustees Of Tufts College | Silk polymer-based adenosine release: therapeutic potential for epilepsy |
US8501172B2 (en) * | 2008-09-26 | 2013-08-06 | Trustees Of Tufts College | pH-induced silk gels and uses thereof |
US8886334B2 (en) | 2008-10-07 | 2014-11-11 | Mc10, Inc. | Systems, methods, and devices using stretchable or flexible electronics for medical applications |
US8372726B2 (en) | 2008-10-07 | 2013-02-12 | Mc10, Inc. | Methods and applications of non-planar imaging arrays |
EP2349440B1 (en) | 2008-10-07 | 2019-08-21 | Mc10, Inc. | Catheter balloon having stretchable integrated circuitry and sensor array |
US8389862B2 (en) | 2008-10-07 | 2013-03-05 | Mc10, Inc. | Extremely stretchable electronics |
US8097926B2 (en) | 2008-10-07 | 2012-01-17 | Mc10, Inc. | Systems, methods, and devices having stretchable integrated circuitry for sensing and delivering therapy |
BRPI0920453A2 (en) * | 2008-10-09 | 2015-12-22 | Tufts College | silk film, fabric engineering construction, methods for preparing a silk film, for covering a surface of a substrate with a silk composition, and for embedding at least one active agent in a silk film, and, film-coated substrate. sedal film |
US9308070B2 (en) | 2008-12-15 | 2016-04-12 | Allergan, Inc. | Pliable silk medical device |
EP2421551B2 (en) * | 2009-04-20 | 2020-07-15 | Allergan, Inc. | Silk fibroin hydrogels and uses thereof |
US20120070427A1 (en) | 2009-06-01 | 2012-03-22 | Trustees Of Tufts College | Vortex-induced silk fibroin gelation for encapsulation and delivery |
WO2011006133A2 (en) * | 2009-07-10 | 2011-01-13 | Trustees Of Tufts College | Bioengineered silk protein-based nucleic acid delivery systems |
EP2453931A4 (en) | 2009-07-14 | 2014-04-30 | Tufts College | Electrospun silk material systems for wound healing |
US9016875B2 (en) | 2009-07-20 | 2015-04-28 | Tufts University/Trustees Of Tufts College | All-protein implantable, resorbable reflectors |
EP2483460B1 (en) | 2009-09-28 | 2015-09-02 | Trustees Of Tufts College | Method to prepare drawn silk egel fibers |
WO2011041395A2 (en) | 2009-09-29 | 2011-04-07 | Trustees Of Tufts College | Silk nanospheres and microspheres and methods of making same |
WO2011041727A1 (en) | 2009-10-01 | 2011-04-07 | Mc10, Inc. | Protective cases with integrated electronics |
US9936574B2 (en) | 2009-12-16 | 2018-04-03 | The Board Of Trustees Of The University Of Illinois | Waterproof stretchable optoelectronics |
JP6046491B2 (en) | 2009-12-16 | 2016-12-21 | ザ ボード オブ トラスティーズ オブ ザ ユニヴァーシティー オブ イリノイ | In vivo electrophysiology using conformal electronics |
US10441185B2 (en) | 2009-12-16 | 2019-10-15 | The Board Of Trustees Of The University Of Illinois | Flexible and stretchable electronic systems for epidermal electronics |
US9603971B2 (en) | 2010-03-05 | 2017-03-28 | Trustees Of Tufts College | Silk-based ionomeric compositions |
JP5751728B2 (en) | 2010-03-17 | 2015-07-22 | ザ ボード オブ トラスティーズ オブ ザ ユニヴァーシティー オブ イリノイ | Embedded biomedical devices on bioabsorbable substrates |
WO2011129756A1 (en) * | 2010-04-12 | 2011-10-20 | Spiber Technologies Ab | Methods and combination |
US9566365B2 (en) | 2010-09-01 | 2017-02-14 | Trustees Of Tufts College | Silk fibroin and polyethylene glycol-based biomaterials |
CN103328034A (en) | 2010-09-03 | 2013-09-25 | 塔夫茨大学/塔夫茨学院信托人 | Plasmonic nanoparticle-doped silk materials |
JP2014502416A (en) | 2010-09-27 | 2014-01-30 | タフツ ユニバーシティー/トラスティーズ オブ タフツ カレッジ | Silk-based piezoelectric material |
US10933173B2 (en) | 2010-10-19 | 2021-03-02 | Trustees Of Tufts College | Silk fibroin-based microneedles and methods of making the same |
CA2815267C (en) | 2010-10-27 | 2019-06-25 | Spiber Technologies Ab | Spider silk fusion protein structures for binding to an organic target |
US8319181B2 (en) | 2011-01-30 | 2012-11-27 | Fei Company | System and method for localization of large numbers of fluorescent markers in biological samples |
US9109047B2 (en) | 2011-02-03 | 2015-08-18 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd | High molecular ordered fibrilar structures, method for their preparation and uses thereof |
WO2012145652A1 (en) | 2011-04-20 | 2012-10-26 | Trustees Of Tufts College | Dynamic silk coatings for implantable devices |
US20140287043A1 (en) | 2011-04-21 | 2014-09-25 | Trustees Of Tufts College | Compositions and methods for stabilization of active agents |
US9765934B2 (en) | 2011-05-16 | 2017-09-19 | The Board Of Trustees Of The University Of Illinois | Thermally managed LED arrays assembled by printing |
KR102000302B1 (en) | 2011-05-27 | 2019-07-15 | 엠씨10, 인크 | Electronic, optical and/or mechanical apparatus and systems and methods for fabricating same |
WO2012167096A2 (en) | 2011-06-03 | 2012-12-06 | The Board Of Trustees Of The University Of Illinois | Conformable actively multiplexed high-density surface electrode array for brain interfacing |
WO2013070907A1 (en) | 2011-11-08 | 2013-05-16 | Tufts University | A silk-based scaffold platform for engineering tissue constructs |
CN104203292B (en) | 2011-11-09 | 2019-05-31 | 塔夫茨大学信托人 | Injectable silk fibroin foam and application thereof |
KR102138152B1 (en) | 2011-11-09 | 2020-07-27 | 트러스티즈 오브 터프츠 칼리지 | Injectable silk fibroin particles and uses thereof |
KR101979354B1 (en) | 2011-12-01 | 2019-08-29 | 더 보오드 오브 트러스티스 오브 더 유니버시티 오브 일리노이즈 | Transient devices designed to undergo programmable transformations |
CA2856553C (en) * | 2011-12-09 | 2017-08-29 | Acell, Inc. | Hemostatic device |
WO2013102193A1 (en) | 2011-12-29 | 2013-07-04 | Trustees Of Tufts College | Functionalization of biomaterials to control regeneration and inflammation responses |
EP2811987B1 (en) | 2012-02-06 | 2021-01-20 | Children's Medical Center Corporation | Multi-layer biomaterial for tissue regeneration and wound healing |
EP2827884A4 (en) | 2012-03-20 | 2015-09-16 | Tufts College | Silk reservoirs for drug delivery |
US9554484B2 (en) | 2012-03-30 | 2017-01-24 | The Board Of Trustees Of The University Of Illinois | Appendage mountable electronic devices conformable to surfaces |
CA2869967A1 (en) | 2012-04-13 | 2013-10-17 | Trustees Of Tufts College | Methods and compositions for preparing a silk microsphere |
WO2013163407A1 (en) | 2012-04-25 | 2013-10-31 | Trustees Of Tufts College | Silk microspheres and methods for surface lubrication |
WO2013164405A1 (en) | 2012-05-02 | 2013-11-07 | Spiber Technologies Ab | Spider silk fusion protein structures without repetitive fragment for binding to an organic target |
CN104470607B (en) | 2012-05-02 | 2017-04-05 | 思百博技术股份公司 | As the spider silk fusion protein structure for being mixed with immunoglobulin fragment of affinity ligand |
US9171794B2 (en) | 2012-10-09 | 2015-10-27 | Mc10, Inc. | Embedding thin chips in polymer |
KR20230021768A (en) | 2013-03-15 | 2023-02-14 | 트러스티즈 오브 터프츠 칼리지 | Low molecular weight silk compositions and stabilizing silk compositions |
US11376329B2 (en) | 2013-03-15 | 2022-07-05 | Trustees Of Tufts College | Low molecular weight silk compositions and stabilizing silk compositions |
JP6759220B2 (en) | 2015-01-28 | 2020-09-23 | アラーガン、インコーポレイテッドAllergan,Incorporated | Joint fat pad preparation and how to use it |
MX2017015586A (en) | 2015-06-01 | 2018-08-23 | Univ Illinois | Miniaturized electronic systems with wireless power and near-field communication capabilities. |
BR112017025616A2 (en) | 2015-06-01 | 2018-08-07 | Univ Illinois | alternative approach to uv capture |
US10925543B2 (en) | 2015-11-11 | 2021-02-23 | The Board Of Trustees Of The University Of Illinois | Bioresorbable silicon electronics for transient implants |
US10857262B2 (en) | 2016-10-31 | 2020-12-08 | Sofregen Medical, Inc. | Compositions comprising low molecular weight silk fibroin fragments and plasticizers |
WO2018152270A1 (en) * | 2017-02-15 | 2018-08-23 | Massachusetts Institute Of Technology | Peptide-based synthetic molecules and silica nanostructures |
US20210085598A1 (en) | 2018-04-03 | 2021-03-25 | Vaxess Technologies, Inc. | Microneedle comprising silk fibroin applied to a dissolvable base |
CN110305202B (en) * | 2019-07-03 | 2021-06-08 | 浙江大学 | Method for improving biomineralization capability of silk fibroin |
WO2021076798A1 (en) | 2019-10-15 | 2021-04-22 | Sofregen Medical, Inc. | Delivery devices for delivering and methods of delivering compositions |
CN113527425B (en) * | 2021-08-17 | 2023-06-27 | 清华大学 | Polypeptide derivative, medicine and application thereof |
WO2023250117A2 (en) | 2022-06-24 | 2023-12-28 | Vaxess Technologies, Inc. | Applicator for medicament patch |
Family Cites Families (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ATE253635T1 (en) * | 1993-06-15 | 2003-11-15 | Du Pont | RECOMBINANT SPINNER SILK ANALOGUE |
JP2000125872A (en) * | 1998-09-07 | 2000-05-09 | Terumo Corp | Trimer chimeric protein and collagen matrix containing chimeric protein |
US6291428B1 (en) * | 1999-12-20 | 2001-09-18 | The Hospital For Special Surgery | Peptides which promote bone-forming cell attraction and adhesion |
WO2002000016A1 (en) * | 2000-06-28 | 2002-01-03 | Luminis Pty Ltd | Altered wool and hair fibres |
JP3772207B2 (en) * | 2002-06-19 | 2006-05-10 | 独立行政法人農業生物資源研究所 | Biodegradable biopolymer material, production method thereof, and functional material comprising the polymer material |
-
2006
- 2006-01-17 WO PCT/US2006/001536 patent/WO2006076711A2/en active Application Filing
- 2006-01-17 US US11/794,934 patent/US7960509B2/en active Active
-
2011
- 2011-04-29 US US13/097,538 patent/US8129141B2/en active Active
-
2012
- 2012-01-11 US US13/347,801 patent/US8501437B2/en active Active
-
2013
- 2013-07-03 US US13/934,828 patent/US8772456B2/en active Active
-
2014
- 2014-05-16 US US14/280,324 patent/US20140379094A1/en not_active Abandoned
Non-Patent Citations (1)
Title |
---|
Sofia et al. (Functionalized silk-based biomaterials for bone formation, Journal of Biomedical Materials Research, Vol. 54, pgs. 139-148, 2001). * |
Also Published As
Publication number | Publication date |
---|---|
US8501437B2 (en) | 2013-08-06 |
US8129141B2 (en) | 2012-03-06 |
WO2006076711A3 (en) | 2007-07-05 |
WO2006076711A2 (en) | 2006-07-20 |
US20110275788A1 (en) | 2011-11-10 |
US20120308611A1 (en) | 2012-12-06 |
US20140142048A1 (en) | 2014-05-22 |
US20080293919A1 (en) | 2008-11-27 |
US8772456B2 (en) | 2014-07-08 |
US7960509B2 (en) | 2011-06-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8772456B2 (en) | Fibrous protein fusion and use thereof in the formation of advanced organic/inorganic composite materials | |
Wang et al. | Biomimetic glycopeptide hydrogel coated PCL/nHA scaffold for enhanced cranial bone regeneration via macrophage M2 polarization-induced osteo-immunomodulation | |
Sheehy et al. | Collagen-based biomaterials for tissue regeneration and repair | |
Huang et al. | The effect of genetically engineered spider silk-dentin matrix protein 1 chimeric protein on hydroxyapatite nucleation | |
Schacht et al. | Processing of recombinant spider silk proteins into tailor-made materials for biomaterials applications | |
Wang et al. | Stem cell-based tissue engineering with silk biomaterials | |
Widhe et al. | Current progress and limitations of spider silk for biomedical applications | |
Zuluaga-Velez et al. | Silk fibroin nanocomposites as tissue engineering scaffolds–A systematic review | |
Zhou et al. | Improving osteogenesis of three-dimensional porous scaffold based on mineralized recombinant human-like collagen via mussel-inspired polydopamine and effective immobilization of BMP-2-derived peptide | |
Bakhshandeh et al. | A review on advances in the applications of spider silk in biomedical issues | |
Debabov et al. | Recombinant spidroins as the basis for new materials | |
US20110229970A1 (en) | Dual-chamber perfusion bioreactor for orthopedic tissue interfaces and methods of use | |
Nagano et al. | Regeneration of the femoral epicondyle on calcium-binding silk scaffolds developed using transgenic silk fibroin produced by transgenic silkworm | |
Wang et al. | Fibrous proteins and tissue engineering | |
CN108066816B (en) | Polyanion modified fiber inner biomimetic mineralization material, preparation method and application | |
Fan et al. | The use of collagen-based materials in bone tissue engineering | |
Gourgas et al. | Cross-linked elastin-like polypeptide membranes as a model for medial arterial calcification | |
US9801972B2 (en) | Mussel-inspired bioactive surface coating composition generating silica nanoparticles | |
CN1268307C (en) | Regenerative bone implant | |
US20140086874A1 (en) | Biomaterial, method for making the biomaterial and uses of the same | |
Peng et al. | High-strength collagen-based composite films regulated by water-soluble recombinant spider silk proteins and water annealing | |
WO2011046519A1 (en) | Polypeptide material composed of elastin-like segments and coiled coil segments | |
Bhattacharjee et al. | Silk-based matrices for bone tissue engineering applications | |
US20210369812A1 (en) | Osteoinductive peptides, compositions, implants, and methods of use | |
Rajakumari et al. | Carbon Nanotubes for Tissue Engineering Scaffold Applications |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: TRUSTEES OF TUFTS COLLEGE, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:KAPLAN, DAVID L.;HUANG, JIA;WONG PO FOO, CHERYL;SIGNING DATES FROM 20120626 TO 20120627;REEL/FRAME:033045/0220 Owner name: TRUSTEES OF TUFTS COLLEGE, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:THE UNITED STATES OF AMERICA AS REPRESENTED BY THE SECRETARY OF THE AIR FORCE;REEL/FRAME:033045/0241 Effective date: 20090528 Owner name: UNITED STATES OF AMERICA AS REPRESENTED BY THE SEC Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:NAIK, RAJESH;REEL/FRAME:033045/0225 Effective date: 20120910 Owner name: THE BOARD OF TRUSTEES OF THE UNIVERSITY OF ILLINOI Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:GEORGE, ANNE;REEL/FRAME:033045/0136 Effective date: 20120927 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |