US20140205630A1 - Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells - Google Patents
Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells Download PDFInfo
- Publication number
- US20140205630A1 US20140205630A1 US14/174,286 US201414174286A US2014205630A1 US 20140205630 A1 US20140205630 A1 US 20140205630A1 US 201414174286 A US201414174286 A US 201414174286A US 2014205630 A1 US2014205630 A1 US 2014205630A1
- Authority
- US
- United States
- Prior art keywords
- antigen
- administered
- cells
- galcer
- ligand
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000000203 mixture Substances 0.000 title claims abstract description 49
- 108010079723 Shiga Toxin Proteins 0.000 title claims abstract description 34
- 230000004936 stimulating effect Effects 0.000 title claims abstract description 21
- 239000000427 antigen Substances 0.000 claims abstract description 131
- 102000036639 antigens Human genes 0.000 claims abstract description 126
- 108091007433 antigens Proteins 0.000 claims abstract description 126
- 239000003446 ligand Substances 0.000 claims abstract description 59
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 54
- VQFKFAKEUMHBLV-BYSUZVQFSA-N 1-O-(alpha-D-galactosyl)-N-hexacosanoylphytosphingosine Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)[C@H](O)CCCCCCCCCCCCCC)CO[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQFKFAKEUMHBLV-BYSUZVQFSA-N 0.000 claims description 84
- 238000000034 method Methods 0.000 claims description 36
- 210000004443 dendritic cell Anatomy 0.000 claims description 31
- 229960005486 vaccine Drugs 0.000 claims description 29
- 206010028980 Neoplasm Diseases 0.000 claims description 26
- 230000028993 immune response Effects 0.000 claims description 25
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 claims description 16
- 229930186217 Glycolipid Natural products 0.000 claims description 16
- HOMYIYLRRDTKAA-UHFFFAOYSA-N 2-hydroxy-N-[3-hydroxy-1-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoctadeca-4,8-dien-2-yl]hexadecanamide Chemical compound CCCCCCCCCCCCCCC(O)C(=O)NC(C(O)C=CCCC=CCCCCCCCCC)COC1OC(CO)C(O)C(O)C1O HOMYIYLRRDTKAA-UHFFFAOYSA-N 0.000 claims description 11
- 150000001875 compounds Chemical class 0.000 claims description 9
- 150000002339 glycosphingolipids Chemical class 0.000 claims description 8
- IRPOZWRRAFKYMQ-LMIAXWKISA-N 1-O-(alpha-D-galactopyranuronosyl)-N-tetradecanoyldihydrosphingosine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@@H](NC(=O)CCCCCCCCCCCCC)CO[C@H]1O[C@H](C(O)=O)[C@H](O)[C@H](O)[C@H]1O IRPOZWRRAFKYMQ-LMIAXWKISA-N 0.000 claims description 6
- MYYARUCLXARAEE-ZATZPJRKSA-N alpha-C-GalCer Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@@H](CC[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O)[C@H](O)[C@H](O)CCCCCCCCCCCCCCCCC MYYARUCLXARAEE-ZATZPJRKSA-N 0.000 claims description 6
- 241000124008 Mammalia Species 0.000 claims description 5
- 241000589968 Borrelia Species 0.000 claims description 4
- 230000001580 bacterial effect Effects 0.000 claims description 4
- 241000894007 species Species 0.000 claims description 4
- 238000011282 treatment Methods 0.000 claims description 4
- 230000003612 virological effect Effects 0.000 claims description 4
- VQFKFAKEUMHBLV-SMEVVEOQSA-N 1-O-(alpha-D-glucosyl)-N-hexacosanoylphytosphingosine Chemical compound CCCCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)[C@H](O)CCCCCCCCCCCCCC)CO[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQFKFAKEUMHBLV-SMEVVEOQSA-N 0.000 claims description 3
- 241000736131 Sphingomonas Species 0.000 claims description 3
- 239000003937 drug carrier Substances 0.000 claims description 3
- 150000003904 phospholipids Chemical class 0.000 claims description 3
- 150000003905 phosphatidylinositols Chemical class 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 210000003370 receptor cell Anatomy 0.000 claims 1
- 239000003814 drug Substances 0.000 abstract description 8
- 239000008194 pharmaceutical composition Substances 0.000 abstract description 5
- 241000699670 Mus sp. Species 0.000 description 68
- 210000004027 cell Anatomy 0.000 description 38
- 108090000765 processed proteins & peptides Proteins 0.000 description 33
- 108010058846 Ovalbumin Proteins 0.000 description 31
- 229940092253 ovalbumin Drugs 0.000 description 29
- 239000002671 adjuvant Substances 0.000 description 25
- 235000018102 proteins Nutrition 0.000 description 24
- 102000004169 proteins and genes Human genes 0.000 description 24
- 108090000623 proteins and genes Proteins 0.000 description 24
- 238000002649 immunization Methods 0.000 description 23
- 230000003053 immunization Effects 0.000 description 22
- JVJGCCBAOOWGEO-RUTPOYCXSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-4-amino-2-[[(2s,3s)-2-[[(2s,3s)-2-[[(2s)-2-azaniumyl-3-hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-3-methylpentanoyl]amino]-4-oxobutanoyl]amino]-3-phenylpropanoyl]amino]-4-carboxylatobutanoyl]amino]-6-azaniumy Chemical compound OC[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O)CC1=CC=CC=C1 JVJGCCBAOOWGEO-RUTPOYCXSA-N 0.000 description 21
- 108020003175 receptors Proteins 0.000 description 18
- 102000005962 receptors Human genes 0.000 description 18
- 102100024219 T-cell surface glycoprotein CD1a Human genes 0.000 description 17
- 210000000581 natural killer T-cell Anatomy 0.000 description 16
- 102000004196 processed proteins & peptides Human genes 0.000 description 15
- 241000701806 Human papillomavirus Species 0.000 description 13
- 0 [1*]OC1C(OCC(NO(C)C([6*])CC)C(O)C([7*])O)OC(CO[5*])C([3*])([4*])C1O[2*] Chemical compound [1*]OC1C(OCC(NO(C)C([6*])CC)C(O)C([7*])O)OC(CO[5*])C([3*])([4*])C1O[2*] 0.000 description 13
- 238000002474 experimental method Methods 0.000 description 13
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 12
- -1 C-glycoside derivative of α-GalCer Chemical class 0.000 description 11
- 229920001184 polypeptide Polymers 0.000 description 11
- 210000000952 spleen Anatomy 0.000 description 11
- 125000001424 substituent group Chemical group 0.000 description 11
- 241000700605 Viruses Species 0.000 description 10
- 229910052739 hydrogen Inorganic materials 0.000 description 10
- 239000001257 hydrogen Substances 0.000 description 10
- 230000004044 response Effects 0.000 description 10
- 230000000638 stimulation Effects 0.000 description 10
- 239000003053 toxin Substances 0.000 description 10
- 231100000765 toxin Toxicity 0.000 description 10
- 108700012359 toxins Proteins 0.000 description 10
- 238000002255 vaccination Methods 0.000 description 10
- 125000000217 alkyl group Chemical group 0.000 description 9
- 235000001014 amino acid Nutrition 0.000 description 9
- 150000001413 amino acids Chemical class 0.000 description 9
- 108090000695 Cytokines Proteins 0.000 description 8
- 102000004127 Cytokines Human genes 0.000 description 8
- 150000002772 monosaccharides Chemical class 0.000 description 8
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 8
- 230000004224 protection Effects 0.000 description 8
- 238000011740 C57BL/6 mouse Methods 0.000 description 7
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 7
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 7
- 230000036039 immunity Effects 0.000 description 7
- 230000006698 induction Effects 0.000 description 7
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 7
- 230000035800 maturation Effects 0.000 description 7
- 108010038807 Oligopeptides Proteins 0.000 description 6
- 102000015636 Oligopeptides Human genes 0.000 description 6
- 230000005867 T cell response Effects 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 230000027455 binding Effects 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 6
- 230000000840 anti-viral effect Effects 0.000 description 5
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 5
- 235000018417 cysteine Nutrition 0.000 description 5
- 201000010099 disease Diseases 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 230000004927 fusion Effects 0.000 description 5
- 102000037865 fusion proteins Human genes 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 125000005647 linker group Chemical group 0.000 description 5
- 210000001672 ovary Anatomy 0.000 description 5
- 244000052769 pathogen Species 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 201000008827 tuberculosis Diseases 0.000 description 5
- 229930182476 C-glycoside Natural products 0.000 description 4
- BLCPPXRGDCYRMP-UHFFFAOYSA-N COC1OC(CO)C(O)C(O)C1O.COC1OC(CO)C(O)C(O)C1O.COC1OC(CO)C(O)C(O)C1O.COC1OC(CO)C(O)C(O)C1O Chemical compound COC1OC(CO)C(O)C(O)C1O.COC1OC(CO)C(O)C(O)C1O.COC1OC(CO)C(O)C(O)C1O.COC1OC(CO)C(O)C(O)C1O BLCPPXRGDCYRMP-UHFFFAOYSA-N 0.000 description 4
- 241000606161 Chlamydia Species 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 238000011510 Elispot assay Methods 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- 108700006640 OspA Proteins 0.000 description 4
- 108700023315 OspC Proteins 0.000 description 4
- 108010039918 Polylysine Proteins 0.000 description 4
- 101100431670 Rattus norvegicus Ybx3 gene Proteins 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- 230000008878 coupling Effects 0.000 description 4
- 238000010168 coupling process Methods 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- 230000016396 cytokine production Effects 0.000 description 4
- 208000002672 hepatitis B Diseases 0.000 description 4
- 230000008348 humoral response Effects 0.000 description 4
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 229910052760 oxygen Inorganic materials 0.000 description 4
- 229920000656 polylysine Polymers 0.000 description 4
- 230000003389 potentiating effect Effects 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 229920006395 saturated elastomer Polymers 0.000 description 4
- 229940021747 therapeutic vaccine Drugs 0.000 description 4
- DKXNBNKWCZZMJT-ZYAMEUKBSA-N (2r,3r,4s,5r)-2,3,5,6-tetrahydroxy-4-[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanal Chemical compound O=C[C@H](O)[C@@H](O)[C@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O DKXNBNKWCZZMJT-ZYAMEUKBSA-N 0.000 description 3
- VUWMDLRKEQUSPZ-UHFFFAOYSA-N CC1OC(CO)C(O)C(O)C1O Chemical compound CC1OC(CO)C(O)C(O)C1O VUWMDLRKEQUSPZ-UHFFFAOYSA-N 0.000 description 3
- 102100037840 Dehydrogenase/reductase SDR family member 2, mitochondrial Human genes 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 241000700721 Hepatitis B virus Species 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 102000043129 MHC class I family Human genes 0.000 description 3
- 108091054437 MHC class I family Proteins 0.000 description 3
- 241000223960 Plasmodium falciparum Species 0.000 description 3
- 101710188053 Protein D Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 101710132893 Resolvase Proteins 0.000 description 3
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 3
- 108010092262 T-Cell Antigen Receptors Proteins 0.000 description 3
- 230000000240 adjuvant effect Effects 0.000 description 3
- 125000004450 alkenylene group Chemical group 0.000 description 3
- 125000003545 alkoxy group Chemical group 0.000 description 3
- 125000002947 alkylene group Chemical group 0.000 description 3
- 125000004419 alkynylene group Chemical group 0.000 description 3
- 210000000612 antigen-presenting cell Anatomy 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 229960004942 lenalidomide Drugs 0.000 description 3
- GOTYRUGSSMKFNF-UHFFFAOYSA-N lenalidomide Chemical compound C1C=2C(N)=CC=CC=2C(=O)N1C1CCC(=O)NC1=O GOTYRUGSSMKFNF-UHFFFAOYSA-N 0.000 description 3
- 239000008297 liquid dosage form Substances 0.000 description 3
- 230000005923 long-lasting effect Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000012737 microarray-based gene expression Methods 0.000 description 3
- 238000012243 multiplex automated genomic engineering Methods 0.000 description 3
- 210000000822 natural killer cell Anatomy 0.000 description 3
- 230000037452 priming Effects 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 210000004988 splenocyte Anatomy 0.000 description 3
- 238000007920 subcutaneous administration Methods 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 208000008732 thymoma Diseases 0.000 description 3
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 2
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 2
- 206010059313 Anogenital warts Diseases 0.000 description 2
- YPMUZVRAVKLKGC-UHFFFAOYSA-N BBGL-II Natural products OC1C(O)C(O)C(COC(=O)CCCCCCCCCCCCCCC)OC1OC1CC2=CCC3C4CCC(C(C)CCCC(C)C)C4(C)CCC3C2(C)CC1 YPMUZVRAVKLKGC-UHFFFAOYSA-N 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 2
- 108030001720 Bontoxilysin Proteins 0.000 description 2
- 150000000700 C-glycosides Chemical class 0.000 description 2
- MPVUCOZDOHIDTN-UHFFFAOYSA-N CCOC1OC(CO)C(O)C(O)C1O.CCOC1OC(CO)C(O)C(O)C1O.CCOC1OC(CO)C(O)C(O)C1O.CCOC1OC(CO)C(O)C(O)C1O Chemical compound CCOC1OC(CO)C(O)C(O)C1O.CCOC1OC(CO)C(O)C(O)C1O.CCOC1OC(CO)C(O)C(O)C1O.CCOC1OC(CO)C(O)C(O)C1O MPVUCOZDOHIDTN-UHFFFAOYSA-N 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- LTIUFNAAHZUXMW-UHFFFAOYSA-N COC1OC(C(O)CO)C(O)C1O.COC1OC(CO)C(O)C(O)C1NC(C)=O Chemical compound COC1OC(C(O)CO)C(O)C1O.COC1OC(CO)C(O)C(O)C1NC(C)=O LTIUFNAAHZUXMW-UHFFFAOYSA-N 0.000 description 2
- 108010022366 Carcinoembryonic Antigen Proteins 0.000 description 2
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 2
- 241000193403 Clostridium Species 0.000 description 2
- 208000000907 Condylomata Acuminata Diseases 0.000 description 2
- 239000004971 Cross linker Substances 0.000 description 2
- 101000609762 Gallus gallus Ovalbumin Proteins 0.000 description 2
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 241000606768 Haemophilus influenzae Species 0.000 description 2
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- 101000767631 Human papillomavirus type 16 Protein E7 Proteins 0.000 description 2
- 102100022297 Integrin alpha-X Human genes 0.000 description 2
- 102100037850 Interferon gamma Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- 108090001030 Lipoproteins Proteins 0.000 description 2
- 102000004895 Lipoproteins Human genes 0.000 description 2
- 102000043131 MHC class II family Human genes 0.000 description 2
- 108091054438 MHC class II family Proteins 0.000 description 2
- 101710105759 Major outer membrane porin Proteins 0.000 description 2
- 101710164702 Major outer membrane protein Proteins 0.000 description 2
- 101710085938 Matrix protein Proteins 0.000 description 2
- 101710127721 Membrane protein Proteins 0.000 description 2
- JMENXJYBCQFIRK-KRJDXUSZSA-N N-hexacosanoylisoglobotriaosyl ceramide Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)O)[C@@H](O)[C@@H](CO)O1 JMENXJYBCQFIRK-KRJDXUSZSA-N 0.000 description 2
- HCUVEUVIUAJXRB-UHFFFAOYSA-N OC1=C(C=C(CNC(CCCC=2SC=CC=2)=O)C=C1)OC Chemical compound OC1=C(C=C(CNC(CCCC=2SC=CC=2)=O)C=C1)OC HCUVEUVIUAJXRB-UHFFFAOYSA-N 0.000 description 2
- 241000224016 Plasmodium Species 0.000 description 2
- 102100035181 Plastin-1 Human genes 0.000 description 2
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 2
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 2
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 2
- 102100038358 Prostate-specific antigen Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 206010070834 Sensitisation Diseases 0.000 description 2
- 241000607764 Shigella dysenteriae Species 0.000 description 2
- RAHZWNYVWXNFOC-UHFFFAOYSA-N Sulphur dioxide Chemical group O=S=O RAHZWNYVWXNFOC-UHFFFAOYSA-N 0.000 description 2
- 108010002687 Survivin Proteins 0.000 description 2
- 208000035896 Twin-reversed arterial perfusion sequence Diseases 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- 108010067390 Viral Proteins Proteins 0.000 description 2
- 125000000738 acetamido group Chemical group [H]C([H])([H])C(=O)N([H])[*] 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 108010004469 allophycocyanin Proteins 0.000 description 2
- 101150078331 ama-1 gene Proteins 0.000 description 2
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 2
- POQRWMRXUOPCLD-HIIAJUEOSA-N beta-D-galactosyl-N-(tetracosanoyl)sphingosine Chemical compound CCCCCCCCCCCCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)\C=C\CCCCCCCCCCCCC)CO[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O POQRWMRXUOPCLD-HIIAJUEOSA-N 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 229940053031 botulinum toxin Drugs 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- 238000012412 chemical coupling Methods 0.000 description 2
- 230000000139 costimulatory effect Effects 0.000 description 2
- 125000004093 cyano group Chemical group *C#N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 229910052736 halogen Inorganic materials 0.000 description 2
- 125000005843 halogen group Chemical group 0.000 description 2
- 150000002367 halogens Chemical group 0.000 description 2
- 210000002443 helper t lymphocyte Anatomy 0.000 description 2
- 102000022382 heparin binding proteins Human genes 0.000 description 2
- 108091012216 heparin binding proteins Proteins 0.000 description 2
- 230000028996 humoral immune response Effects 0.000 description 2
- CBOIHMRHGLHBPB-UHFFFAOYSA-N hydroxymethyl Chemical compound O[CH2] CBOIHMRHGLHBPB-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 201000004792 malaria Diseases 0.000 description 2
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 201000001441 melanoma Diseases 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 239000006186 oral dosage form Substances 0.000 description 2
- 244000045947 parasite Species 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 108010049148 plastin Proteins 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 230000008313 sensitization Effects 0.000 description 2
- 239000012679 serum free medium Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 150000003408 sphingolipids Chemical class 0.000 description 2
- 229910052717 sulfur Inorganic materials 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 229960003433 thalidomide Drugs 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 125000003396 thiol group Chemical group [H]S* 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 230000009261 transgenic effect Effects 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 1
- FUKOTTQGWQVMQB-UHFFFAOYSA-N (2-bromoacetyl) 2-bromoacetate Chemical compound BrCC(=O)OC(=O)CBr FUKOTTQGWQVMQB-UHFFFAOYSA-N 0.000 description 1
- SJHPCNCNNSSLPL-CSKARUKUSA-N (4e)-4-(ethoxymethylidene)-2-phenyl-1,3-oxazol-5-one Chemical compound O1C(=O)C(=C/OCC)\N=C1C1=CC=CC=C1 SJHPCNCNNSSLPL-CSKARUKUSA-N 0.000 description 1
- LIXVHWQNKBIZBR-ICAJWQFTSA-N 1-O-(6-acetamido-6-deoxy-alpha-D-galactosyl)-N-[(15Z)-tetracos-15-enoyl]phytosphingosine Chemical compound CCCCCCCC\C=C/CCCCCCCCCCCCCC(=O)N[C@H]([C@H](O)[C@H](O)CCCCCCCCCCCCCC)CO[C@H]1O[C@H](CNC(C)=O)[C@H](O)[C@H](O)[C@H]1O LIXVHWQNKBIZBR-ICAJWQFTSA-N 0.000 description 1
- 125000004042 4-aminobutyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])N([H])[H] 0.000 description 1
- 101000768957 Acholeplasma phage L2 Uncharacterized 37.2 kDa protein Proteins 0.000 description 1
- 101000823746 Acidianus ambivalens Uncharacterized 17.7 kDa protein in bps2 3'region Proteins 0.000 description 1
- 101000916369 Acidianus ambivalens Uncharacterized protein in sor 5'region Proteins 0.000 description 1
- 101000769342 Acinetobacter guillouiae Uncharacterized protein in rpoN-murA intergenic region Proteins 0.000 description 1
- 101000823696 Actinobacillus pleuropneumoniae Uncharacterized glycosyltransferase in aroQ 3'region Proteins 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 241001251200 Agelas Species 0.000 description 1
- 101000786513 Agrobacterium tumefaciens (strain 15955) Uncharacterized protein outside the virF region Proteins 0.000 description 1
- 101000618005 Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) Uncharacterized protein BpOF4_00885 Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 206010001935 American trypanosomiasis Diseases 0.000 description 1
- 102100020724 Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Human genes 0.000 description 1
- 101100162403 Arabidopsis thaliana ALEU gene Proteins 0.000 description 1
- 240000005528 Arctium lappa Species 0.000 description 1
- 101000967489 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) Uncharacterized protein AZC_3924 Proteins 0.000 description 1
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 1
- 241000223836 Babesia Species 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 101000823761 Bacillus licheniformis Uncharacterized 9.4 kDa protein in flaL 3'region Proteins 0.000 description 1
- 101000819719 Bacillus methanolicus Uncharacterized N-acetyltransferase in lysA 3'region Proteins 0.000 description 1
- 101000789586 Bacillus subtilis (strain 168) UPF0702 transmembrane protein YkjA Proteins 0.000 description 1
- 101000792624 Bacillus subtilis (strain 168) Uncharacterized protein YbxH Proteins 0.000 description 1
- 101000790792 Bacillus subtilis (strain 168) Uncharacterized protein YckC Proteins 0.000 description 1
- 101000819705 Bacillus subtilis (strain 168) Uncharacterized protein YlxR Proteins 0.000 description 1
- 101000948218 Bacillus subtilis (strain 168) Uncharacterized protein YtxJ Proteins 0.000 description 1
- 101000718627 Bacillus thuringiensis subsp. kurstaki Putative RNA polymerase sigma-G factor Proteins 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 101000641200 Bombyx mori densovirus Putative non-structural protein Proteins 0.000 description 1
- 241000588807 Bordetella Species 0.000 description 1
- 241000588779 Bordetella bronchiseptica Species 0.000 description 1
- 241000588780 Bordetella parapertussis Species 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589978 Borrelia hermsii Species 0.000 description 1
- 241000495356 Borrelia microti Species 0.000 description 1
- 241000142472 Borreliella andersonii Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241001148605 Borreliella garinii Species 0.000 description 1
- 241000589893 Brachyspira hyodysenteriae Species 0.000 description 1
- YDNKGFDKKRUKPY-JHOUSYSJSA-N C16 ceramide Natural products CCCCCCCCCCCCCCCC(=O)N[C@@H](CO)[C@H](O)C=CCCCCCCCCCCCCC YDNKGFDKKRUKPY-JHOUSYSJSA-N 0.000 description 1
- VOMJFBZGNMSNFP-UHFFFAOYSA-N CC1COC(C(O)CO)C1O.CC1OC(CO)C(O)C(O)C1C.N=C=O Chemical compound CC1COC(C(O)CO)C1O.CC1OC(CO)C(O)C(O)C1C.N=C=O VOMJFBZGNMSNFP-UHFFFAOYSA-N 0.000 description 1
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 241000589877 Campylobacter coli Species 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 102100035882 Catalase Human genes 0.000 description 1
- 108010053835 Catalase Proteins 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241001647372 Chlamydia pneumoniae Species 0.000 description 1
- 241001647378 Chlamydia psittaci Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- 101710117490 Circumsporozoite protein Proteins 0.000 description 1
- 101000947633 Claviceps purpurea Uncharacterized 13.8 kDa protein Proteins 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241001337994 Cryptococcus <scale insect> Species 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 1
- 102100031262 Deleted in malignant brain tumors 1 protein Human genes 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 241000605314 Ehrlichia Species 0.000 description 1
- 241000224431 Entamoeba Species 0.000 description 1
- 241001133638 Entamoeba equi Species 0.000 description 1
- 241000224432 Entamoeba histolytica Species 0.000 description 1
- 101000948901 Enterobacteria phage T4 Uncharacterized 16.0 kDa protein in segB-ipI intergenic region Proteins 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 241000194031 Enterococcus faecium Species 0.000 description 1
- 101000805958 Equine herpesvirus 4 (strain 1942) Virion protein US10 homolog Proteins 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 101000790442 Escherichia coli Insertion element IS2 uncharacterized 11.1 kDa protein Proteins 0.000 description 1
- 101000788354 Escherichia phage P2 Uncharacterized 8.2 kDa protein in gpA 5'region Proteins 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 101000770304 Frankia alni UPF0460 protein in nifX-nifW intergenic region Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 101000797344 Geobacillus stearothermophilus Putative tRNA (cytidine(34)-2'-O)-methyltransferase Proteins 0.000 description 1
- 101000748410 Geobacillus stearothermophilus Uncharacterized protein in fumA 3'region Proteins 0.000 description 1
- 241000224466 Giardia Species 0.000 description 1
- 241000224467 Giardia intestinalis Species 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- NMJREATYWWNIKX-UHFFFAOYSA-N GnRH Chemical compound C1CCC(C(=O)NCC(N)=O)N1C(=O)C(CC(C)C)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)CNC(=O)C(NC(=O)C(CO)NC(=O)C(CC=1C2=CC=CC=C2NC=1)NC(=O)C(CC=1NC=NC=1)NC(=O)C1NC(=O)CC1)CC1=CC=C(O)C=C1 NMJREATYWWNIKX-UHFFFAOYSA-N 0.000 description 1
- 241000606790 Haemophilus Species 0.000 description 1
- 101000772675 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) UPF0438 protein HI_0847 Proteins 0.000 description 1
- 101000631019 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uncharacterized protein HI_0350 Proteins 0.000 description 1
- 101100406392 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) omp26 gene Proteins 0.000 description 1
- 101000768938 Haemophilus phage HP1 (strain HP1c1) Uncharacterized 8.9 kDa protein in int-C1 intergenic region Proteins 0.000 description 1
- 241000589989 Helicobacter Species 0.000 description 1
- 101710154606 Hemagglutinin Proteins 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 241000724675 Hepatitis E virus Species 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 101000785414 Homo sapiens Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 Proteins 0.000 description 1
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 1
- 101000844721 Homo sapiens Deleted in malignant brain tumors 1 protein Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000916644 Homo sapiens Macrophage colony-stimulating factor 1 receptor Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000874141 Homo sapiens Probable ATP-dependent RNA helicase DDX43 Proteins 0.000 description 1
- 101001130441 Homo sapiens Ras-related protein Rap-2a Proteins 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 206010071038 Human anaplasmosis Diseases 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 241000701828 Human papillomavirus type 11 Species 0.000 description 1
- 241000341655 Human papillomavirus type 16 Species 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 101000782488 Junonia coenia densovirus (isolate pBRJ/1990) Putative non-structural protein NS2 Proteins 0.000 description 1
- 102100034872 Kallikrein-4 Human genes 0.000 description 1
- 102100023678 Killer cell lectin-like receptor subfamily B member 1 Human genes 0.000 description 1
- 101710131918 Killer cell lectin-like receptor subfamily B member 1A Proteins 0.000 description 1
- 101000811523 Klebsiella pneumoniae Uncharacterized 55.8 kDa protein in cps region Proteins 0.000 description 1
- 101000818409 Lactococcus lactis subsp. lactis Uncharacterized HTH-type transcriptional regulator in lacX 3'region Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 102100032241 Lactotransferrin Human genes 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 241000589242 Legionella pneumophila Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 101000878851 Leptolyngbya boryana Putative Fe(2+) transport protein A Proteins 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 241000589929 Leptospira interrogans Species 0.000 description 1
- 241000239218 Limulus Species 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 101000758828 Methanosarcina barkeri (strain Fusaro / DSM 804) Uncharacterized protein Mbar_A1602 Proteins 0.000 description 1
- 101001122401 Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) Non-structural protein ORF3 Proteins 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000588621 Moraxella Species 0.000 description 1
- 241000588622 Moraxella bovis Species 0.000 description 1
- 241000588655 Moraxella catarrhalis Species 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 108010008707 Mucin-1 Proteins 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 101100181099 Mus musculus Klra1 gene Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241000186367 Mycobacterium avium Species 0.000 description 1
- 241000187482 Mycobacterium avium subsp. paratuberculosis Species 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000187480 Mycobacterium smegmatis Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 101001055788 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) Pentapeptide repeat protein MfpA Proteins 0.000 description 1
- CRJGESKKUOMBCT-VQTJNVASSA-N N-acetylsphinganine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@H](CO)NC(C)=O CRJGESKKUOMBCT-VQTJNVASSA-N 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 101710141454 Nucleoprotein Proteins 0.000 description 1
- 229910004727 OSO3H Inorganic materials 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 101000740670 Orgyia pseudotsugata multicapsid polyhedrosis virus Protein C42 Proteins 0.000 description 1
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 1
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 238000010222 PCR analysis Methods 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- KHGNFPUMBJSZSM-UHFFFAOYSA-N Perforine Natural products COC1=C2CCC(O)C(CCC(C)(C)O)(OC)C2=NC2=C1C=CO2 KHGNFPUMBJSZSM-UHFFFAOYSA-N 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 101000769182 Photorhabdus luminescens Uncharacterized protein in pnp 3'region Proteins 0.000 description 1
- 101710099976 Photosystem I P700 chlorophyll a apoprotein A1 Proteins 0.000 description 1
- 101000983333 Plasmodium falciparum (isolate NF54) 25 kDa ookinete surface antigen Proteins 0.000 description 1
- 241000233870 Pneumocystis Species 0.000 description 1
- 241000233872 Pneumocystis carinii Species 0.000 description 1
- 101710183389 Pneumolysin Proteins 0.000 description 1
- 241000243142 Porifera Species 0.000 description 1
- 102100035724 Probable ATP-dependent RNA helicase DDX43 Human genes 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 101710176177 Protein A56 Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 101000961392 Pseudescherichia vulneris Uncharacterized 29.9 kDa protein in crtE 3'region Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 101000731030 Pseudomonas oleovorans Poly(3-hydroxyalkanoate) polymerase 2 Proteins 0.000 description 1
- 101001065485 Pseudomonas putida Probable fatty acid methyltransferase Proteins 0.000 description 1
- 101710201576 Putative membrane protein Proteins 0.000 description 1
- 102100022851 Rab5 GDP/GTP exchange factor Human genes 0.000 description 1
- 102100031420 Ras-related protein Rap-2a Human genes 0.000 description 1
- 101710203837 Replication-associated protein Proteins 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 101000711023 Rhizobium leguminosarum bv. trifolii Uncharacterized protein in tfuA 3'region Proteins 0.000 description 1
- 101000948156 Rhodococcus erythropolis Uncharacterized 47.3 kDa protein in thcA 5'region Proteins 0.000 description 1
- 101000917565 Rhodococcus fascians Uncharacterized 33.6 kDa protein in fasciation locus Proteins 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- 241000606695 Rickettsia rickettsii Species 0.000 description 1
- 101000999689 Saimiriine herpesvirus 2 (strain 11) Transcriptional regulator ICP22 homolog Proteins 0.000 description 1
- 101000790284 Saimiriine herpesvirus 2 (strain 488) Uncharacterized 9.5 kDa protein in DHFR 3'region Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241001138501 Salmonella enterica Species 0.000 description 1
- 241001354013 Salmonella enterica subsp. enterica serovar Enteritidis Species 0.000 description 1
- 241000531795 Salmonella enterica subsp. enterica serovar Paratyphi A Species 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 241000242680 Schistosoma mansoni Species 0.000 description 1
- 108010090763 Shiga Toxin 2 Proteins 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000607760 Shigella sonnei Species 0.000 description 1
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191963 Staphylococcus epidermidis Species 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 241000193985 Streptococcus agalactiae Species 0.000 description 1
- 101000936719 Streptococcus gordonii Accessory Sec system protein Asp3 Proteins 0.000 description 1
- 241000194019 Streptococcus mutans Species 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 108010011834 Streptolysins Proteins 0.000 description 1
- 101000788499 Streptomyces coelicolor Uncharacterized oxidoreductase in mprA 5'region Proteins 0.000 description 1
- 101001102841 Streptomyces griseus Purine nucleoside phosphorylase ORF3 Proteins 0.000 description 1
- 101000708557 Streptomyces lincolnensis Uncharacterized 17.2 kDa protein in melC2-rnhH intergenic region Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 101710137302 Surface antigen S Proteins 0.000 description 1
- 108010017842 Telomerase Proteins 0.000 description 1
- 108010055044 Tetanus Toxin Proteins 0.000 description 1
- 101000649826 Thermotoga neapolitana Putative anti-sigma factor antagonist TM1081 homolog Proteins 0.000 description 1
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 1
- 102000002689 Toll-like receptor Human genes 0.000 description 1
- 108020000411 Toll-like receptor Proteins 0.000 description 1
- 229940123384 Toll-like receptor (TLR) agonist Drugs 0.000 description 1
- 241000223996 Toxoplasma Species 0.000 description 1
- 241000223997 Toxoplasma gondii Species 0.000 description 1
- 102000010912 Transferrin-Binding Proteins Human genes 0.000 description 1
- 108010062476 Transferrin-Binding Proteins Proteins 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 241000589892 Treponema denticola Species 0.000 description 1
- 241000589884 Treponema pallidum Species 0.000 description 1
- 241000224526 Trichomonas Species 0.000 description 1
- 241000224527 Trichomonas vaginalis Species 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 1
- 108050002568 Tumor necrosis factor ligand superfamily member 6 Proteins 0.000 description 1
- 102100039094 Tyrosinase Human genes 0.000 description 1
- 108060008724 Tyrosinase Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- 101000827562 Vibrio alginolyticus Uncharacterized protein in proC 3'region Proteins 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 101000778915 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) Uncharacterized membrane protein VP2115 Proteins 0.000 description 1
- 108700020467 WT1 Proteins 0.000 description 1
- 101150084041 WT1 gene Proteins 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241000607477 Yersinia pseudotuberculosis Species 0.000 description 1
- 241000606834 [Haemophilus] ducreyi Species 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 159000000013 aluminium salts Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 208000025009 anogenital human papillomavirus infection Diseases 0.000 description 1
- 201000004201 anogenital venereal wart Diseases 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 238000013096 assay test Methods 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 229960001212 bacterial vaccine Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 201000001531 bladder carcinoma Diseases 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000001720 carbohydrates Chemical group 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 239000002771 cell marker Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 229940106189 ceramide Drugs 0.000 description 1
- ZVEQCJWYRWKARO-UHFFFAOYSA-N ceramide Natural products CCCCCCCCCCCCCCC(O)C(=O)NC(CO)C(O)C=CCCC=C(C)CCCCCCCCC ZVEQCJWYRWKARO-UHFFFAOYSA-N 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 108091016312 choline binding proteins Proteins 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 230000003467 diminishing effect Effects 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- LGRBZCLULGFXOD-DQMMGUQESA-L disodium (2S,4S,5R,6R)-5-acetamido-6-[(1S,2R)-2-[(2S,4S,5R,6R)-5-acetamido-2-carboxylato-4-hydroxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]oxan-2-yl]oxy-1,3-dihydroxypropyl]-2-[(2S,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(E,2S,3R)-3-hydroxy-2-(octadecanoylamino)octadec-4-enoxy]oxan-3-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-4-hydroxyoxane-2-carboxylate Chemical compound [Na+].[Na+].CCCCCCCCCCCCCCCCCC(=O)N[C@@H](CO[C@@H]1O[C@H](CO)[C@@H](O[C@@H]2O[C@H](CO)[C@H](O)[C@H](O[C@@]3(C[C@H](O)[C@@H](NC(C)=O)[C@@H](O3)[C@H](O)[C@@H](CO)O[C@@]3(C[C@H](O)[C@@H](NC(C)=O)[C@@H](O3)[C@H](O)[C@H](O)CO)C([O-])=O)C([O-])=O)[C@H]2O)[C@H](O)[C@H]1O)[C@H](O)\C=C\CCCCCCCCCCCCC LGRBZCLULGFXOD-DQMMGUQESA-L 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 230000000369 enteropathogenic effect Effects 0.000 description 1
- 231100000249 enterotoxic Toxicity 0.000 description 1
- 230000002242 enterotoxic effect Effects 0.000 description 1
- ZINJLDJMHCUBIP-UHFFFAOYSA-N ethametsulfuron-methyl Chemical compound CCOC1=NC(NC)=NC(NC(=O)NS(=O)(=O)C=2C(=CC=CC=2)C(=O)OC)=N1 ZINJLDJMHCUBIP-UHFFFAOYSA-N 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000011990 functional testing Methods 0.000 description 1
- 150000002270 gangliosides Chemical class 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 150000008271 glucosaminides Chemical class 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000000185 hemagglutinin Substances 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- WQZGKKKJIJFFOK-UHFFFAOYSA-N hexopyranose Chemical group OCC1OC(O)C(O)C(O)C1O WQZGKKKJIJFFOK-UHFFFAOYSA-N 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 201000009163 human granulocytic anaplasmosis Diseases 0.000 description 1
- 208000022340 human granulocytic ehrlichiosis Diseases 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000002130 immunocastration Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 230000002480 immunoprotective effect Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 108010024383 kallikrein 4 Proteins 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000001821 langerhans cell Anatomy 0.000 description 1
- 150000002605 large molecules Chemical class 0.000 description 1
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 201000005296 lung carcinoma Diseases 0.000 description 1
- 201000003866 lung sarcoma Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 101710130522 mRNA export factor Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 229940124735 malaria vaccine Drugs 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- VVGIYYKRAMHVLU-UHFFFAOYSA-N newbouldiamide Natural products CCCCCCCCCCCCCCCCCCCC(O)C(O)C(O)C(CO)NC(=O)CCCCCCCCCCCCCCCCC VVGIYYKRAMHVLU-UHFFFAOYSA-N 0.000 description 1
- JPXMTWWFLBLUCD-UHFFFAOYSA-N nitro blue tetrazolium(2+) Chemical compound COC1=CC(C=2C=C(OC)C(=CC=2)[N+]=2N(N=C(N=2)C=2C=CC=CC=2)C=2C=CC(=CC=2)[N+]([O-])=O)=CC=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=C([N+]([O-])=O)C=C1 JPXMTWWFLBLUCD-UHFFFAOYSA-N 0.000 description 1
- 231100001083 no cytotoxicity Toxicity 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 125000002347 octyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- VQWNELVFHZRFIB-UHFFFAOYSA-N odn 1826 Chemical compound O=C1NC(=O)C(C)=CN1C(O1)CC(O)C1COP(O)(=O)OC1CC(N2C(NC(=O)C(C)=C2)=O)OC1COP(O)(=O)OC1CC(N2C3=C(C(NC(N)=N3)=O)N=C2)OC1COP(O)(=O)OC1CC(N2C(N=C(N)C=C2)=O)OC1COP(O)(=O)OC1CC(N2C3=NC=NC(N)=C3N=C2)OC1COP(O)(=O)OC1CC(N2C3=C(C(NC(N)=N3)=O)N=C2)OC1COP(O)(=O)OC1CC(N2C(NC(=O)C(C)=C2)=O)OC1COP(O)(=O)OC1CC(N2C(N=C(N)C=C2)=O)OC1COP(O)(=O)OC1CC(N2C(N=C(N)C=C2)=O)OC1COP(O)(=O)OC1CC(N2C(NC(=O)C(C)=C2)=O)OC1COP(O)(=O)OC(C(O1)COP(O)(=O)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=O)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=O)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=O)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=O)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(O)=O)CC1N1C=C(C)C(=O)NC1=O VQWNELVFHZRFIB-UHFFFAOYSA-N 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 150000002482 oligosaccharides Polymers 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 239000006201 parenteral dosage form Substances 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 229930192851 perforin Natural products 0.000 description 1
- 108010021711 pertactin Proteins 0.000 description 1
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 201000000317 pneumocystosis Diseases 0.000 description 1
- 230000010287 polarization Effects 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 210000004986 primary T-cell Anatomy 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 238000000751 protein extraction Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000003014 reinforcing effect Effects 0.000 description 1
- 239000003488 releasing hormone Substances 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 235000017709 saponins Nutrition 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 229940007046 shigella dysenteriae Drugs 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 229940031626 subunit vaccine Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 229940118376 tetanus toxin Drugs 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 239000003970 toll like receptor agonist Substances 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000024033 toxin binding Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 208000010570 urinary bladder carcinoma Diseases 0.000 description 1
- 230000002477 vacuolizing effect Effects 0.000 description 1
- 244000052613 viral pathogen Species 0.000 description 1
- 239000000277 virosome Substances 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/24—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Enterobacteriaceae (F), e.g. Citrobacter, Serratia, Proteus, Providencia, Morganella, Yersinia
- C07K14/25—Shigella (G)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5256—Virus expressing foreign proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55544—Bacterial toxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55555—Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6037—Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/24011—Poxviridae
- C12N2710/24111—Orthopoxvirus, e.g. vaccinia virus, variola
- C12N2710/24141—Use of virus, viral particle or viral elements as a vector
- C12N2710/24143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- the present invention relates to the field of antigen-related disease and especially to the field of therapeutic vaccines.
- the present invention aims to elicit an immune response in an individual in need thereof, using a B subunit of Shiga toxin or a functional equivalent thereof complexed to an antigen and a means stimulating NKT cells.
- Vaccine delivery system and adjuvants approved for human use primarily stimulate humoral immune responses.
- pathogens HAV, mycobacterium tuberculosis , malaria . . .
- cancer vaccines will likely require both humoral and cellular responses.
- Live attenuated pathogens or whole inactivated organisms have been shown to activate both arms of the immune system in human but these vaccines are difficult to produce, potentially unsafe or poorly immunogenic. Development of subunit vaccines to elicit a robust specific CD8+ T cell response represents therefore an ongoing competitive challenge.
- DCs Dendritic cells
- NK and NKT cells are effective immune cells
- clinical studies using healthy recipients proved the immunogenicity and safety of DCs, and demonstrated that a single injection of a small number of antigen-pulsed DCs is sufficient to rapidly expand T-cell immunity for both na ⁇ ve and recall antigens.
- generation and ex vivo manipulation of DCs are laborious. Direct antigen targeting to DCs in vivo will therefore offer several advantages.
- the present invention aims to respond to said objective by providing a composition that delivers antigen to DCs, leads to an optimal presentation of peptides derived from the antigen by HLA-class 1 molecules, and provides a maturation stimulus for DCs.
- WO02/060937 previously disclosed a carrier for targeting a molecule to Gb3 receptor expressing cells, said carrier having the following formula STxB-Z(n)-Cys, wherein STxB is the Shiga Toxin subunit B, Z is an amino acid linker with no sulfydryl group, n being 0, 1 or a polypeptide, and Cys is the amino acid Cysteine.
- STxB is the Shiga Toxin subunit B
- Z is an amino acid linker with no sulfydryl group
- n being 0, 1 or a polypeptide
- Cys is the amino acid Cysteine.
- WO02/060937 showed that a STxB based vaccine induced humoral response and a robust and long-lasting CD8+ T cell response. All these results may be explained by the ability of STxB to increase costimulatory and MHC class II molecules on DCs and to induce TNF on some cells which could indirectly favour the maturation of DCs.
- the present invention aims therefore to provide a composition that leads to the maturation of DCs.
- EP 1078007 described the use of a toxin-antigen conjugate, wherein the toxin is the Shiga toxin B subunit, in combination with KLH for stimulating an immune response.
- the patent application WO2005/112991 disclosed the use of the B subunit of Shiga Toxin complexed with an antigen and an adjuvant for stimulating an immune response.
- the adjuvant may be selected from the group consisting of metal salts, oil in water emulsions, Toll like receptors agonists, saponins, lipid A, alkyl glucosaminide phosphate, immunostimulatory oligonucleotide or combinations thereof.
- the Applicant did not observed such a synergy with adjuvants such as IFA (Haicheur et al. JI 2000, 165:3301-3308) and observed a very weak synergy with adjuvants such as IFN ⁇ , Poly(I:C), or the Toll like receptor agonist CpG.
- adjuvants such as IFA (Haicheur et al. JI 2000, 165:3301-3308) and observed a very weak synergy with adjuvants such as IFN ⁇ , Poly(I:C), or the Toll like receptor agonist CpG.
- an object of the present invention is to provide a composition comprising
- the immunological functional equivalent of the B subunit of Shiga toxin has at least 50% amino acid sequence identity to the B subunit of Shiga toxin.
- said ligand of CD1 is a ligand of CD1d.
- said ligand of CD1 is a glycolipid or phospholipid, a glycosphingolipid, a derivative or an analog thereof.
- said ligand is chosen from iGb3, GD3, PE and PI.
- said ligand of CD1 is a glycosylceramide or an analog or a derivative thereof.
- said glycosylceramide is selected from the group consisting of ⁇ -GalCer, ⁇ -GlcCer, Gal ⁇ 1-6Gal ⁇ 1-1′Cer, Gal ⁇ 1-6Glc ⁇ 1-1′Cer, Gal ⁇ 1-2Gal ⁇ 1-1′Cer, Gal ⁇ 1-3Gal ⁇ 1-1′Cer or a derivative thereof, preferably a C-glycoside derivative thereof, more preferably a C-glycoside derivative of ⁇ -GalCer.
- ⁇ GalCer is (2S,3S,4R)-1-O-( ⁇ -D-galactopyranosyl)-2-(N-hexa-cosanoylamino)-1,3,4-octadecanetriol.
- ⁇ GalCer is (2S,3S,4S)-1-O-( ⁇ -D-galactopyranosyloxy)-2-hexacosanoylamino-3,4-octadecanediol (KRN7000).
- said ligand of CD1 is selected from the group consisting of 3-O-sulfo- ⁇ -GalCer, ⁇ -GalCer, an OCH compound, ⁇ -C-GalCer.
- said ligand of CD1 is a microbe derived glycolipid.
- said ligand is
- the B subunit of Shiga toxin or the functional equivalent thereof is present in a universal polypeptidic carrier having the formula STxB-Z(n)-Cys, wherein
- n 0.
- the antigen is covalently linked to the —S residue of the universal carrier by a —S—S, or —S—CO, or S—CH 2 , or —S—NH linkage.
- the universal carrier is covalently linked to an oligopeptide or a polypeptide by a —S—S, or —S—CO, or S—CH 2 , or —S—NH linkage, and the antigen to be targeted is operably linked to the said oligopeptide or polypeptide.
- the universal carrier is covalently linked to a poly-lysine oligopeptide and the antigen to be targeted is operably linked to the said poly-lysine moiety.
- the antigen is a tumor antigen, a viral or a bacterial antigen.
- composition as described above further comprises a pharmaceutically acceptable carrier.
- the present invention also aims to provide a medicament comprising a composition as described above.
- Another object of the present invention is a vaccine comprising said composition.
- It is also an object of the present invention to provide a pharmaceutical kit comprising:
- a) a first container comprising a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen and
- At least a second container comprising at least one ligand of CD1 capable of stimulating NK T cells.
- the present invention relates to the use of a composition as described above for the manufacture of a pharmaceutical composition or a medicament, including a vaccine, for treating an antigen-related condition in an individual, said antigen-related state being a tumor or an infection.
- the present invention relates to the use of said composition for treating an antigen-related condition in an individual in need thereof, wherein said composition is to be administrated to said individual in an therapeutically effective amount for stimulating an immune response against the antigen in said individual, thereby treating said antigen-related condition in said individual.
- the present invention relates to the use of said composition for treating an antigen-related condition in an individual in need thereof, wherein said composition is to be administered in combination with thalidomide or an analog thereof, preferably lenalidomide.
- the present invention also relates to the use of the kit as described above, wherein at least one ligand of CD1 capable of stimulating NK T cells is to be administrated before, simultaneously or after the B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen.
- the use of the composition as described above leads to the stimulation of the immune response, which comprises stimulating dendritic cells.
- composition as described above leads to the stimulation of the immune response, which comprises eliciting an antigen specific CD8 response.
- FIG. 1 Role of adjuvants on the levels of anti-OVA 257-264 CD8 + T cells induced by the STxB-OVA conjugate.
- ⁇ -GalCer (2 ⁇ g) was only admixed with STxB-OVA on d0.
- the second immunization was performed with STxB-OVA alone.
- CD8 + T cells from spleen were isolated 7 days after the last immunization and directly stained ex vivo with PE-labeled OVA 257-264 /kb tetramer and allophycocyanin-labeled anti-CD8 mAb. Values shown correspond to mean ⁇ SD obtained with specific tetramer after subtracting values from irrelevant tetramer recognizing a VSV-derived peptide in the context of K b . These results are representative of three experiments with 4 mice per group.
- FIG. 2 ⁇ -GalCer increases the efficiency of STxB to induce long-lasting and functional specific anti-OVA 257-264 CD8 + T cells even at very low doses of antigen.
- Mice were subcutaneously immunized twice (d0 and d21) with various doses of STxB-OVA alone (A Left) or combined with ⁇ -GalCer (A right, C, D) or with free ovalbumin admixed with ⁇ -GalCer (B). As mentioned in Material and Methods, ⁇ -GalCer was only administered during the first immunization.
- A, B, C CD8 + T cells from spleens were isolated 7 days after the last immunization and directly stained ex vivo with PE-labeled OVA 257-264 /k b tetramer and allophycocyanin-labeled anti-CD8 mAb. Results shown are gated on CD8 + T cells. An irrelevant tetramer recognizing a VSV-derived peptide in the context of K b and an isotype control mAb were included as controls. These results are representative of three experiments with 4 mice per group. D: Mice were immunized with STxB-OVA (1 ⁇ g) mixed with ⁇ -GalCer (2 ⁇ g).
- IFN ⁇ producing OVA 257-264 /K b specific CD8 + T cells were detected ex vivo by an IFN ⁇ ELISPOT assay using EL4 pulsed ( ⁇ ) or not ( ⁇ ) with the OVA 257-264 peptide (SL8).
- CTL activity was measured in a standard 4-h 51 Cr release assay on the target EL4 cells pulsed with ( ⁇ ) or without ( ⁇ ) the OVA 257-264 peptide at an effector-target E/T ratio of 100/1. Three mice per group were immunized and these experiments were reproduced two times.
- FIG. 3 ⁇ -GalCer also increases the efficiency of STxB-E7 to elicit anti-E7 CTL.
- Mice were immunized on day 0 and day 21 with STxB-E7 43-57 (1 ⁇ g) alone or mixed with ⁇ -GalCer or with the free polypeptide E7 43-57 mixed with ⁇ -GalCer.
- CD8 + T cells from spleen were isolated and directly stained with PE-labeled E7 49-57 /D b tetramer. (Cells were previously gated on CD8 + T cells). An irrelevant tetramer recognizing a LCMV derived peptide in the context of D b was included as controls.
- FIG. 4 CD4 + T cell and humoral responses after STxB-OVA based vaccine immunization.
- mice were vaccinated with ovalbumin (0.01 nmol) mixed with IFA.
- CD4 + T cells were purified from spleen and labeled with CFSE. They were then incubated with T cell depleted splenocytes as APC pulsed with free ovalbumin protein and cocultured for 5 days in AIM V serum free medium.
- FIG. 5 Combination of STxB-OVA and ⁇ -GalCer enhances the cross-presentation of ovalbumin by dendritic cells.
- CD11c + enriched dendritic cells were cocultured with CFSE labeled OT-1 cells for 72 hours. These experiments were reproduced three times with similar results. Dot plots were gated on CFSE labeled CD8 + OT-1 cells.
- FIG. 6 STxB-OVA combined with ⁇ -GalCer primes anti-OVA 257-264 CD8 + T cells in OVA-TG mice.
- OVA-TG mice were immunized with STxB-OVA (0.1 nmol) combined or not with ⁇ -GalCer (2 ⁇ g).
- CD8 + T cells from spleen were isolated and directly stained with PE-labeled OVA 257-264 /K b tetramer and APC-labeled anti-CD8 mAb.
- Each square represents values from individual mice and corresponds to results obtained with specific OVA 257-264 /K b tetramer after subtracting the values obtained with an irrelevant tetramer recognizing a VSV derived peptide in the context of K b . Two series of experiments were performed with similar results.
- FIG. 7 STxB-OVA combined with ⁇ -GalCer induce anti-viral protective immunity against a challenge with rVV-OVA.
- ⁇ -GalCer was not added during the second immunization.
- mice Eight days after the last injection mice were challenged intraperitoneally with 2.5 ⁇ 10 6 PFU recombinant vaccina virus (rVV-OVA, Westerns Reserve strains) expressing ovalbumin cDNA. After 4 days, ovaries were assayed for rVV titers by plaque assay on BHK 21 cells. Results represent mean of pfu from 6 mice per group. P values were calculated by a Student't test.
- FIG. 8 No adjuvant effect of ⁇ -GalCer in mice deficient in NKT cells. Ja18 ⁇ / ⁇ mice were immunized with STxB-OVA (1 ⁇ g) or STxB-OVA+ ⁇ -GalCer (2 ⁇ g). 7 days after immunization, the spleens of immunized and non-immunized mice were harvested and stained with anti-CD8 antibody and OVA 257-264 /K b tetramer.
- FIG. 9 Vaccination with ⁇ GalCer combined with STxB-Ova induces protection against established tumors.
- C57BL6 mice were grafted with EG7 tumor and three days after were vaccinated with PBS, STxB-OVA, ⁇ -GalCer, or STxB-OVA+ ⁇ -GalCer.
- mammals mammals, in particular a human being.
- an effective amount it is meant an amount sufficient to effect a beneficial or desired clinical result (e.g. improvement in clinical condition).
- treatment generally refers to a clinical intervention in an attempt to alter the natural course of the individual or cell being treated, and may be performed either for prophylaxis or during the course of clinical pathology. Desirable effects include, but are not limited to, preventing occurrence or recurrence of disease, alleviating symptoms, suppressing, diminishing or inhibiting any direct or indirect pathological consequences of the disease, preventing metastasis, lowering the rate of disease progression, ameliorating or palliating the disease state, and causing remission or improved prognosis.
- NKT cells or “natural killer cell” is known in the art, and as used herein, refers to a T cell population that causes, stimulates or contributes to cytokine production, and/or in another embodiment, is cytotoxic. NKT cells are characterised by expression of both a T cell antigen receptor (TCR) and NK cell marker (i.e. NK 1.1, a C-lectin-type NK receptor, DX5, Ly49 receptors in mice and NKR-P1A in human).
- TCR T cell antigen receptor
- NK cell marker i.e. NK 1.1, a C-lectin-type NK receptor, DX5, Ly49 receptors in mice and NKR-P1A in human.
- Th1 cytokine refers to cytokine elicited by T helper cells as part of the adaptative immune response.
- Th1 cytokines are interleukin-2 or interferon- ⁇ for example.
- Th2 cytokine refers to cytokine elicited by T helper cells as part of the adaptative immune response.
- Th2 cytokine are interleukine-4 or interleukine-10, for example.
- DC dendritic cell
- mature dendritic cells refers to a population of dendritic cells with diminished CD115, CD14, CD68 or CD32 expression, or a population of dendritic cells with enhanced CD86 expression, or a combination thereof.
- stimulating an immune response refers to the initiation of an immune response against an antigen of interest in an individual in which an immune response against said antigen has not already been initiated or refers to any improvement in an immune response that has already been mounted by an individual. It is to be understood that reference to the stimulation of the immune response may involve both the humoral and cell-mediated arms of the immune system. In one embodiment; stimulation of the immune response resulting in the stimulation of the humoral immune response may be reflected by an increase in antibody production and a TH2 cytokine profile (IL-4, 11-5, IL-6 . . . ) which can be determined by any means known in the art, such as for example by ELISA.
- a TH2 cytokine profile IL-4, 11-5, IL-6 . . .
- stimulation of the immune response resulting in the stimulation of the cell-mediated response may be reflected by an increase in IFN- ⁇ or IL-12, or both, which may be similarly determined.
- stimulating the immune response is associated with a change in cytokine expression. Such change may be readily measured by any means well-known in the art, such as ELISA, Western-Blot analysis, PCR analysis, and others.
- antigen is known in the art, and as used herein, refers to any agent (protein, peptide, polysaccharide, glycoprotein, glycolipid, nucleic acid, or combination thereof), which elicits an immune response when introduced into a host and those which are able to elicit an immune response when complexed with the B subunit of Shiga toxin according to the invention.
- antiigen epitope includes fragments of proteins capable of determining antigenicity.
- antigens include proteins and other molecules which are specifically associated with surfaces of particular types of cancer cells, i.e. tumour cells.
- antigens may be associated with the surfaces or secretion products of micro-organisms or pathogens.
- pathogen is meant to include organisms that cause disorders, such disorders produced by one or more particular species of bacteria, viruses, fungi and protozoans which are disease-producing organisms.
- antigen-related state or “antigen-related condition” as used herein refers to micro-organism or pathogenic infections, allergen associated states or refers to the presence of a tumour.
- adjuvant refers to a compound or a mixture that may be non-immunogenic when administered in the host alone, but that augments the host's immune response to an antigen when administered conjointly with that antigen.
- vacun refers to a composition that can be used to elicit protective immunity in a recipient.
- a vaccine is a medicament.
- the present invention relates to a composition
- a composition comprising
- the B subunit of Shiga toxin is secreted by Shigella dysenteriae . This homopentamer is responsible for toxin binding to and internalisation into target cells by interacting with the glycolipid Gb3 found in the plasma membrane of these cells.
- the B subunit of Shiga toxin has the sequence described in NA Strockbine et al. J Bacteriol 1988, 170, 1116-22.
- a functional equivalent of the B subunit of Shiga toxin means a polypeptidic sequence having the capacity to bind specifically to the Gb3 receptor and/or to trigger an internalisation of an antigen and its presentation in an MHC class I restricted pathway, or both MHC class I and class II on the same antigen presenting cell.
- functional equivalents of the B subunit of Shiga toxin include homologous toxins, which are able to bind the Gb3 receptor, from other bacteria.
- the B subunits of verotoxin-1 or verotoxin-2 from E Coli are also known to bind the Gb3 receptor.
- the term “toxin” is intended to mean toxins that have been detoxified such that they are no longer toxic to humans, or a toxin subunit or fragment thereof that are substantially devoid of toxic activity in humans.
- the functional equivalent of the B subunit of Shiga toxin has at least 50%, and preferably 60, 70, 80, 90 or 95%, amino acid identity to the B subunit of Shiga toxin.
- the capacity of polypeptidic sequence to bind specifically to the Gb3 receptor may be evaluated by the following assay which is based on the method described by Tarrago-Trani (Protein extraction and purification 39, pp 170-176, 2004) and involves an affinity chromatography on a commercially available galabiose-linked agarose gel (Calbiochem).
- Galabiose (Gala1-4Gal) is the terminal carbohydrate portion of the oligosaccharide moiety of Gb3 and is thought to represent the minimal structure recognized by the B subunit of Shiga toxin.
- the protein of interest in PBS buffer (500 ⁇ l) is mixed with 100 ⁇ l of immobilized galabiose resin previously equilibrated with the same buffer, and incubated for 30 min to 1 hour at 4° C. on a rotating wheel. After a first centrifugation at 5000 rpm for 1 min, the pellet is washed twice with PBS. The bound material is then eluated twice by re-suspending the final pellet in 2 ⁇ 500 ⁇ l of 100 mM glycine pH 2.5. Samples corresponding to the flow-through, the pooled washes and the pooled eluates are then analysed by SDS Page, Coomassie staining and Western blotting.
- CD1 molecules are a family of highly conserved antigen presenting proteins that are similar to in function to classical MHC molecules. CD1 proteins bind and display a variety of lipids and glycolipids to T lymphocytes. The five known isoforms are classified into two groups, group 1 (CD1a, CD1b, CD1c and CD1e in humans) and group II (CD1d in humans and mice).
- the ligand of CD1 present in the composition of the invention is a ligand of CD1d.
- Certain ligands of CD1 molecule when bound, stimulate NKT cells: for example they stimulate rapid Th1 and Th2 cytokine production by NKT cells.
- said ligand induces Th1 and Th2 cytokine production, such as IL-4 and IFN- ⁇ .
- Th1 and Th2 cytokine production may be readily measured by any means well-known in the art, such as ELISA or by flow cytometry for example.
- said ligand induces an increase in the expression of CD25, CD69 or Fas Ligand molecules, or an increase in the production of perforin. Such increase may be measured by any means well-known in the art, such as flow-cytometry for example.
- said ligand of CD1 capable of stimulating NKT cells is a glycolipid, a phospholipid, a glycosphingolipid, a derivative or an analog thereof.
- Glycosphingolipids are complex glycolipids which contain ceramide as an extra-lipid component.
- Kirin Pharmaceutical in Japan identified several glycosphingolipids compounds, named agelasphins, from an extract of the Okinawan marine sponge, Agela mauritianus (Natori et al. Tetrahedron 1994, 50:2771-2784).
- glycolipid examples include the lysosomal glycosphingolipid, isoglobotrihexosylceramide iGB3 (Zhou et al. Science 2004, 306:1786-1789); the disialoganglioside GD3 (Wu et al., J. Exp. Med. 2003, 198:173-181); the phosphatidylinositol PI (Gumperz et al. Immunity 2000, 12:211-221) and the phosphatidylethanolamine PE (Rauch et al. J. Bioch. Chem 2003, 278:47508-47515).
- said ligand is chosen from GD3, PE and PI.
- said ligand is the sphingolipid as described in the U.S. Pat. No. 5,780,441, said sphingolipid having the following formula:
- R1 represents H or
- R2 represents H
- R3 and R6 represent H or OH, respectively;
- R4 represents H, OH or
- R5 represents H or
- X denotes an integer from 19 to 23; and R7 represents any one of the following groups (a)-(g):
- R1, R2, R4 and R5 is a glycosyl moiety.
- said ligand is an ⁇ -galactosylceramide as described in the U.S. Pat. No. 5,936,076, said ⁇ -galactosylceramide having the following formula:
- R2 represents H or OH and X denotes an integer of 0-26 or R represents (CH 2 ) 7 CH ⁇ CH(CH 2 ) 7 CH 3 and
- R1 represents any one of the substituents defined by the following (a)-(e):
- Y denotes an integer of 5-17.
- said ligand is an ⁇ -galactosylceramide as described in the U.S. Pat. No. 6,555,372, said ⁇ -galactosylceramide having the following formula:
- R1 represents H or OH
- X represents an integer between 7 and 27
- R2 represents a substituent selected from the group consisting of the following (a) to (e) (wherein Y represents an integer between 5 and 17):
- R3 to R9 represent substituents as defined in any one of the following i) and ii):
- R3, R6 and R8 represent H
- R4 represents H, OH, NH 2 , NHCOCH 3 , or a substituent selected from the group consisting of the following groups (A) to (D):
- R5 represents OH or a substituent selected from the group consisting of the following groups (E) and (F):
- R7 represents OH or a substituent selected from the group consisting of the following groups (A) to (D):
- R9 represents H, CH 3 , CH 2 OH or a substituent selected from the group consisting of the following groups (A′) to (D′):
- R3, R6 and R7 represent H
- R4 represents H, OH, NH 2 , NHCOCH 3 , or substituent selected from the group consisting of the following groups (A) to (D):
- R5 represents OH or a substituent selected from the group consisting of groups (E) and (F):
- R8 represents OH or a substituent selected from the group consisting of the following groups (A) to (D):
- R9 represents H, CH3, CH2OH or a substituent selected from the group consisting of the following groups (A′) to (D′):
- said ligand is the compound KRN7000, having the following formula: (2S,3S,4S)-1-( ⁇ -D-galactopyranosyloxy)-2-hexacosanoymamino-3,4-octadecanediol.
- said ligand is a glycolipid derivative as described in the patent application US2002/0032158, said glycolipid derivative having the following formula:
- W represents carbone chain from 9 to 17 which containing double bond or hydroxy group occasionally;
- X represents carbone chain from 11 to 25 which containing double bond or hydroxy group occasionally;
- Y represents —(CH 2 ) a —CH ⁇ CH—(CH 2 ) a —, —(CH 2 ) a — (a, a′ denotes an integer of 0-5 and a+a′ is 5 and under.), —S(O) 0-2 CH 2 —, —NHCH 2 ;
- Z represents —CO—, —SO 2 ;
- R represents —CH 2 OH, —CO 2 H, —CH 2 OCH 2 CO 2 H, —CH 2 OSO 3 H;
- R 0 represents —OH, —NH 2 , —NHAc.
- said ligand is a glycosylceramide as described in the patent application US2003/0157135, said glycosylceramide having the following formula:
- R1, R2 and R5 represent H or a specific monosaccharide
- R3 and R6 represent H or OH, respectively
- R4 represents H, OH or a specific monosaccharide
- X denotes an integer from 1 to 23
- R7 represents any one of the following groups (a)-(g):
- said ligand is a glycosylceramide or an analog or a derivative thereof.
- said ligand is selected from the group consisting of ⁇ -galactosylceramide ( ⁇ -GalCer), ⁇ -glucosylceramide ( ⁇ -GlcCer), Gal ⁇ 1-6Gal ⁇ 1-1′Cer, Gal ⁇ 1-6Glc ⁇ 1-1′Cer, Gal ⁇ 1-2Gal ⁇ 1-1′Cer, Gal ⁇ 1-3Gal ⁇ 1-1′Cer or a derivative thereof, preferably a C-glycoside derivative thereof, more preferably a C-glycoside derivative of ⁇ -GalCer.
- ⁇ -galactosylceramide ⁇ -GalCer
- ⁇ -GlcCer ⁇ -glucosylceramide
- Gal ⁇ 1-6Gal ⁇ 1-1′Cer Gal ⁇ 1-6Glc ⁇ 1-1′Cer
- Gal ⁇ 1-2Gal ⁇ 1-1′Cer Gal ⁇ 1-2Gal ⁇ 1-1′Cer
- Gal ⁇ 1-3Gal ⁇ 1-1′Cer Gal ⁇ 1-3Gal ⁇ 1-1′Cer or a derivative thereof,
- said ligand has the following formula (2S,3S,4R)-1-O-( ⁇ -D-galactopyranosyl)-2-(N-hexa-cosanoylamino)-1,3,4-octadecanetriol.
- said ligand has the following formula (2S,3S,4S)-1-O-( ⁇ -D-galactopyranosyloxy)-2-hexacosanolamino-3,4-octadecanediol (KRN7000).
- said ligand is an ⁇ -GalCer analog, called ⁇ -C-GalCer, as described in the patent application US2004/0127429, said ligand having the following formula:
- R1 is selected from the group consisting of —(CH 2 ) 11 CH 3 , —(CH 2 ) 12 CH 3 , —(CH 2 ) 13 CH 3 , —(CH 2 ) 9 CH(CH 3 ) 2 , —(CH 2 ) 10 CH(CH 3 ) 2 , —(CH 2 ) 11 CH(CH 3 ) 2 and (CH 2 ) 11 CH(CH 2 )—C 2 H 5 ;
- R3 is OH or a monosaccharide and R4 is hydrogen, or R3 is hydrogen and R4 is OH or a monosaccharide;
- R5 is hydrogen or a monosaccharide
- Q 1 is optionally present and is a C 1-10 straight or branched chain alkylene, alkenylene, or alkynylene;
- X′′ is optionally present and is O, S or NR 8 ;
- Q 2 is optionally present and is a C 1-10 straight or branched chain alkylene, alkenylene or alkynylene;
- X′′ is optionally present and is O, S or NR 8 ;
- Q 3 is a straight or branched chain C 1-10 alkylene, alkenylene or alkynylene, or is hydrogen, wherein each Q′, Q 2 or Q 3 is optionally substituted with hydroxyl, halogen, cyano, nitro, SO 2 NHR 8 , or C( ⁇ O)—R 9 ; and wherein
- R8 is hydrogen, C 1-5 alkyl, C 1-5 alkoxy, halogen, cyano, nitro, SO 2 or C( ⁇ O)—R 9 ;
- R9 is hydrogen, C 1-5 alkyl, C 1-5 alkoxy or NHR 10 ;
- R10 is hydrogen, C 1-5 alkyl or C 1-5 alkoxy
- said ligand is PBS-57, which structure was described by Liu et al. Journal of Immunological Methods, 312 (2006) 34-39.
- said ligand is a C-glycolipid, as described in the patent application US2005/0222048, having the following formula:
- said ligand is an immunogenic compound as described in the patent application US2006/0211856, having the following formula:
- R1 H or an alkyl group
- R2 H or SO 3 ⁇ ;
- R3 H or OH
- R 3′ H or OH
- R 4′ H, unsaturated or saturated, alkyl group; unsaturated or saturated, alkyl group; and
- R5 0H, acetamido or a halogen atom
- said ligand is selected from 3-O-sulfo- ⁇ -GalCer, ⁇ -GalCer, an OCH compound, ⁇ -C-GalCer.
- the OCH compound is described in the patent application US2006/0148723, and has the following formula:
- R1 is an aldopyranose group
- R2 is a hydrogen atom or a hydroxyl group
- R3 is —CH 2 —, —CH(OH)—CH 2 — or —CH ⁇ CH—
- R4 is a hydrogen atom or CH 3
- x is 0-35
- ⁇ -C-GalCer has been described above.
- 3-O-sulfo- ⁇ -GalCer is a sulfatide variant of ⁇ -GalCer and has been described in the article Wu et al. (Wu et al. PNAS 2005, 102:1352-1356).
- said ligand is a microbe derived glycolipid.
- said ligand is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N
- composition of the invention comprises the B subunit of Shiga toxin, or the functional equivalent thereof, present in a universal polypeptidic carrier having the formula STxB-Z(n)-Cys, wherein
- the STxB moiety of the universal carrier has the sequence described in NA Strockbine et al. J Bacteriol 1988, 170, 1116-22, or a functional equivalent thereof.
- n 0 and the universal carrier has the following sequence
- the antigen is to be targeted to antigen presentating cells.
- Such cells are selected in a group comprising T lymphocytes, dendritic cells, macrophages, Langerhans cells and the like.
- the coupling approaches for covalent binding of an antigen to STxB-Z (n)-Cys can be any method or processes described or carried out by a skilled person.
- a first method that can be embodied is the use of SPDP hetero-bi-functional cross-linker described par Carlsson et al (5).
- SPDP is capable of being cleavable by serumthiolases that is a cause of decreasing the yield of the reaction.
- a second method for covalent coupling of STxB-Z (n)-Cys peptides with an antigen is to produce bromoacetyl or maleimide functions on the latter as described by P. Schelte et al (4).
- the antigen is chemically activated with bromoacetate anhydride or by a maleimide group respectively.
- these groups are eliminated by cis-elimination, yielding respectively to —S—S, —S—CH2-, to —S—CO- or S—NH-covalent linkages.
- the antigen to be coupled to the —SH moiety the C-terminal Cysteine of the universal carrier has its N-terminus activated with bromoacetic anhydride following the reaction scheme:
- the Bromoacetyl function has high chemoselectivity for peptide thiol groups and the activated peptide can be reacted with STxB-Cys as follows:
- the resulting thioether-linkage is stable to hydrolysis.
- Another method for coupling an antigen to the universal carrier of the invention is to use MBS (m-Maleimidobenzoyl-N-hydroxysuccinimide ester).
- This coupling allows the transport and processing of large molecules such antigenic proteins or glycoproteins through MHC class I and/or MHC class 11 pathways.
- the antigen is covalently linked to the —S residue of the universal carrier by a —S—S, or —S—CO, or S—CH 2 , or —S—NH linkage.
- the universal carrier according to the present invention can be operably linked directly through a covalent binding or indirectly through a linker.
- indirect binding means that the universal carrier is covalently linked through the sulfhydryl moiety of the C-terminal Cysteine to a linker, said linker being operably linked to an antigen to be internalized into Gb3 receptor bearing cells.
- This linkage might be a covalent binding or a non-covalent binding, provided that the affinity between the linker and the antigen is higher than 10 ⁇ 9 mole/1.
- the universal carrier is covalently linked to an oligopeptide or a polypeptide by a —S—S, or —S—CO, or S—CH 2 , or —S—NH linkage, and the antigen to be targeted is operably linked to the said oligopeptide or polypeptide.
- the universal carrier is covalently linked to a poly-lysine oligopeptide and the antigen to be targeted is operably linked to the said poly-lysine moiety.
- the antigen complexed to the B subunit of Shiga toxin is a tumor antigen, a viral antigen or a bacterial antigen.
- the antigen is selected such that it provides immunity against intracellular pathogens such as HIV, tuberculosis, Chlamydia , HBV, HCV and influenza.
- the antigen is derived from HIV (such as gag or fragments thereof, such as p24, tat, nef, envelope such as gp120 or gp160, or fragments of any of these), human herpes viruses, such as gD or derivatives thereof or Immediate Early protein such as ICP27 from HSV1 or HSV2, cytomegalovirus ((esp Human) (such as gB or derivatives thereof), Rotaviral antigen, Epstein Barr virus (such as gp350 or derivatives thereof), Varicella Zoster Virus (such as gp1, 11 and 1E63), or from a hepatitis virus such as hepatitis B virus (for example Hepatitis B Surface antigen or a derivative thereof), or antigens from hepatitis A virus,
- HIV such as gag or
- Influenza virus purified or recombinant proteins thereof such as HA, NP, NA, or M proteins, or combinations thereof), or derived from bacterial pathogens such as Neisseria spp, including N. gonorrhea and N. meningitidis (for example, transferrin-binding proteins, lactoferrin binding proteins, PiIC, adhesins); S. pyogenes (for example M proteins or fragments thereof, C5A protease,), S. agalactiae, S. mutans; H.
- Neisseria spp including N. gonorrhea and N. meningitidis
- S. pyogenes for example M proteins or fragments thereof, C5A protease,), S. agalactiae, S. mutans
- Moraxella spp including M catarrhalis , also known as Branhamella catarrhalis (for example high and low molecular weight adhesins and invasins); Bordetella spp, including B. pertussis (for example pertactin, pertussis toxin or derivatives thereof, filamenteous hemagglutinin, adenylate cyclase, fimbriae), B. parapertussis and B. bronchiseptica; Mycobacterium spp., including M. tuberculosis (for example ESAT6, Antigen 85A, -B or -C), M. bovis, M. leprae, M. avium, M.
- M. tuberculosis for example ESAT6, Antigen 85A, -B or -C
- paratuberculosis M. smegmatis; Legionella spp, including L. pneumophila; Escherichia spp, including enterotoxic E. coli (for example colonization factors, heat-labile toxin or derivatives thereof, heat-stable toxin or derivatives thereof), enterohemorragic E. coli , enteropathogenic E. coli Vibrio spp, including V. cholera (for example cholera toxin or derivatives thereof); Shigella spp, including S. sonnei, S. dysenteriae, S. flexnerii; Yersinia spp, including Y. enterocolitica (for example a Yop protein), Y. pestis, Y.
- enterotoxic E. coli for example colonization factors, heat-labile toxin or derivatives thereof, heat-stable toxin or derivatives thereof
- enterohemorragic E. coli enteropathogenic E. coli Vibrio spp
- Campylobacter spp including C. jejuni (for example toxins, adhesins and invasins) and C. coli; Salmonella spp, including S. typhi, S. paratyphi, S. choleraesuis, S. enteritidis; Listeria spp., including L. monocytogenes; Helicobacter spp, including H. pylori (for example urease, catalase, vacuolating toxin); Pseudomonas spp, including P. aeruginosa; Staphylococcus spp., including S. aureus, S.
- Clostridium spp. including C. tetani (for example tetanus toxin and derivative thereof), C. botulinum (for example botulinum toxin and derivative thereof), C. difficile (for example clostridium toxins A or B and derivatives thereof); Bacillus spp., including B. anthracis (for example botulinum toxin and derivatives thereof); Corynebacterium spp., including C. diphtheriae (for example diphtheria toxin and derivatives thereof); Borrelia spp., including B.
- burgdorferi for example OspA, OspC, DbpA, DbpB
- B. garinii for example OspA, OspC, DbpA, DbpB
- B. afzelii for example OspA, OspC, DbpA, DbpB
- B. andersonii for example OspA, OspC, DbpA, DbpB
- B. hermsii; Ehrlichia spp. including E. equi and the agent of the Human Granulocytic Ehrlichiosis; Rickettsia spp, including R.
- Chlamydia spp. including C. trachomatis (for example MOMP, heparin-binding proteins), C. pneumoniae (for example MOMP, heparin-binding proteins), C. psittaci; Leptospira spp., including L. interrogans; Treponema spp., including T. pallidum (for example the rare outer membrane proteins), T. denticola, T. hyodysenteriae ; or derived from parasites such as Plasmodium spp., including P. falciparum; Toxoplasma spp., including T.
- C. trachomatis for example MOMP, heparin-binding proteins
- C. pneumoniae for example MOMP, heparin-binding proteins
- C. psittaci Leptospira spp., including L. interrogans
- Treponema spp. including T. pallidum (for example the rare outer membrane proteins
- gondii for example SAG2, SAGS, Tg34
- Entamoeba spp. including E. histolytica
- Babesia spp. including B. microti
- Trypanosoma spp. including T. cruzi
- Giardia spp. including G. lamblia
- Leshmania spp. including L. major
- Pneumocystis spp. including P. carinii
- Trichomonas spp. including T. vaginalis
- Schisostoma spp. including S. mansoni , or derived from yeast such as Candida spp., including C. albicans
- Cryptococcus spp. including C. neoformans.
- M. tuberculosis are for example Tb Ra12, Tb H9, Tb Ra35, Tb38-1, Erd 14, DPV, MTI, MSL, mTTC2 and hTCC1 (WO 99/51748).
- Proteins for M. tuberculosis also include fusion proteins and variants thereof where at least two, preferably three polypeptides of M. tuberculosis are fused into a larger protein.
- Preferred fusions include Ra12-TbH9-Ra35, Erd14-DPV-MTI, DPV-MTI-MSL, Erd14-DPV-MTI-MSL-mTCC2, Erd14-DPV-MTI-MSL, DPV-MTI-MSL-mTCC2, TbH9-DPV-MTI (WO 99/51748).
- Chlamydia antigens for Chlamydia include for example the High Molecular Weight Protein (HMW) (WO 99/17741), ORF3 (EP 366 412), and putative membrane proteins (Pmps).
- HMW High Molecular Weight Protein
- ORF3 ORF3
- Pmps putative membrane proteins
- Other Chlamydia antigens of the vaccine formulation can be selected from the group described in WO 99/28475.
- Preferred bacterial antigens are derived from Streptococcus spp, including S. pneumoniae (for example, PsaA, PspA, streptolysin, choline-binding proteins) and the protein antigen Pneumolysin (Biochem Biophys Acta, 1989, 67, 1007; Rubins et al., Microbial Pathogenesis, 25, 337-342), and mutant detoxified derivatives thereof (WO 90/06951; WO 99/03884).
- Other preferred bacterial vaccines comprise antigens derived from Haemophilus spp., including H. influenzae typeB, non typeable H.
- influenzae for example OMP26, high molecular weight adhesins, P5, P6, protein D and lipoprotein D, and fimbrin and fimbrin derived peptides (U.S. Pat. No. 5,843,464) or multiple copy varients or fusion proteins thereof.
- Hepatitis B Surface antigen are well known in the art and include, inter alia, those PreS1, PreS2 S antigens set forth described in European Patent applications EP-A-414 374; EP-A-0304 578, and EP 198-474.
- the antigen is derived from the Human Papilloma Virus (HPV) considered to be responsible for genital warts (HPV 6 or HPV 11 and others), and the HPV viruses responsible for cervical cancer (HPV16, HPV18. and others).
- HPV Human Papilloma Virus
- Particularly preferred forms of genital wart prophylactic, or therapeutic, vaccine comprise L1 protein, and fusion 5, proteins comprising one or more antigens selected from the HPV proteins E1, E2, E5, E6, E7, L1, and L2.
- the most preferred forms of fusion protein are: L2E7 as disclosed in WO 96/26277, and proteinD(1/3)-E7 disclosed in WO99/10375.
- a preferred HPV cervical infection or cancer, prophylaxis or therapeutic vaccine, composition may comprise HPV 16 or 18 antigens.
- Particularly preferred HPV 16 antigens comprise the early proteins E6 or E7 in fusion with a protein D carrier to form Protein D-E6 or E7 fusions from HPV 16, or combinations thereof; or combinations of E6 or E7 with L2 (WO 96/26277).
- the HPV 16 or 18 early proteins E6 and E7 may be presented in a single molecule, preferably a Protein D-E6/E7 fusion.
- Such vaccine may optionally contain either or both E6 and E7 proteins from HPV 18, preferably in the form of a Protein D-E6 or Protein D-E7 fusion protein or Protein D E6/E7 fusion protein.
- Antigens may also derived from parasites that cause Malaria, for example, antigens from Plasmodia falciparum including circumsporozoite protein (CS protein), RTS, S, MSP1, MSP3, LSA1, LSA3, AMA1 and TRAP.
- RTS is a hybrid protein comprising substantially all the C-terminal portion of the circumsporozoite (CS) protein of P. falciparum linked via four amino acids of the preS2 portion of Hepatitis B surface antigen to the surface (S) antigen of hepatitis B virus. Its full structure is disclosed in International Patent Application No. PCT/EP92/02591, published under Number WO 93/10152 claiming priority from UK patent application No. 9124390.7.
- RTS When expressed in yeast RTS is produced as a lipoprotein particle, and when it is co-expressed with the S antigen from HBV it produces a mixed particle known as RTS, S.
- TRAP antigens are described in International Patent Application No. PCT/GB89/00895, published under WO 90/01496. Plasmodia antigens that are likely candidates to be components of a multistage Malaria vaccine are P.
- tumor antigens examples include MAGE 1 and MAGE 3 or other MAGE antigens (for the treatment of melanoma), PRAME, BAGE, or GAGE (Robbins and Kawakami, 1996, Current Opinions in Immunology 8, pps 628-636; Van den Eynde et al., International Journal of Clinical & Laboratory Research (submitted 1997); Correale et al. (1997), Journal of the National Cancer Institute 89, p293. Indeed these antigens are expressed in a wide range of tumour types such as melanoma, lung carcinoma, sarcoma and bladder carcinoma.
- tumour-specific antigens include, but are not restricted to tumour-specific gangliosides, Prostate specific antigen (PSA) or Her-2/neu, KSA (GA733), PAP, mammaglobin, MUC-1, carcinoembryonic antigen (CEA).
- Other tumour-associated antigen comprise Prostate-specific membrane antigen (PSMA), Prostate Stem Cell Antigen (PSCA), tyrosinase, survivin, NY-ES01, prostase, PS108 (WO 98/50567), RAGE, LAGE, HAGE.
- said antigen may be a self peptide hormone such as whole length Gonadotrophin hormone releasing hormone (GnRH, WO 95/20600), a short 10 amino acid long peptide, useful in the treatment of many cancers, or in immunocastration.
- the antigen complexed to the B subunit of Shiga toxin is chosen among E6, E7, antigens from the Mage family, Her2/neu, EGFRVIII, survivin, telomerase, WT1 and ESAT6.
- the composition above described further comprises a pharmaceutically acceptable carrier.
- compositions of the present invention are formulated as oral or parenteral dosage forms, such as uncoated tablets, coated tablets, pills, capsules, powders, granulates, dispersions or suspensions.
- the compositions of the present invention are formulated for intravenous administration.
- the compounds of the present invention are formulated in ointment, cream or gel form for transdermal administration.
- the compounds of the present invention are formulated as an aerosol or spray for nasal application.
- the compositions of the present invention are formulated in a liquid dosage form. Examples of suitable liquid dosage forms include solutions or suspensions in water, pharmaceutically acceptable fats and oils, alcohols or other organic solvents, including esters, emulsions, syrups or elixirs, solutions and/or suspensions.
- Suitable excipients and carriers may be, according to embodiments of the invention, solid or liquid and the type is generally chosen based on the type of administration being used. Liposomes may also be used to deliver the composition. Examples of suitable solid carriers include lactose, sucrose, gelatin and agar. Oral dosage forms may contain suitable binders, lubricants, diluents, disintegrating agents, coloring agents, flavoring agents, flow-inducing agents, and melting agents.
- Liquid dosage forms may contain, for example, suitable solvents, preservatives, emulsifying agents, suspending agents, diluents, sweeteners, thickeners, and melting agents
- suitable solvents for example, suitable solvents, preservatives, emulsifying agents, suspending agents, diluents, sweeteners, thickeners, and melting agents
- Parenteral and intravenous forms should also include minerals and other materials to make them compatible with the type of injection or delivery system chosen. Of course, other excipients may also be used.
- Another object of the present invention is to provide a vaccine comprising said composition.
- the amount of antigen in each vaccine dose is selected as an amount which induces an immunoprotective response without significant, adverse side effects in typical vaccines.
- each human dose will comprise 0.1-1000 ⁇ g of antigen, preferably 0.1-500 ⁇ g, preferably 0.1-100 ⁇ g, most preferably 0.1 to 50 ⁇ g.
- An optimal amount for a particular vaccine can be ascertained by standard studies involving observation of appropriate immune responses in vaccinated subjects. Following an initial vaccination, subjects may receive one or several booster immunisations adequately spaced.
- Such a vaccine formulation may be applied to a mucosal surface of a mammal in either a priming or a boosting vaccination regime; or alternatively be administered systemically, for example via the transdermal, subcutaneous or intramuscular routes. Intramuscular administration is preferred.
- Another object of the present invention is a pharmaceutical kit comprising:
- a) a first container comprising a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen as described above and
- At least a second container comprising at least one ligand of CD1 capable of stimulating NK T cells as described above.
- said ligand of CD1 is a ligand of CD1d. More preferably, said ligand is chosen among all ligands cited above.
- Another object of the present invention is to provide a process for the preparation of said composition wherein the B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen is mixed with at least one ligand of CD 1 capable of stimulating NK T cells.
- formulations of the present invention may be used for both prophylactic and therapeutic purposes.
- a further object of the present invention is therefore the use of the composition as described above for the manufacture of a pharmaceutical composition or a medicament, including a vaccine, for treating an antigen-related condition in an individual, said antigen-related condition being a tumor or an infection.
- the composition as described above is used for the manufacture of a pharmaceutical composition or medicament, including a vaccine, for treating cancer.
- the present invention relates to the use of said composition for treating an antigen-related state in an individual in need thereof.
- Said pharmaceutical composition or medicament is to be administrated to the individual in a therapeutically effective amount for stimulating an immune response against the antigen in said individual, thereby treating said antigen-related condition in said individual.
- the present invention relates to the use of said composition for treating an antigen-related condition in an individual in need thereof, wherein the composition is to be administered in combination with thalidomide or an analog thereof, preferably lenalidomide.
- lenalidomide and its analogues enhance CD 1d-mediated presentation of glycolipid antigens, and therefore enhance antigen-specific activation of NKT cells.
- the present invention relates to the use of the kit as described above, wherein at least one ligand of CD1 capable of stimulating NKT cells is to be administrated before, simultaneously or after the B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen.
- the use of said composition allows the delivery of the antigen into a Gb3 receptor expression cells.
- the stimulation of the immune response induced by the use of the composition of the invention comprises stimulating dendritic cells.
- the stimulation of the immune response induced by the use of the composition of the invention comprises eliciting an antigen specific CD8+ response.
- mice Female C57BL/6 (H-2 b ) mice were purchased from Charles River Laboratories (L'Arbresle, France).
- OVA-TG mice were obtained from Dr P.shrikant (Roswell Park Cancer Institute, Buffalo, N.Y.) with the permission of Dr M. K Jenkins (University of Minnesota). These mice present the C57BL/6 background and express low levels of the membrane-associated form of chicken ovalbumin protein (OVA) in most actin-expressing cells. Mice were kept under specific pathogen-free conditions and were used between 6 and 8 weeks of age according to institutional guidelines.
- OVA ovalbumin
- grade V Purified chicken ovalbumin
- Synthetic OVA-derived peptide OVA 257-264 (SIINFEKL) and HPV16-E7 derived peptide E7 49-57 (RAHYNIVTF) or E7 43-57 (GQAEPDRAHYNIVTF) were obtained from NeoMPS (Strasbourg, France) and stored in PBS.
- STxB-OVA was obtained by chemical coupling, as previously described (Haicheur, N., et al. 2003. Int Immunol 15:1-11). Briefly, OVA was first activated via amino groups on lysine side chains using the heterobifunctional cross-linker MBS (Pierce, Rockford, Ill.). Activated OVA was then reacted with STxB-Cys, and the reaction product was purified by gel filtration and immunoaffinity chromatography.
- STxB-E7 43-57 was produced using a chemical coupling between the N-bromoacetylated E7 43-57 peptide and the sulfhydril group of the STxB-Cys recombinant protein as previously described (Mallard, F. et al. 2003. Methods Mol Med 73:209-220). Removal of contaminating LPS was carried out using Acticlean Etox columns (Biotech-IgG, Kobenhavn, Denmark). After purification, endotoxin concentrations determined by the Limulus assay test (Biowhittaker, Walkersville, Md.) were ⁇ 0.5 EU/mg.
- the iNKT cell ligand ⁇ -GalCer (KRN7000) was kindly supplied by Kirin Brewery Co (Japan). Poly (I:C) and incomplete Freund's adjuvant (IFA) were purchased from Sigma (St Quentin-Fallavier, France). CpG ODN 1826 was purchased from Proligo (Paris, France).
- IFN ⁇ was kindly provided by Ion Gresser (Inserm, France)
- mice thymoma cell line EL4 (H-2 b ) was kindly provided by K. Rock (University of Massachusetts Medical School, Worcester, Mass.) and P Jeannin (Angers University Hospital, France)
- the functionality of the anti-OVA 257-264 /K b CD8 + T cells induced after injection of STxB-OVA was determined by ELISPOT according to the manufacturer's recommendations (Diaclone, Besancon, France). Briefly, 10 5 CD8 + T cells were transferred to anti-mouse IFN ⁇ mAb precoated plates and cultured for 18 hours at 37° C. with 10 5 EL4 cells previously pulsed (or not) with the OVA 257-264 peptide and fixed with 1% paraformaldehyde. After washings, the plates were further incubated with biotinylated anti-mouse IFN ⁇ mAb. Finally, the plates were washed and incubated for 30 min at 37° C.
- CD4 + T cells were purified from spleen and labeled with CFSE (Molecular Probes, Eugene, Oreg.), used at 0.5 ⁇ M for 30 min at 20° C. Labeling was stopped by repeated washing with ice-cold PBS supplemented with 5% FCS. Cells were then incubated with T cell depleted splenocytes as APC pulsed or not with free ovalbumin protein and cocultured for 5 days in AIM V serum free medium. Proliferation in absence of APC sensitization were subtracted as background from values obtained after ovalbumin pulsing.
- CFSE Molecular Probes, Eugene, Oreg.
- CD11c + enriched dendritic cells (10 6 ) isolated as described (37) from mice vaccinated with various vaccine formulations were co-cultured with OT-1 cells (5 ⁇ 10 5 ) for 72 hours. Dilution of CFSE detected by FACS analysis was considered to be an indicator of OT-1 cell proliferation after antigen recognition.
- mice C57BL/6 mice (5 mice per group) were injected twice (d0 and d21) intraperitoneally (200 ⁇ l) with different vaccine formulations and control mice were injected with PBS.
- mice Eight days after the last injection, mice were challenged intraperitoneally with 2.5 ⁇ 10 6 PFU recombinant vaccina virus (rVV, Westerns Reserve strains) expressing either the ovalbumin or the HBx cDNA derived from Hepatitis B virus kindly provided, by Dr N Etchart (INSERM, Lyon) and Dr Lone Yu Chun (Institut Pasteur), respectively. After 4 days, the ovaries of the mice were harvested and homogenized with a mechanical tissue grinder.
- rVV PFU recombinant vaccina virus
- the homogenates were clarified by centrifugation at 4,000 g for 10 min, and the number of rVV PFU in the resultant supernatant was enumerated by infecting BHK 21 cell monolayers with 10-fold serial dilutions of these fluids and plaques were counted after 2 days in culture at 37° C. in a 5% CO 2 environment as previously described (52).
- ⁇ -GalCer Increased the Efficiency of STxB Coupled to Antigen to Induce Specific CTL.
- a first series of experiments tested the ability of various well defined adjuvants to increase the efficiency of STxB-OVA to trigger a specific CTL response.
- the specific anti-OVA 257-264 CD8 + T cells induced by the combination of ⁇ -GalCer and the STxB-OVA conjugate were long-lasting as 2.49% of CD8 + T cells stained positively with OVA 257-264 /K b tetramer directly ex vivo 202 days after the first immunization ( FIG. 2C ).
- mice immunized with STxB-OVA mixed with ⁇ -GalCer efficiently lyzed EL4 target cells loaded with the OVA 257-264 peptide, whereas no cytotoxicity was observed against EL4 alone. No ex vivo cytotoxicity was demonstrated when mice were vaccinated twice with STxB-OVA alone even when high doses (50 ⁇ g) were used (data not shown).
- mice were immunized twice with STxB coupled to a polypeptide derived from the HPV16-E7 protein (STxB-E7 43-57 ) at a low dose (1 ⁇ g).
- STxB-E7 43-57 a polypeptide derived from the HPV16-E7 protein
- FIG. 3 A marked induction of anti-E7 CTL detectable ex vivo by the E7 49-57 Db tetramer (1.12% of CD8 + T cells) was also demonstrated ( FIG. 3 ). These CTL were functional (data not shown).
- E7-specific CTL (0.12% of CD8 + T cells) were detected after immunization with STxB-E7 43-57 alone.
- the E7 43-57 polypeptide mixed with ⁇ -GalCer did not prime a CTL response ( FIG. 3 ).
- mice vaccinated with the STxB-OVA conjugate mixed with ⁇ -GalCer displayed a more potent anti-OVA CD4 + T cell response compared to mice immunized with STxB-OVA alone or free ovalbumin mixed with IFA ( FIG. 4 ).
- ⁇ -GalCer increased the anti-OVA IgG2a response compared to free ovalbumin with adjuvant, this humoral response either for total IgG or the various isotypes was not enhanced when STxB was admixed with ⁇ -GalCer compared to STxB alone.
- mice with recombinant vaccinia virus encoding ovalbumin VV-OVA
- VV-OVA vaccinia virus encoding ovalbumin
- Vaccination of mice with STxB-OVA and ⁇ -GalCer conferred potent protection against VV-OVA, with virus titers in the ovaries reduced by 5 log (3 ⁇ 92 ⁇ 10 3 PFU) compared to those of mice treated with PBS (8 ⁇ 28 ⁇ 10 8 PFU) ( FIG. 7 ).
- mice immunized with ovalbumin and ⁇ -GalCer exhibited a slight reduction of infectious virus, titers from 8 ⁇ 28 ⁇ 10 8 PFU in PBS-treated mice to 7 ⁇ 73 ⁇ 10 8 PFU corresponding to less that 1 log reduction of virus titers ( FIG. 7 ).
- the specificity of the protection was documented by challenging STxB-OVA/ ⁇ -GalCer immunized mice, with an irrelevant vaccinia virus encoding hepatitis B ⁇ protein). No significant reduction of viral load was observed (data not shown).
- C57BL6 mice were grafted with EG7 tumor, a thymoma transfected with cDNA encoding ovalbumin mice, and three days after were treated with PBS, 5 ⁇ g STx-B-Ova, 2 ⁇ g ⁇ GalCer or the combination of both ( FIG. 9 ).
- C57BL6 mice are grafted with EG7 tumor, a thymoma transfected with cDNA encoding ovalbumin mice, and three days after are treated with PBS, 5 ⁇ g STx-B-Ova, 2 ⁇ g C- ⁇ GalCer, or the combination STx-B-Ova/C- ⁇ GalCer.
- mice vaccinated three days after subcutaneous graft of EG7 with the combination of STx-B-Ova/C- ⁇ GalCer will show a significant regression of tumor. In contrast mice immunized with STxB-Ova, or C- ⁇ GalCer alone will not control the growth of the tumor.
Abstract
The present invention relates to a composition comprising a) a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen and b) at least one ligand of CDl capable of stimulating NK T cells; and to a pharmaceutical composition and a medicament comprising said composition.
Description
- The present invention relates to the field of antigen-related disease and especially to the field of therapeutic vaccines. In particular, the present invention aims to elicit an immune response in an individual in need thereof, using a B subunit of Shiga toxin or a functional equivalent thereof complexed to an antigen and a means stimulating NKT cells.
- Vaccine delivery system and adjuvants approved for human use (aluminium salts, MF59, virosomes . . . ) primarily stimulate humoral immune responses. However, preclinical studies strongly suggest that successful vaccines against pathogens (HIV, mycobacterium tuberculosis, malaria . . . ) but also cancer vaccines will likely require both humoral and cellular responses. Live attenuated pathogens or whole inactivated organisms have been shown to activate both arms of the immune system in human but these vaccines are difficult to produce, potentially unsafe or poorly immunogenic. Development of subunit vaccines to elicit a robust specific CD8+ T cell response represents therefore an ongoing competitive challenge.
- Dendritic cells (DCs) have been shown to be the most potent antigen-presenting cells for the induction of primary T cell responses, but they can also induce the differentiation of B cells into antibody forming cells and mobilize other effective immune cells such as NK and NKT cells. In human, clinical studies using healthy recipients proved the immunogenicity and safety of DCs, and demonstrated that a single injection of a small number of antigen-pulsed DCs is sufficient to rapidly expand T-cell immunity for both naïve and recall antigens. However, generation and ex vivo manipulation of DCs are laborious. Direct antigen targeting to DCs in vivo will therefore offer several advantages.
- Therefore, a composition that elicits a robust specific CD8+ T cell response in vivo is of great concern in the field of therapeutic vaccines. The present invention aims to respond to said objective by providing a composition that delivers antigen to DCs, leads to an optimal presentation of peptides derived from the antigen by HLA-
class 1 molecules, and provides a maturation stimulus for DCs. - WO02/060937 previously disclosed a carrier for targeting a molecule to Gb3 receptor expressing cells, said carrier having the following formula STxB-Z(n)-Cys, wherein STxB is the Shiga Toxin subunit B, Z is an amino acid linker with no sulfydryl group, n being 0, 1 or a polypeptide, and Cys is the amino acid Cysteine. WO02/060937 showed that a STxB based vaccine induced humoral response and a robust and long-lasting CD8+ T cell response. All these results may be explained by the ability of STxB to increase costimulatory and MHC class II molecules on DCs and to induce TNF on some cells which could indirectly favour the maturation of DCs. However, when myeloid DCs derived from bone marrow were incubated with STxB, no maturation of these cells has been observed. Thus, the STxB based vaccine disclosed in WO02/060937 does not lead to the maturation of DCs in vivo.
- In one aspect, the present invention aims therefore to provide a composition that leads to the maturation of DCs.
- Combinations of vectors complexed to an antigen with adjuvants have already been described, as adjuvants are known to favour DCs maturation.
- For example, EP 1078007 described the use of a toxin-antigen conjugate, wherein the toxin is the Shiga toxin B subunit, in combination with KLH for stimulating an immune response.
- In addition, the patent application WO2005/112991 disclosed the use of the B subunit of Shiga Toxin complexed with an antigen and an adjuvant for stimulating an immune response. The adjuvant may be selected from the group consisting of metal salts, oil in water emulsions, Toll like receptors agonists, saponins, lipid A, alkyl glucosaminide phosphate, immunostimulatory oligonucleotide or combinations thereof.
- However, the Applicant observed and confirmed that all combinations of vectors and adjuvant are not equivalent for the induction of CD8+ T cells response. After screening many conventional adjuvants, the inventors found a dramatic synergy between ligands of CD1 capable of stimulating NKT cells and the STxB based vaccine, leading to potent CD8+ T cells response with the use of very low doses of antigen. Vaccines combining STxB and one of said ligands were found to be efficient to break tolerance against self antigen and to elicit anti-viral immunity. Contrary to the teaching of the prior art, this synergy was not observed with all adjuvants. In particular, the Applicant did not observed such a synergy with adjuvants such as IFA (Haicheur et al. JI 2000, 165:3301-3308) and observed a very weak synergy with adjuvants such as IFNα, Poly(I:C), or the Toll like receptor agonist CpG.
- Therefore, an object of the present invention is to provide a composition comprising
- a) a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen and
b) at least one ligand of CD1 capable of stimulating NK T cells. - In one embodiment of the invention, the immunological functional equivalent of the B subunit of Shiga toxin has at least 50% amino acid sequence identity to the B subunit of Shiga toxin.
- In another embodiment of the invention, said ligand of CD1 is a ligand of CD1d.
- In another embodiment of the invention, said ligand of CD1 is a glycolipid or phospholipid, a glycosphingolipid, a derivative or an analog thereof. In a preferred embodiment, said ligand is chosen from iGb3, GD3, PE and PI.
- In another preferred embodiment, said ligand of CD1 is a glycosylceramide or an analog or a derivative thereof. Preferably, said glycosylceramide is selected from the group consisting of α-GalCer, α-GlcCer, Galα1-6Galα1-1′Cer, Galα1-6Glcα1-1′Cer, Galα1-2Galα1-1′Cer, Galβ1-3Galα1-1′Cer or a derivative thereof, preferably a C-glycoside derivative thereof, more preferably a C-glycoside derivative of α-GalCer.
- In one embodiment of the invention, αGalCer is (2S,3S,4R)-1-O-(α-D-galactopyranosyl)-2-(N-hexa-cosanoylamino)-1,3,4-octadecanetriol. In another embodiment, αGalCer is (2S,3S,4S)-1-O-(α-D-galactopyranosyloxy)-2-hexacosanoylamino-3,4-octadecanediol (KRN7000).
- In a preferred embodiment of the invention, said ligand of CD1 is selected from the group consisting of 3-O-sulfo-α-GalCer, β-GalCer, an OCH compound, α-C-GalCer.
- In another embodiment, said ligand of CD1 is a microbe derived glycolipid. Preferably, said ligand is
-
- a Sphingomonas species-derived glycosphingolipid selected in the group consisting of GSL-1 and
GSL′ 1 or - a Borrelia species derived glycolipid selected from the group consisting of BbGL-I and BbGL-II or
- a Mycobacteria species derived phosphoglycolipid PIM.
- a Sphingomonas species-derived glycosphingolipid selected in the group consisting of GSL-1 and
- In one embodiment of the invention, the B subunit of Shiga toxin or the functional equivalent thereof is present in a universal polypeptidic carrier having the formula STxB-Z(n)-Cys, wherein
-
- STxB is the Shiga Toxin B subunit or a functional equivalent thereof,
- Z is an amino-acid devoided of sulfydryl group, n being 0, 1 or a polypeptide,
- Cys is the amino-acid Cysteine.
- In a preferred embodiment, n is 0.
- In a preferred embodiment, the antigen is covalently linked to the —S residue of the universal carrier by a —S—S, or —S—CO, or S—CH2, or —S—NH linkage. In another preferred embodiment, the universal carrier is covalently linked to an oligopeptide or a polypeptide by a —S—S, or —S—CO, or S—CH2, or —S—NH linkage, and the antigen to be targeted is operably linked to the said oligopeptide or polypeptide. In a more preferred embodiment, the universal carrier is covalently linked to a poly-lysine oligopeptide and the antigen to be targeted is operably linked to the said poly-lysine moiety.
- In one embodiment of the invention, the antigen is a tumor antigen, a viral or a bacterial antigen.
- In one embodiment of the invention, the composition as described above further comprises a pharmaceutically acceptable carrier.
- The present invention also aims to provide a medicament comprising a composition as described above.
- Another object of the present invention is a vaccine comprising said composition.
- It is also an object of the present invention to provide a pharmaceutical kit comprising:
- a) a first container comprising a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen and
- b) at least a second container comprising at least one ligand of CD1 capable of stimulating NK T cells.
- The present invention relates to the use of a composition as described above for the manufacture of a pharmaceutical composition or a medicament, including a vaccine, for treating an antigen-related condition in an individual, said antigen-related state being a tumor or an infection.
- In one embodiment, the present invention relates to the use of said composition for treating an antigen-related condition in an individual in need thereof, wherein said composition is to be administrated to said individual in an therapeutically effective amount for stimulating an immune response against the antigen in said individual, thereby treating said antigen-related condition in said individual.
- In another embodiment, the present invention relates to the use of said composition for treating an antigen-related condition in an individual in need thereof, wherein said composition is to be administered in combination with thalidomide or an analog thereof, preferably lenalidomide.
- The present invention also relates to the use of the kit as described above, wherein at least one ligand of CD1 capable of stimulating NK T cells is to be administrated before, simultaneously or after the B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen.
- In one embodiment, the use of the composition as described above leads to the stimulation of the immune response, which comprises stimulating dendritic cells.
- In another embodiment, the use of the composition as described above leads to the stimulation of the immune response, which comprises eliciting an antigen specific CD8 response.
-
FIG. 1 : Role of adjuvants on the levels of anti-OVA257-264 CD8+T cells induced by the STxB-OVA conjugate. Mice were subcutaneously immunized twice (d0 and d21) with STxB-OVA alone (50 μg=0.5 nmol) diluted in PBS or combined with various adjuvants (IFA vol/vol, IFNα 100000 IU d0, d1 and d2, Poly(I:C) (250 d0 and d21), CpG (50 μg, d0 and d21). α-GalCer (2 μg) was only admixed with STxB-OVA on d0. The second immunization was performed with STxB-OVA alone. CD8+T cells from spleen were isolated 7 days after the last immunization and directly stained ex vivo with PE-labeled OVA257-264/kb tetramer and allophycocyanin-labeled anti-CD8 mAb. Values shown correspond to mean±SD obtained with specific tetramer after subtracting values from irrelevant tetramer recognizing a VSV-derived peptide in the context of Kb. These results are representative of three experiments with 4 mice per group. -
FIG. 2 : α-GalCer increases the efficiency of STxB to induce long-lasting and functional specific anti-OVA257-264 CD8+T cells even at very low doses of antigen. Mice were subcutaneously immunized twice (d0 and d21) with various doses of STxB-OVA alone (A Left) or combined with α-GalCer (A right, C, D) or with free ovalbumin admixed with α-GalCer (B). As mentioned in Material and Methods, α-GalCer was only administered during the first immunization. A, B, C: CD8+T cells from spleens were isolated 7 days after the last immunization and directly stained ex vivo with PE-labeled OVA257-264/kb tetramer and allophycocyanin-labeled anti-CD8 mAb. Results shown are gated on CD8+T cells. An irrelevant tetramer recognizing a VSV-derived peptide in the context of Kb and an isotype control mAb were included as controls. These results are representative of three experiments with 4 mice per group. D: Mice were immunized with STxB-OVA (1 μg) mixed with α-GalCer (2 μg). Left: IFNγ producing OVA257-264/Kb specific CD8+T cells were detected ex vivo by an IFNγ ELISPOT assay using EL4 pulsed (▪) or not (□) with the OVA257-264 peptide (SL8). SFC=spot-forming cells were read using an Elispot automated reader system. Right: CTL activity was measured in a standard 4-h 51Cr release assay on the target EL4 cells pulsed with (▪) or without (□) the OVA257-264 peptide at an effector-target E/T ratio of 100/1. Three mice per group were immunized and these experiments were reproduced two times. -
FIG. 3 : α-GalCer also increases the efficiency of STxB-E7 to elicit anti-E7 CTL. Mice were immunized onday 0 and day 21 with STxB-E743-57 (1 μg) alone or mixed with α-GalCer or with the free polypeptide E743-57 mixed with α-GalCer. Seven days after the last immunization, CD8+ T cells from spleen were isolated and directly stained with PE-labeled E749-57/Db tetramer. (Cells were previously gated on CD8+ T cells). An irrelevant tetramer recognizing a LCMV derived peptide in the context of Db was included as controls. These results are representative of two experiments with 3 mice per group. -
FIG. 4 : CD4+T cell and humoral responses after STxB-OVA based vaccine immunization. Left: Mice (n=3 per group) were immunized twice (d0 and d21) with STxB-OVA (0.01 nmol) alone or combined with α-GalCer (2 μg). As control, mice were vaccinated with ovalbumin (0.01 nmol) mixed with IFA. Seven days after the last immunization, CD4+T cells were purified from spleen and labeled with CFSE. They were then incubated with T cell depleted splenocytes as APC pulsed with free ovalbumin protein and cocultured for 5 days in AIM V serum free medium. Proliferation in the absence of APC sensitization was subtracted as background from values obtained after ovalbumin pulsing. These experiments were reproduced two times. Right: One week after the last immunization, serum was collected and anti-OVA IgG2a and IgG2b were measured by ELISA. -
FIG. 5 : Combination of STxB-OVA and α-GalCer enhances the cross-presentation of ovalbumin by dendritic cells. Mice (n=3 per group) were immunized with STxB-OVA alone (1 μg=0.01 nmol) or combined with Poly (I:C) or with α-GalCer (2 μg). Seven days after vaccination, CD11c+ enriched dendritic cells were cocultured with CFSE labeled OT-1 cells for 72 hours. These experiments were reproduced three times with similar results. Dot plots were gated on CFSE labeled CD8+ OT-1 cells. -
FIG. 6 : STxB-OVA combined with α-GalCer primes anti-OVA257-264 CD8+T cells in OVA-TG mice. - OVA-TG mice were immunized with STxB-OVA (0.1 nmol) combined or not with α-GalCer (2 μg). Fourteen days later, CD8+ T cells from spleen were isolated and directly stained with PE-labeled OVA257-264/Kb tetramer and APC-labeled anti-CD8 mAb. Each square represents values from individual mice and corresponds to results obtained with specific OVA257-264/Kb tetramer after subtracting the values obtained with an irrelevant tetramer recognizing a VSV derived peptide in the context of Kb. Two series of experiments were performed with similar results.
-
FIG. 7 : STxB-OVA combined with α-GalCer induce anti-viral protective immunity against a challenge with rVV-OVA. Mice (5 mice per group) were injected twice (d0 and d21) intraperitoneally (200 μl) either with B-OVA alone (0.05 nmol=5 μg), or B-OVA (0.05 nmol) combined with α-GalCer, or OVA (0.05 nmol) mixed with α-GalCer and control mice were injected with PBS. Similarly to the previous experiments, α-GalCer was not added during the second immunization. Eight days after the last injection mice were challenged intraperitoneally with 2.5×106 PFU recombinant vaccina virus (rVV-OVA, Westerns Reserve strains) expressing ovalbumin cDNA. After 4 days, ovaries were assayed for rVV titers by plaque assay on BHK 21 cells. Results represent mean of pfu from 6 mice per group. P values were calculated by a Student't test. -
FIG. 8 : No adjuvant effect of α-GalCer in mice deficient in NKT cells. Ja18−/− mice were immunized with STxB-OVA (1 μg) or STxB-OVA+α-GalCer (2 μg). 7 days after immunization, the spleens of immunized and non-immunized mice were harvested and stained with anti-CD8 antibody and OVA257-264/Kb tetramer. -
FIG. 9 : Vaccination with αGalCer combined with STxB-Ova induces protection against established tumors. C57BL6 mice were grafted with EG7 tumor and three days after were vaccinated with PBS, STxB-OVA, α-GalCer, or STxB-OVA+α-GalCer. - By “individual”, it is meant mammal, in particular a human being.
- By “effective amount”, it is meant an amount sufficient to effect a beneficial or desired clinical result (e.g. improvement in clinical condition).
- As used herein, “treatment” or “treating” generally refers to a clinical intervention in an attempt to alter the natural course of the individual or cell being treated, and may be performed either for prophylaxis or during the course of clinical pathology. Desirable effects include, but are not limited to, preventing occurrence or recurrence of disease, alleviating symptoms, suppressing, diminishing or inhibiting any direct or indirect pathological consequences of the disease, preventing metastasis, lowering the rate of disease progression, ameliorating or palliating the disease state, and causing remission or improved prognosis.
- The term “NKT cells” or “natural killer cell” is known in the art, and as used herein, refers to a T cell population that causes, stimulates or contributes to cytokine production, and/or in another embodiment, is cytotoxic. NKT cells are characterised by expression of both a T cell antigen receptor (TCR) and NK cell marker (i.e. NK 1.1, a C-lectin-type NK receptor, DX5, Ly49 receptors in mice and NKR-P1A in human).
- The term “Th1 cytokine” is known in the art and as used herein, refers to cytokine elicited by T helper cells as part of the adaptative immune response. Typically, Th1 cytokines are interleukin-2 or interferon-γ for example.
- The term “Th2 cytokine” is known in the art, and as used herein, refers to cytokine elicited by T helper cells as part of the adaptative immune response. Typically, Th2 cytokine are interleukine-4 or interleukine-10, for example.
- The term “dendritic cell” (DC) is known in the art, and as used herein, refers to antigen-presenting cells, which are capable of presenting antigen to T cells.
- The term “mature dendritic cells” is known in the art, and as used herein, refers to a population of dendritic cells with diminished CD115, CD14, CD68 or CD32 expression, or a population of dendritic cells with enhanced CD86 expression, or a combination thereof.
- The term “stimulating an immune response” as used herein refers to the initiation of an immune response against an antigen of interest in an individual in which an immune response against said antigen has not already been initiated or refers to any improvement in an immune response that has already been mounted by an individual. It is to be understood that reference to the stimulation of the immune response may involve both the humoral and cell-mediated arms of the immune system. In one embodiment; stimulation of the immune response resulting in the stimulation of the humoral immune response may be reflected by an increase in antibody production and a TH2 cytokine profile (IL-4, 11-5, IL-6 . . . ) which can be determined by any means known in the art, such as for example by ELISA. In another embodiment, stimulation of the immune response resulting in the stimulation of the cell-mediated response may be reflected by an increase in IFN-γ or IL-12, or both, which may be similarly determined. In another embodiment, stimulating the immune response is associated with a change in cytokine expression. Such change may be readily measured by any means well-known in the art, such as ELISA, Western-Blot analysis, PCR analysis, and others.
- The term “antigen” is known in the art, and as used herein, refers to any agent (protein, peptide, polysaccharide, glycoprotein, glycolipid, nucleic acid, or combination thereof), which elicits an immune response when introduced into a host and those which are able to elicit an immune response when complexed with the B subunit of Shiga toxin according to the invention. The term “antigen epitope” includes fragments of proteins capable of determining antigenicity. For example, antigens include proteins and other molecules which are specifically associated with surfaces of particular types of cancer cells, i.e. tumour cells. Alternatively, antigens may be associated with the surfaces or secretion products of micro-organisms or pathogens. The term “pathogen” is meant to include organisms that cause disorders, such disorders produced by one or more particular species of bacteria, viruses, fungi and protozoans which are disease-producing organisms.
- The term “antigen-related state” or “antigen-related condition” as used herein refers to micro-organism or pathogenic infections, allergen associated states or refers to the presence of a tumour.
- The term “adjuvant” as used herein refers to a compound or a mixture that may be non-immunogenic when administered in the host alone, but that augments the host's immune response to an antigen when administered conjointly with that antigen.
- The term “vaccine” as used herein refers to a composition that can be used to elicit protective immunity in a recipient. According to the present invention, a vaccine is a medicament.
- The present invention relates to a composition comprising
- a) a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen and
- b) at least one ligand of
CD 1 capable of stimulating NK T cells. - The B subunit of Shiga toxin is secreted by Shigella dysenteriae. This homopentamer is responsible for toxin binding to and internalisation into target cells by interacting with the glycolipid Gb3 found in the plasma membrane of these cells. The B subunit of Shiga toxin has the sequence described in NA Strockbine et al. J Bacteriol 1988, 170, 1116-22.
- A functional equivalent of the B subunit of Shiga toxin means a polypeptidic sequence having the capacity to bind specifically to the Gb3 receptor and/or to trigger an internalisation of an antigen and its presentation in an MHC class I restricted pathway, or both MHC class I and class II on the same antigen presenting cell.
- Additionally, functional equivalents of the B subunit of Shiga toxin include homologous toxins, which are able to bind the Gb3 receptor, from other bacteria. For example, the B subunits of verotoxin-1 or verotoxin-2 from E Coli are also known to bind the Gb3 receptor. In the context of the present invention, the term “toxin” is intended to mean toxins that have been detoxified such that they are no longer toxic to humans, or a toxin subunit or fragment thereof that are substantially devoid of toxic activity in humans.
- In one embodiment of the present invention, the functional equivalent of the B subunit of Shiga toxin has at least 50%, and preferably 60, 70, 80, 90 or 95%, amino acid identity to the B subunit of Shiga toxin.
- The capacity of polypeptidic sequence to bind specifically to the Gb3 receptor may be evaluated by the following assay which is based on the method described by Tarrago-Trani (Protein extraction and purification 39, pp 170-176, 2004) and involves an affinity chromatography on a commercially available galabiose-linked agarose gel (Calbiochem). Galabiose (Gala1-4Gal) is the terminal carbohydrate portion of the oligosaccharide moiety of Gb3 and is thought to represent the minimal structure recognized by the B subunit of Shiga toxin. The protein of interest in PBS buffer (500 μl) is mixed with 100 μl of immobilized galabiose resin previously equilibrated with the same buffer, and incubated for 30 min to 1 hour at 4° C. on a rotating wheel. After a first centrifugation at 5000 rpm for 1 min, the pellet is washed twice with PBS. The bound material is then eluated twice by re-suspending the final pellet in 2×500 μl of 100 mM glycine pH 2.5. Samples corresponding to the flow-through, the pooled washes and the pooled eluates are then analysed by SDS Page, Coomassie staining and Western blotting.
- CD1 molecules are a family of highly conserved antigen presenting proteins that are similar to in function to classical MHC molecules. CD1 proteins bind and display a variety of lipids and glycolipids to T lymphocytes. The five known isoforms are classified into two groups, group 1 (CD1a, CD1b, CD1c and CD1e in humans) and group II (CD1d in humans and mice).
- In one embodiment, the ligand of CD1 present in the composition of the invention is a ligand of CD1d.
- Certain ligands of CD1 molecule, when bound, stimulate NKT cells: for example they stimulate rapid Th1 and Th2 cytokine production by NKT cells.
- In one embodiment of the present invention, said ligand induces Th1 and Th2 cytokine production, such as IL-4 and IFN-γ. Such cytokine production may be readily measured by any means well-known in the art, such as ELISA or by flow cytometry for example. In another embodiment, said ligand induces an increase in the expression of CD25, CD69 or Fas Ligand molecules, or an increase in the production of perforin. Such increase may be measured by any means well-known in the art, such as flow-cytometry for example.
- In one embodiment of the present invention, said ligand of CD1 capable of stimulating NKT cells is a glycolipid, a phospholipid, a glycosphingolipid, a derivative or an analog thereof.
- Glycosphingolipids are complex glycolipids which contain ceramide as an extra-lipid component. For example, Kirin Pharmaceutical in Japan identified several glycosphingolipids compounds, named agelasphins, from an extract of the Okinawan marine sponge, Agela mauritianus (Natori et al. Tetrahedron 1994, 50:2771-2784).
- Other examples of glycolipid are: the lysosomal glycosphingolipid, isoglobotrihexosylceramide iGB3 (Zhou et al. Science 2004, 306:1786-1789); the disialoganglioside GD3 (Wu et al., J. Exp. Med. 2003, 198:173-181); the phosphatidylinositol PI (Gumperz et al. Immunity 2000, 12:211-221) and the phosphatidylethanolamine PE (Rauch et al. J. Bioch. Chem 2003, 278:47508-47515).
- In one embodiment of the invention, said ligand is chosen from GD3, PE and PI.
- In one embodiment of the present invention, said ligand is the sphingolipid as described in the U.S. Pat. No. 5,780,441, said sphingolipid having the following formula:
- Wherein R1 represents H or
- R2 represents H,
- R3 and R6 represent H or OH, respectively;
- R4 represents H, OH or
- R5 represents H or
- X denotes an integer from 19 to 23; and R7 represents any one of the following groups (a)-(g):
- (a) —(CH2)11—CH3,
- (b) —(CH2)12—CH3,
- (c) —(CH2)13—CH3,
- (d) —(CH2)9—CH(CH3)2,
- (e) —(CH2)10—CH(CH3)2,
- (f) —(CH2)11—CH(CH3)2,
- (g) —(CH2)11—CH(CH3)—C2H5,
- wherein at least one of R1, R2, R4 and R5 is a glycosyl moiety.
- In another embodiment of the present invention, said ligand is an α-galactosylceramide as described in the U.S. Pat. No. 5,936,076, said α-galactosylceramide having the following formula:
- wherein R represents
- where R2 represents H or OH and X denotes an integer of 0-26 or R represents (CH2)7CH═CH(CH2)7CH3 and
- R1 represents any one of the substituents defined by the following (a)-(e):
- (a) —CH2(CH2)yCH3,
- (b) —CH(OH)(CH2)2CH3,
- (c) —CH(OH)(CH2)yCH(CH3)2,
- (d) —CH═CH(CH2)yCH3, and
- (e) —CH(OH)(CH2)yCH(CH3)CH2CH3,
- wherein Y denotes an integer of 5-17.
- In another embodiment of the present invention, said ligand is an α-galactosylceramide as described in the U.S. Pat. No. 6,555,372, said α-galactosylceramide having the following formula:
- wherein R1 represents H or OH, X represents an integer between 7 and 27, R2 represents a substituent selected from the group consisting of the following (a) to (e) (wherein Y represents an integer between 5 and 17):
- (a) —CH2(CH2)YCH3
- (b) —CH(OH)(CH2)YCH3
- (c) —CH(OH)(CH2)YCH(CH2)2
- (d) —CH═CH(CH2)Y(CH3)
- (e) —CH(OH)(CH2)YCH(CH3)CH2CH3,
- and R3 to R9 represent substituents as defined in any one of the following i) and ii):
- i) when R3, R6 and R8 represent H, R4 represents H, OH, NH2, NHCOCH3, or a substituent selected from the group consisting of the following groups (A) to (D):
- R5 represents OH or a substituent selected from the group consisting of the following groups (E) and (F):
- R7 represents OH or a substituent selected from the group consisting of the following groups (A) to (D):
- R9 represents H, CH3, CH2OH or a substituent selected from the group consisting of the following groups (A′) to (D′):
- ii) when R3, R6 and R7 represent H, R4 represents H, OH, NH2, NHCOCH3, or substituent selected from the group consisting of the following groups (A) to (D):
- R5 represents OH or a substituent selected from the group consisting of groups (E) and (F):
- R8 represents OH or a substituent selected from the group consisting of the following groups (A) to (D):
- R9 represents H, CH3, CH2OH or a substituent selected from the group consisting of the following groups (A′) to (D′):
- or a salt or solvate thereof.
- In a preferred embodiment of the present invention; said ligand is the compound KRN7000, having the following formula: (2S,3S,4S)-1-(α-D-galactopyranosyloxy)-2-hexacosanoymamino-3,4-octadecanediol.
- In another embodiment of the present invention, said ligand is a glycolipid derivative as described in the patent application US2002/0032158, said glycolipid derivative having the following formula:
- wherein W represents carbone chain from 9 to 17 which containing double bond or hydroxy group occasionally; X represents carbone chain from 11 to 25 which containing double bond or hydroxy group occasionally; Y represents —(CH2)a—CH═CH—(CH2)a—, —(CH2)a— (a, a′ denotes an integer of 0-5 and a+a′ is 5 and under.), —S(O)0-2CH2—, —NHCH2; Z represents —CO—, —SO2; R represents —CH2OH, —CO2H, —CH2OCH2CO2H, —CH2OSO3H; R0 represents —OH, —NH2, —NHAc.
- In another embodiment of the present invention, said ligand is a glycosylceramide as described in the patent application US2003/0157135, said glycosylceramide having the following formula:
- wherein R1, R2 and R5 represent H or a specific monosaccharide; R3 and R6 represent H or OH, respectively; R4 represents H, OH or a specific monosaccharide; X denotes an integer from 1 to 23; R7 represents any one of the following groups (a)-(g):
- (a) —(CH2)11—CH3,
- (b) —(CH2)12—CH3,
- (c) —(CH2)13—CH3,
- (d) —(CH2)9—CH(CH3)2,
- (e) —(CH2)10—CH(CH3)2,
- (f) —(CH2)11—CH(CH3)2,
- (g) —(CH2)11—CH(CH3)—C2H5.
- In a preferred embodiment, said ligand is a glycosylceramide or an analog or a derivative thereof.
- In a more preferred embodiment, said ligand is selected from the group consisting of α-galactosylceramide (α-GalCer), α-glucosylceramide (α-GlcCer), Galα1-6Galα1-1′Cer, Galα1-6Glcα1-1′Cer, Galα1-2Galα1-1′Cer, Galβ1-3Galα1-1′Cer or a derivative thereof, preferably a C-glycoside derivative thereof, more preferably a C-glycoside derivative of α-GalCer.
- In another preferred embodiment, said ligand has the following formula (2S,3S,4R)-1-O-(α-D-galactopyranosyl)-2-(N-hexa-cosanoylamino)-1,3,4-octadecanetriol.
- In another embodiment, said ligand has the following formula (2S,3S,4S)-1-O-(α-D-galactopyranosyloxy)-2-hexacosanolamino-3,4-octadecanediol (KRN7000).
- In another embodiment, said ligand is an α-GalCer analog, called α-C-GalCer, as described in the patent application US2004/0127429, said ligand having the following formula:
- wherein X is O or NH; R1 is selected from the group consisting of —(CH2)11CH3, —(CH2)12CH3, —(CH2)13CH3, —(CH2)9CH(CH3)2, —(CH2)10CH(CH3)2, —(CH2)11 CH(CH3)2 and (CH2)11CH(CH2)—C2H5;
- R3 is OH or a monosaccharide and R4 is hydrogen, or R3 is hydrogen and R4 is OH or a monosaccharide;
- R5 is hydrogen or a monosaccharide;
- Q1 is optionally present and is a C1-10 straight or branched chain alkylene, alkenylene, or alkynylene;
- X″ is optionally present and is O, S or NR8;
- Q2 is optionally present and is a C1-10 straight or branched chain alkylene, alkenylene or alkynylene;
- X″ is optionally present and is O, S or NR8;
- Q3 is a straight or branched chain C1-10 alkylene, alkenylene or alkynylene, or is hydrogen, wherein each Q′, Q2 or Q3 is optionally substituted with hydroxyl, halogen, cyano, nitro, SO2 NHR8, or C(═O)—R9; and wherein
- R8 is hydrogen, C1-5 alkyl, C1-5 alkoxy, halogen, cyano, nitro, SO2 or C(═O)—R9;
- R9 is hydrogen, C1-5 alkyl, C1-5 alkoxy or NHR10;
- R10 is hydrogen, C1-5 alkyl or C1-5 alkoxy;
- and a pharmaceutically acceptable salt or ester thereof.
- In another embodiment, said ligand is PBS-57, which structure was described by Liu et al. Journal of Immunological Methods, 312 (2006) 34-39.
- In another embodiment, said ligand is a C-glycolipid, as described in the patent application US2005/0222048, having the following formula:
- wherein X is O or NH; R3 is OH or a monosaccharide and R4 is hydrogen, or R3 is hydrogen and R4 is OH or a monosaccharide; R5 is hydrogen or a monosaccharide; and pharmaceutically acceptable salts or esters thereof.
- In another embodiment of the present invention, said ligand is an immunogenic compound as described in the patent application US2006/0211856, having the following formula:
- wherein, R═COOR1 or CH2OR1;
- R1=H or an alkyl group;
- R2=H or SO3 −;
- R3=H or OH;
- R3′=H or OH;
- R4′=H, unsaturated or saturated, alkyl group; unsaturated or saturated, alkyl group; and
- R5=0H, acetamido or a halogen atom;
- or a pharmaceutically acceptable salt thereof,
- wherein if R═CH2OR1, R2═H, R3′, is OH and R3 is H, then R5=acetamido, halogen atom or OH in an axial position or R4═H, unsaturated or saturated, alkyl chain having 9 carbon atoms or fewer, or R4′=H, unsaturated or saturated, alkyl chain having 20 carbon atoms or fewer.
- In a preferred embodiment of the present invention, said ligand is selected from 3-O-sulfo-α-GalCer, β-GalCer, an OCH compound, α-C-GalCer.
- The OCH compound is described in the patent application US2006/0148723, and has the following formula:
- wherein, R1 is an aldopyranose group, R2 is a hydrogen atom or a hydroxyl group, R3 is —CH2—, —CH(OH)—CH2— or —CH═CH—, R4 is a hydrogen atom or CH3, x is 0-35, y and z represent integers satisfying y+z=0-3.
- α-C-GalCer has been described above. 3-O-sulfo-α-GalCer is a sulfatide variant of α-GalCer and has been described in the article Wu et al. (Wu et al. PNAS 2005, 102:1352-1356).
- In another embodiment of the present invention, said ligand is a microbe derived glycolipid.
- In a preferred embodiment, said ligand is
-
- a Sphingomonas species-derived glycosphingolipid selected in the group consisting of GSL-1 and GSL′1 or
- a Borrelia species derived glycolipid selected from the group consisting of BbGL-I and BbGL-II or
- a Mycobacteria species derived phosphoglycolipid PIM.
- In one embodiment of the present invention, the composition of the invention comprises the B subunit of Shiga toxin, or the functional equivalent thereof, present in a universal polypeptidic carrier having the formula STxB-Z(n)-Cys, wherein
-
- STxB is the Shiga Toxin B subunit or a functional equivalent thereof,
- Z is an amino-acid devoided of sulfydryl group, n being 0, 1 or a polypeptide,
- Cys is the amino-acid Cysteine.
- This universal carrier has been described in the patent application WO02/060937.
- The STxB moiety of the universal carrier has the sequence described in NA Strockbine et al. J Bacteriol 1988, 170, 1116-22, or a functional equivalent thereof.
- In a preferred embodiment, n is 0 and the universal carrier has the following sequence
-
(SEQ ID NO: 1): COOH-MKKTLLIAASLSFFSASALATPDCVTGKVE YTKYNDDDTFTVKVGDKELF TNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFRC-NH2. - As a matter of fact, if the Z linker is too long, i.e. when n is equal or greater than 2, some internal disulfide bridges might occur, and prevent either the binding of STxB to Gb3 receptor.
- In another embodiment of the invention, the antigen is to be targeted to antigen presentating cells. Such cells are selected in a group comprising T lymphocytes, dendritic cells, macrophages, Langerhans cells and the like.
- The coupling approaches for covalent binding of an antigen to STxB-Z (n)-Cys can be any method or processes described or carried out by a skilled person.
- A first method that can be embodied is the use of SPDP hetero-bi-functional cross-linker described par Carlsson et al (5). However, SPDP is capable of being cleavable by serumthiolases that is a cause of decreasing the yield of the reaction.
- A second method for covalent coupling of STxB-Z (n)-Cys peptides with an antigen is to produce bromoacetyl or maleimide functions on the latter as described by P. Schelte et al (4).
- Briefly, the antigen is chemically activated with bromoacetate anhydride or by a maleimide group respectively. In appropriate reaction conditions (pH, temperature, incubation times), these groups are eliminated by cis-elimination, yielding respectively to —S—S, —S—CH2-, to —S—CO- or S—NH-covalent linkages.
- As an example, the antigen to be coupled to the —SH moiety the C-terminal Cysteine of the universal carrier, has its N-terminus activated with bromoacetic anhydride following the reaction scheme:
-
Br—CH2-CO—O—CO—CH2-Br+NH2-antigen=>Br—CH2-CO—NH-antigen+Br—CH2-COOH - The Bromoacetyl function has high chemoselectivity for peptide thiol groups and the activated peptide can be reacted with STxB-Cys as follows:
-
STxB-Cys-SH+Br—CH2-CO—NH-antigen=>STxB-Cys-S—CH2-CO—NH-antigen+HBr - The resulting thioether-linkage is stable to hydrolysis.
- Another method for coupling an antigen to the universal carrier of the invention is to use MBS (m-Maleimidobenzoyl-N-hydroxysuccinimide ester).
- This coupling allows the transport and processing of large molecules such antigenic proteins or glycoproteins through MHC class I and/or MHC class 11 pathways.
- Thus, in one embodiment of the invention, the antigen is covalently linked to the —S residue of the universal carrier by a —S—S, or —S—CO, or S—CH2, or —S—NH linkage.
- In another embodiment, the universal carrier according to the present invention can be operably linked directly through a covalent binding or indirectly through a linker.
- The term “indirect binding” means that the universal carrier is covalently linked through the sulfhydryl moiety of the C-terminal Cysteine to a linker, said linker being operably linked to an antigen to be internalized into Gb3 receptor bearing cells.
- This linkage might be a covalent binding or a non-covalent binding, provided that the affinity between the linker and the antigen is higher than 10−9 mole/1.
- Thus, the universal carrier is covalently linked to an oligopeptide or a polypeptide by a —S—S, or —S—CO, or S—CH2, or —S—NH linkage, and the antigen to be targeted is operably linked to the said oligopeptide or polypeptide. In a preferred embodiment, the universal carrier is covalently linked to a poly-lysine oligopeptide and the antigen to be targeted is operably linked to the said poly-lysine moiety.
- In one embodiment of the present invention, the antigen complexed to the B subunit of Shiga toxin is a tumor antigen, a viral antigen or a bacterial antigen.
- In a preferred embodiment, the antigen is selected such that it provides immunity against intracellular pathogens such as HIV, tuberculosis, Chlamydia, HBV, HCV and influenza. Preferably, the antigen is derived from HIV (such as gag or fragments thereof, such as p24, tat, nef, envelope such as gp120 or gp160, or fragments of any of these), human herpes viruses, such as gD or derivatives thereof or Immediate Early protein such as ICP27 from HSV1 or HSV2, cytomegalovirus ((esp Human) (such as gB or derivatives thereof), Rotaviral antigen, Epstein Barr virus (such as gp350 or derivatives thereof), Varicella Zoster Virus (such as gp1, 11 and 1E63), or from a hepatitis virus such as hepatitis B virus (for example Hepatitis B Surface antigen or a derivative thereof), or antigens from hepatitis A virus, hepatitis C virus and hepatitis E virus, or from other viral pathogens, such as paramyxoviruses: Respiratory Syncytial virus (such as F G and N proteins or derivatives thereof), parainfluenza virus, measles virus, mumps virus, human papilloma viruses (for example HPV 6, 11, 16, 18,) flaviviruses (e.g. Yellow Fever Virus, Dengue Virus, Tick-borne encephalitis virus, Japanese Encephalitis Virus) or Influenza virus purified or recombinant proteins thereof, such as HA, NP, NA, or M proteins, or combinations thereof), or derived from bacterial pathogens such as Neisseria spp, including N. gonorrhea and N. meningitidis (for example, transferrin-binding proteins, lactoferrin binding proteins, PiIC, adhesins); S. pyogenes (for example M proteins or fragments thereof, C5A protease,), S. agalactiae, S. mutans; H. ducreyi; Moraxella spp, including M catarrhalis, also known as Branhamella catarrhalis (for example high and low molecular weight adhesins and invasins); Bordetella spp, including B. pertussis (for example pertactin, pertussis toxin or derivatives thereof, filamenteous hemagglutinin, adenylate cyclase, fimbriae), B. parapertussis and B. bronchiseptica; Mycobacterium spp., including M. tuberculosis (for example ESAT6, Antigen 85A, -B or -C), M. bovis, M. leprae, M. avium, M. paratuberculosis, M. smegmatis; Legionella spp, including L. pneumophila; Escherichia spp, including enterotoxic E. coli (for example colonization factors, heat-labile toxin or derivatives thereof, heat-stable toxin or derivatives thereof), enterohemorragic E. coli, enteropathogenic E. coli Vibrio spp, including V. cholera (for example cholera toxin or derivatives thereof); Shigella spp, including S. sonnei, S. dysenteriae, S. flexnerii; Yersinia spp, including Y. enterocolitica (for example a Yop protein), Y. pestis, Y. pseudotuberculosis; Campylobacter spp, including C. jejuni (for example toxins, adhesins and invasins) and C. coli; Salmonella spp, including S. typhi, S. paratyphi, S. choleraesuis, S. enteritidis; Listeria spp., including L. monocytogenes; Helicobacter spp, including H. pylori (for example urease, catalase, vacuolating toxin); Pseudomonas spp, including P. aeruginosa; Staphylococcus spp., including S. aureus, S. epidermidis; Enterococcus spp., including E. faecalis, E. faecium; Clostridium spp., including C. tetani (for example tetanus toxin and derivative thereof), C. botulinum (for example botulinum toxin and derivative thereof), C. difficile (for example clostridium toxins A or B and derivatives thereof); Bacillus spp., including B. anthracis (for example botulinum toxin and derivatives thereof); Corynebacterium spp., including C. diphtheriae (for example diphtheria toxin and derivatives thereof); Borrelia spp., including B. burgdorferi (for example OspA, OspC, DbpA, DbpB), B. garinii (for example OspA, OspC, DbpA, DbpB), B. afzelii (for example OspA, OspC, DbpA, DbpB), B. andersonii (for example OspA, OspC, DbpA, DbpB), B. hermsii; Ehrlichia spp., including E. equi and the agent of the Human Granulocytic Ehrlichiosis; Rickettsia spp, including R. rickettsii; Chlamydia spp., including C. trachomatis (for example MOMP, heparin-binding proteins), C. pneumoniae (for example MOMP, heparin-binding proteins), C. psittaci; Leptospira spp., including L. interrogans; Treponema spp., including T. pallidum (for example the rare outer membrane proteins), T. denticola, T. hyodysenteriae; or derived from parasites such as Plasmodium spp., including P. falciparum; Toxoplasma spp., including T. gondii (for example SAG2, SAGS, Tg34); Entamoeba spp., including E. histolytica; Babesia spp., including B. microti; Trypanosoma spp., including T. cruzi; Giardia spp., including G. lamblia; Leshmania spp., including L. major; Pneumocystis spp., including P. carinii; Trichomonas spp., including T. vaginalis; Schisostoma spp., including S. mansoni, or derived from yeast such as Candida spp., including C. albicans; Cryptococcus spp., including C. neoformans.
- Other preferred specific antigens for M. tuberculosis are for example Tb Ra12, Tb H9, Tb Ra35, Tb38-1, Erd 14, DPV, MTI, MSL, mTTC2 and hTCC1 (WO 99/51748).
- Proteins for M. tuberculosis also include fusion proteins and variants thereof where at least two, preferably three polypeptides of M. tuberculosis are fused into a larger protein. Preferred fusions include Ra12-TbH9-Ra35, Erd14-DPV-MTI, DPV-MTI-MSL, Erd14-DPV-MTI-MSL-mTCC2, Erd14-DPV-MTI-MSL, DPV-MTI-MSL-mTCC2, TbH9-DPV-MTI (WO 99/51748).
- Most preferred antigens for Chlamydia include for example the High Molecular Weight Protein (HMW) (WO 99/17741), ORF3 (EP 366 412), and putative membrane proteins (Pmps). Other Chlamydia antigens of the vaccine formulation can be selected from the group described in WO 99/28475.
- Preferred bacterial antigens are derived from Streptococcus spp, including S. pneumoniae (for example, PsaA, PspA, streptolysin, choline-binding proteins) and the protein antigen Pneumolysin (Biochem Biophys Acta, 1989, 67, 1007; Rubins et al., Microbial Pathogenesis, 25, 337-342), and mutant detoxified derivatives thereof (WO 90/06951; WO 99/03884). Other preferred bacterial vaccines comprise antigens derived from Haemophilus spp., including H. influenzae typeB, non typeable H. influenzae, for example OMP26, high molecular weight adhesins, P5, P6, protein D and lipoprotein D, and fimbrin and fimbrin derived peptides (U.S. Pat. No. 5,843,464) or multiple copy varients or fusion proteins thereof.
- Derivatives of Hepatitis B Surface antigen are well known in the art and include, inter alia, those PreS1, PreS2 S antigens set forth described in European Patent applications EP-A-414 374; EP-A-0304 578, and EP 198-474.
- In another embodiment, the antigen is derived from the Human Papilloma Virus (HPV) considered to be responsible for genital warts (HPV 6 or HPV 11 and others), and the HPV viruses responsible for cervical cancer (HPV16, HPV18. and others). Particularly preferred forms of genital wart prophylactic, or therapeutic, vaccine comprise L1 protein, and
fusion 5, proteins comprising one or more antigens selected from the HPV proteins E1, E2, E5, E6, E7, L1, and L2. The most preferred forms of fusion protein are: L2E7 as disclosed in WO 96/26277, and proteinD(1/3)-E7 disclosed in WO99/10375. A preferred HPV cervical infection or cancer, prophylaxis or therapeutic vaccine, composition may compriseHPV 16 or 18 antigens. Particularly preferredHPV 16 antigens comprise the early proteins E6 or E7 in fusion with a protein D carrier to form Protein D-E6 or E7 fusions fromHPV 16, or combinations thereof; or combinations of E6 or E7 with L2 (WO 96/26277). Alternatively theHPV 16 or 18 early proteins E6 and E7, may be presented in a single molecule, preferably a Protein D-E6/E7 fusion. Such vaccine may optionally contain either or both E6 and E7 proteins from HPV 18, preferably in the form of a Protein D-E6 or Protein D-E7 fusion protein or Protein D E6/E7 fusion protein. - Antigens may also derived from parasites that cause Malaria, for example, antigens from Plasmodia falciparum including circumsporozoite protein (CS protein), RTS, S, MSP1, MSP3, LSA1, LSA3, AMA1 and TRAP. RTS is a hybrid protein comprising substantially all the C-terminal portion of the circumsporozoite (CS) protein of P. falciparum linked via four amino acids of the preS2 portion of Hepatitis B surface antigen to the surface (S) antigen of hepatitis B virus. Its full structure is disclosed in International Patent Application No. PCT/EP92/02591, published under Number WO 93/10152 claiming priority from UK patent application No. 9124390.7. When expressed in yeast RTS is produced as a lipoprotein particle, and when it is co-expressed with the S antigen from HBV it produces a mixed particle known as RTS, S. TRAP antigens are described in International Patent Application No. PCT/GB89/00895, published under WO 90/01496. Plasmodia antigens that are likely candidates to be components of a multistage Malaria vaccine are P. falciparum MSP1, AMA1, MSP3, EBA, GLURP, RAP1, RAP2, Sequestrin, PfEMP1, Pf332, LSA1, LSA3, STARP, SALSA, PfEXP1, Pfs25, Pfs28, PFS27/25, Pfs16, Pfs48/45, Pfs230 and their analogues in Plasmodium spp.
- Examples of tumor antigens include
MAGE 1 andMAGE 3 or other MAGE antigens (for the treatment of melanoma), PRAME, BAGE, or GAGE (Robbins and Kawakami, 1996, Current Opinions inImmunology 8, pps 628-636; Van den Eynde et al., International Journal of Clinical & Laboratory Research (submitted 1997); Correale et al. (1997), Journal of the National Cancer Institute 89, p293. Indeed these antigens are expressed in a wide range of tumour types such as melanoma, lung carcinoma, sarcoma and bladder carcinoma. Other tumour-specific antigens include, but are not restricted to tumour-specific gangliosides, Prostate specific antigen (PSA) or Her-2/neu, KSA (GA733), PAP, mammaglobin, MUC-1, carcinoembryonic antigen (CEA). Other tumour-associated antigen comprise Prostate-specific membrane antigen (PSMA), Prostate Stem Cell Antigen (PSCA), tyrosinase, survivin, NY-ES01, prostase, PS108 (WO 98/50567), RAGE, LAGE, HAGE. Additionally said antigen may be a self peptide hormone such as whole length Gonadotrophin hormone releasing hormone (GnRH, WO 95/20600), a short 10 amino acid long peptide, useful in the treatment of many cancers, or in immunocastration. - In a preferred embodiment of the invention, the antigen complexed to the B subunit of Shiga toxin is chosen among E6, E7, antigens from the Mage family, Her2/neu, EGFRVIII, survivin, telomerase, WT1 and ESAT6.
- In one embodiment of the present invention, the composition above described further comprises a pharmaceutically acceptable carrier.
- In one embodiment, the compositions of the present invention are formulated as oral or parenteral dosage forms, such as uncoated tablets, coated tablets, pills, capsules, powders, granulates, dispersions or suspensions. In another embodiment, the compositions of the present invention are formulated for intravenous administration. In another embodiment, the compounds of the present invention are formulated in ointment, cream or gel form for transdermal administration. In another embodiment, the compounds of the present invention are formulated as an aerosol or spray for nasal application. In another embodiment, the compositions of the present invention are formulated in a liquid dosage form. Examples of suitable liquid dosage forms include solutions or suspensions in water, pharmaceutically acceptable fats and oils, alcohols or other organic solvents, including esters, emulsions, syrups or elixirs, solutions and/or suspensions.
- Suitable excipients and carriers may be, according to embodiments of the invention, solid or liquid and the type is generally chosen based on the type of administration being used. Liposomes may also be used to deliver the composition. Examples of suitable solid carriers include lactose, sucrose, gelatin and agar. Oral dosage forms may contain suitable binders, lubricants, diluents, disintegrating agents, coloring agents, flavoring agents, flow-inducing agents, and melting agents. Liquid dosage forms may contain, for example, suitable solvents, preservatives, emulsifying agents, suspending agents, diluents, sweeteners, thickeners, and melting agents Parenteral and intravenous forms should also include minerals and other materials to make them compatible with the type of injection or delivery system chosen. Of course, other excipients may also be used.
- There is also an object of the present invention to provide a medicament comprising the composition of the invention.
- Another object of the present invention is to provide a vaccine comprising said composition.
- The amount of antigen in each vaccine dose is selected as an amount which induces an immunoprotective response without significant, adverse side effects in typical vaccines.
- Generally, it is expected that each human dose will comprise 0.1-1000 μg of antigen, preferably 0.1-500 μg, preferably 0.1-100 μg, most preferably 0.1 to 50 μg. An optimal amount for a particular vaccine can be ascertained by standard studies involving observation of appropriate immune responses in vaccinated subjects. Following an initial vaccination, subjects may receive one or several booster immunisations adequately spaced. Such a vaccine formulation may be applied to a mucosal surface of a mammal in either a priming or a boosting vaccination regime; or alternatively be administered systemically, for example via the transdermal, subcutaneous or intramuscular routes. Intramuscular administration is preferred.
- Another object of the present invention is a pharmaceutical kit comprising:
- a) a first container comprising a B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen as described above and
- b) at least a second container comprising at least one ligand of CD1 capable of stimulating NK T cells as described above.
- Preferably, said ligand of CD1 is a ligand of CD1d. More preferably, said ligand is chosen among all ligands cited above.
- Another object of the present invention is to provide a process for the preparation of said composition wherein the B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen is mixed with at least one ligand of
CD 1 capable of stimulating NK T cells. - The formulations of the present invention may be used for both prophylactic and therapeutic purposes.
- A further object of the present invention is therefore the use of the composition as described above for the manufacture of a pharmaceutical composition or a medicament, including a vaccine, for treating an antigen-related condition in an individual, said antigen-related condition being a tumor or an infection.
- In a preferred embodiment, the composition as described above is used for the manufacture of a pharmaceutical composition or medicament, including a vaccine, for treating cancer.
- In one embodiment, the present invention relates to the use of said composition for treating an antigen-related state in an individual in need thereof. Said pharmaceutical composition or medicament is to be administrated to the individual in a therapeutically effective amount for stimulating an immune response against the antigen in said individual, thereby treating said antigen-related condition in said individual.
- In another embodiment, the present invention relates to the use of said composition for treating an antigen-related condition in an individual in need thereof, wherein the composition is to be administered in combination with thalidomide or an analog thereof, preferably lenalidomide.
- Indeed, it was shown that lenalidomide and its analogues enhance CD 1d-mediated presentation of glycolipid antigens, and therefore enhance antigen-specific activation of NKT cells.
- In another embodiment, the present invention relates to the use of the kit as described above, wherein at least one ligand of CD1 capable of stimulating NKT cells is to be administrated before, simultaneously or after the B subunit of Shiga toxin or a functional equivalent thereof which is able to bind the Gb3 receptor, complexed with an antigen.
- According to the invention, the use of said composition allows the delivery of the antigen into a Gb3 receptor expression cells.
- According to the invention, the stimulation of the immune response induced by the use of the composition of the invention comprises stimulating dendritic cells.
- According to the invention, the stimulation of the immune response induced by the use of the composition of the invention comprises eliciting an antigen specific CD8+ response.
- In the following description, all molecular biology experiments for which no detailed protocol is given are performed according to standard protocol.
- The following examples are included to demonstrate preferred embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention.
- I. Material and Methods.
- Mice
- Female C57BL/6 (H-2b) mice were purchased from Charles River Laboratories (L'Arbresle, France). OT-I TCR transgenic (TG) mice specific for the ovalbumin (OVA) peptide (SIINFEKL) in the context of H-2Kb were provided by Dr C Leclerc (Institut Pasteur). OVA-TG mice were obtained from Dr P. Shrikant (Roswell Park Cancer Institute, Buffalo, N.Y.) with the permission of Dr M. K Jenkins (University of Minnesota). These mice present the C57BL/6 background and express low levels of the membrane-associated form of chicken ovalbumin protein (OVA) in most actin-expressing cells. Mice were kept under specific pathogen-free conditions and were used between 6 and 8 weeks of age according to institutional guidelines.
- Chemical Reagents (Recombinant Proteins, Peptides, Adjuvant)
- Purified chicken ovalbumin (OVA) (grade V) was purchased from Sigma (St Quentin Fallavier, France). Synthetic OVA-derived peptide OVA257-264 (SIINFEKL) and HPV16-E7 derived peptide E749-57 (RAHYNIVTF) or E743-57 (GQAEPDRAHYNIVTF) were obtained from NeoMPS (Strasbourg, France) and stored in PBS.
- STxB-OVA was obtained by chemical coupling, as previously described (Haicheur, N., et al. 2003. Int Immunol 15:1-11). Briefly, OVA was first activated via amino groups on lysine side chains using the heterobifunctional cross-linker MBS (Pierce, Rockford, Ill.). Activated OVA was then reacted with STxB-Cys, and the reaction product was purified by gel filtration and immunoaffinity chromatography. STxB-E743-57 was produced using a chemical coupling between the N-bromoacetylated E743-57 peptide and the sulfhydril group of the STxB-Cys recombinant protein as previously described (Mallard, F. et al. 2003. Methods Mol Med 73:209-220). Removal of contaminating LPS was carried out using Acticlean Etox columns (Biotech-IgG, Kobenhavn, Denmark). After purification, endotoxin concentrations determined by the Limulus assay test (Biowhittaker, Walkersville, Md.) were <0.5 EU/mg.
- The iNKT cell ligand α-GalCer (KRN7000) was kindly supplied by Kirin Brewery Co (Japan). Poly (I:C) and incomplete Freund's adjuvant (IFA) were purchased from Sigma (St Quentin-Fallavier, France). CpG ODN 1826 was purchased from Proligo (Paris, France).
- IFNα was kindly provided by Ion Gresser (Inserm, France)
- Cells
- The mouse thymoma cell line EL4 (H-2b) was kindly provided by K. Rock (University of Massachusetts Medical School, Worcester, Mass.) and P Jeannin (Angers University Hospital, France)
- ELISPOT Assay
- The functionality of the anti-OVA257-264/Kb CD8+ T cells induced after injection of STxB-OVA was determined by ELISPOT according to the manufacturer's recommendations (Diaclone, Besancon, France). Briefly, 105 CD8+ T cells were transferred to anti-mouse IFNγ mAb precoated plates and cultured for 18 hours at 37° C. with 105 EL4 cells previously pulsed (or not) with the OVA257-264 peptide and fixed with 1% paraformaldehyde. After washings, the plates were further incubated with biotinylated anti-mouse IFNγ mAb. Finally, the plates were washed and incubated for 30 min at 37° C. with alkaline phosphatase-labeled streptavidin. Spots were developed by adding 5-bromo-4-chloro-3-indolyl-phosphatase/nitroblue tetrazolium. Positive controls included cells stimulated with phorbol myristate acetate (100 ng/ml, Sigma) and ionomycin (500 ng/ml, Sigma). Controls consisted of cells cultured in the absence of the OVA257-264 peptide. IFN γ spot-forming cells (SFCs) were counted on a KS-ELISPOT system (Carl Zeiss, Munich, Germany).
- Cytotoxicity Assay
- Cytotoxicity was assessed on 51Cr-labeled target cells as previously described (Haicheur, N., et al. 2000. J Immunol 165:3301-3308)
- Flow-Cytometry
- To detect anti-OVA257-264/Kb or anti-E749-57/Db specific CD8+ T cells, the cells were stained with OVA257-264/Kb or E749.57/Db tetramer according to the manufacturer's recommendations (Beckman-Coulter Immunomics, Marseilles, France). Briefly, cells were incubated with PE-labeled tetramer (45 min at 4° C. in the dark). After incubation and washes, labeled anti-CD8 mAbs (ebioscience, San Diego, Calif.) were used to phenotype the positive tetramer CD8+T cells. Irrelevant tetramers recognizing a VSV derived peptide in the context of Kb or Db molecules were used in each experiment. Naive non immunized mice were also included as control for these experiments.
- Proliferation Assay to Detect Specific Anti-OVA CD4+T Cells
- CD4+T cells were purified from spleen and labeled with CFSE (Molecular Probes, Eugene, Oreg.), used at 0.5 μM for 30 min at 20° C. Labeling was stopped by repeated washing with ice-cold PBS supplemented with 5% FCS. Cells were then incubated with T cell depleted splenocytes as APC pulsed or not with free ovalbumin protein and cocultured for 5 days in AIM V serum free medium. Proliferation in absence of APC sensitization were subtracted as background from values obtained after ovalbumin pulsing.
- Ex Vivo Cross-Presentation Assay
- Anti-OVA specific CD8+T cells derived from OT-1 mice were labeled with CFSE. CD11c+ enriched dendritic cells (106) isolated as described (37) from mice vaccinated with various vaccine formulations were co-cultured with OT-1 cells (5·105) for 72 hours. Dilution of CFSE detected by FACS analysis was considered to be an indicator of OT-1 cell proliferation after antigen recognition.
- Serological Analysis
- It was performed as previously described (Haicheur, N., F. et al. 2003. Int Immunol 15:1-11).
- Anti-Viral Protection Experiments
- C57BL/6 mice (5 mice per group) were injected twice (d0 and d21) intraperitoneally (200 μl) with different vaccine formulations and control mice were injected with PBS. Eight days after the last injection, mice were challenged intraperitoneally with 2.5×106 PFU recombinant vaccina virus (rVV, Westerns Reserve strains) expressing either the ovalbumin or the HBx cDNA derived from Hepatitis B virus kindly provided, by Dr N Etchart (INSERM, Lyon) and Dr Lone Yu Chun (Institut Pasteur), respectively. After 4 days, the ovaries of the mice were harvested and homogenized with a mechanical tissue grinder. The homogenates were clarified by centrifugation at 4,000 g for 10 min, and the number of rVV PFU in the resultant supernatant was enumerated by infecting BHK 21 cell monolayers with 10-fold serial dilutions of these fluids and plaques were counted after 2 days in culture at 37° C. in a 5% CO2 environment as previously described (52).
- Results
- α-GalCer Increased the Efficiency of STxB Coupled to Antigen to Induce Specific CTL.
- A first series of experiments tested the ability of various well defined adjuvants to increase the efficiency of STxB-OVA to trigger a specific CTL response.
- As previously reported, when mice were immunized twice with the STxB-OVA conjugate (50 μg) alone, an induction of anti-OVA257-264 CD8+T cells corresponding to 0.4% of CD8+ T cells was demonstrated (
FIGS. 1 and 2A ). Except for IFA, all other adjuvants (IFNα, Poly (I:C), CpG and α-GalCer) combined with STxB-OVA significantly enhanced the frequency of anti-OVA257-264 CD8+T cells. However, whereas, IFNα, Poly (I:C) and CpG led to a modest increase of anti-OVA257-264 CD8+T cells detected by specific tetramer not exceeding 1% of total CD8+T cells, the glycolipid α-GalCer elicited a dramatic increase of the percent of specific anti-OVA CTL (FIG. 1 ). Indeed, after two immunizations with STxB-OVA and α-GalCer, 4.6% of CD8+T cells stained positively with OVA257-264/Kb tetramer directly ex vivo without any in vitro restimulation step (FIG. 1 ). We therefore focused on analysis of this synergy between STxB and α-GalCer. Since previous studies reported that repeated administration of α-GalCer may lead to anergy and TH2 polarization (53-55) and no difference was observed when α-GalCer was injected during both the first and second immunizations or only at priming, we only combined this adjuvant and STxB-OVA during the first immunization. - When different doses of the STxB-OVA conjugate were mixed with α-GalCer, this adjuvant was found to significantly induce the anti-OVA257-264 CTL response even at very low doses of antigen (50 ng STxB-OVA corresponding to 25 ng of equivalent ovalbumin antigen) (
FIG. 2A ). In contrast, free ovalbumin even at high doses (200 μg) combined with α-GalCer elicited a low frequency of anti-OVA257-264 CTL not exceeding 1% of total CD8+T cells (FIG. 2B ) compared to 5-7% of anti-OVA257-264 specific CTL when ovalbumin was coupled to STxB and combined with α-GalCer. In addition, no significant induction of anti-OVA257-264 CD8+T cells was shown when less than 50 μg of OVA was added to α-GalCer or when OVA alone was used for immunization (FIG. 2B ). The other adjuvants (IFNα, Poly (I:C), CpG) did not allow this priming of CTL when a low dose of STxB-OVA conjugate was used reinforcing the significance of the synergy between STxB and α-GalCer (data not shown). - The specific anti-OVA257-264 CD8+T cells induced by the combination of α-GalCer and the STxB-OVA conjugate were long-lasting as 2.49% of CD8+T cells stained positively with OVA257-264/Kb tetramer directly ex vivo 202 days after the first immunization (
FIG. 2C ). - Since tetramer analysis does not discriminate between anergic and functional CD8′T cells, two functional tests, an Elispot assay and a cytotoxic assay on 51Cr-labeled target cells without an in vitro stimulation were performed. As shown in
FIG. 2D , after vaccination with STxB-OVA (1 μg) mixed with α-GalCer, large numbers of CD8+T cells produced IFNγ (mean 61/105 cells) when co-incubated with OVA257-264 peptide-pulsed EL4 cells (FIG. 2D left). Similarly, as shown inFIG. 1D (right), spleen cells from mice immunized with STxB-OVA mixed with α-GalCer efficiently lyzed EL4 target cells loaded with the OVA257-264 peptide, whereas no cytotoxicity was observed against EL4 alone. No ex vivo cytotoxicity was demonstrated when mice were vaccinated twice with STxB-OVA alone even when high doses (50 μg) were used (data not shown). - To check whether these results could be reproduced with another more clinically relevant antigen, mice were immunized twice with STxB coupled to a polypeptide derived from the HPV16-E7 protein (STxB-E743-57) at a low dose (1 μg). A marked induction of anti-E7 CTL detectable ex vivo by the E749-57 Db tetramer (1.12% of CD8+T cells) was also demonstrated (
FIG. 3 ). These CTL were functional (data not shown). In contrast, at this dosage, only low levels of E7-specific CTL (0.12% of CD8+T cells) were detected after immunization with STxB-E743-57 alone. The E743-57 polypeptide mixed with α-GalCer did not prime a CTL response (FIG. 3 ). - We then investigated whether the synergy observed between α-GalCer and STxB was restricted to induction of CTL or could be extended to other immune responses. Mice vaccinated with the STxB-OVA conjugate mixed with α-GalCer displayed a more potent anti-OVA CD4+T cell response compared to mice immunized with STxB-OVA alone or free ovalbumin mixed with IFA (
FIG. 4 ). However, although α-GalCer increased the anti-OVA IgG2a response compared to free ovalbumin with adjuvant, this humoral response either for total IgG or the various isotypes was not enhanced when STxB was admixed with α-GalCer compared to STxB alone. - Analysis of Potential Mechanisms Leading to the Synergy Between STxB and α-GalCer.
- In a previous study, the adjuvant property of α-GalCer was related to its ability to promote maturation of DC. A rapid increase of costimulatory molecules (CD86 . . . ) and MHC class II was observed, after administration of α-GalCer in mice (data not shown). However, we also confirmed that other adjuvants used in this study (CpG, Poly (I:C) . . . ) also activated dendritic cells but their enhancing effect on the STxB immunogenicity remained modest (
FIG. 1 and data not shown). - Since the levels of CD1d may affect NKT cell activation, we tested whether STxB could modulate the expression of CD1d. After STxB administration in mice, no significant change was detected in CD expression on APC (dendritic cells and B cells) derived from splenocytes. Similarly, α-GalCer did not regulate the membrane expression of Gb3 on dendritic and B cells (data not shown).
- As one striking consequence of the synergy between STxB and α-GalCer is the ability to markedly reduce the efficient dose of STxB vaccine, we analyzed the in vivo presentation of antigen after vaccination. Dendritic cells derived from mice immunized with low doses of STxB-OVA (1 μg) combined with α-GalCer, 7 days earlier, more significantly presented the OVA257-264/Kb complex in vivo than mice vaccinated with STxB alone (
FIG. 5 ). This presentation was observed for both dendritic cells derived from spleen or draining lymph node and persisted for at least 12 days (data not shown). This increased presentation could also be detected when STxB was mixed with other adjuvants, but the levels of antigen presentation appeared to be lower than those observed with α-GalCer (FIG. 5 and data not shown). Although the Gb3 receptor and CD1d are also expressed by B cells, addition of α-GalCer to STxB-OVA did not allow these cells to express the OVA257-264/Kb complex whose expression remained restricted to dendritic cells after immunization as previously reported (data not shown). - STxB Conjugate Mixed with α-GalCer Broke Tolerance Against Self Antigens
- It is often criticized that exogenous antigens such as ovalbumin and viral proteins do not mimic the clinical situations in which therapeutic vaccines will be developed because most tumor antigens are self antigens and, during chronic infection, tolerance to viral protein is already established. For these indications, a potential vaccine is therefore expected to be endowed with the ability to break tolerance against self antigen. For this purpose we selected a novel transgenic mouse model that expresses ovalbumin on the surface of all cells. When these mice were vaccinated with STxB-OVA alone, no anti-OVA257-264 CD8+T cell induction was observed in either blood or spleen at various times after primary or secondary immunizations (
FIG. 6 and data not shown). In contrast, specific tetramer assay detected significant levels of anti-OVA257-264 CD8+ T cells in 8 out of 11 mice immunized with STxB-OVA combined with α-GalCer (FIG. 6 ). Some of them (4 out of 7 vaccinated mice) were functional as they produced IFNγ using an Elispot assay. These specific CD8+T cells seemed to be induced by the vaccine as they were not present before immunization (data not shown). These anti-OVA specific CD8+T cells were essentially found after primary immunizations and rapidly disappeared from the blood and from the spleen. It should be emphasized that this strain of mice expresses membrane ovalbumin in all organs. - STxB Conjugate Mixed with α-GalCer Induces Anti-Viral Protective Immunity.
- To investigate the clinical relevance of the synergy observed between STxB and α-GalCer, we challenged mice with recombinant vaccinia virus encoding ovalbumin (VV-OVA), 7 days after vaccination, and measured virus titers in the
ovaries 5 days later to assess protection. Vaccination of mice with STxB-OVA and α-GalCer conferred potent protection against VV-OVA, with virus titers in the ovaries reduced by 5 log (3·92·103 PFU) compared to those of mice treated with PBS (8·28·108 PFU) (FIG. 7 ). Immunization with STxB-OVA alone conferred a statistically significant reduction of virus titers in the ovary by >2 log but this effect was dramatically amplified by the addition of α-GalCer. - To exclude a direct role of α-GalCer in this anti-viral protection, we showed that mice immunized with ovalbumin and α-GalCer exhibited a slight reduction of infectious virus, titers from 8·28·108 PFU in PBS-treated mice to 7·73·108 PFU corresponding to less that 1 log reduction of virus titers (
FIG. 7 ). The specificity of the protection was documented by challenging STxB-OVA/α-GalCer immunized mice, with an irrelevant vaccinia virus encoding hepatitis B×protein). No significant reduction of viral load was observed (data not shown). - No Adjuvant Effect of α-GalCer in Mice Deficient in NKT Cells.
- Ja18−/− mice were immunized with STxB-OVA (1 μg) or STxB-OVA+α-GalCer (2 μg). 7 days after immunization, the spleens of immunized and non-immunized mice were harvested and stained with anti-CD8 antibody and OVA257-264/Kb tetramer. The results (
FIG. 8 ) showed that almost no anti-OVA257-264 specific CTL were observed in immunized Ja18−/− mice with or without α-GalCer. This is to be compared with the 6.43% of anti-OVA257-264 specific CTL observed in immunized C57BL/6 mice with α-GalCer (FIG. 2A ). Therefore, no adjuvant effect of α-GalCer can be observed in mice deficient in NKT cells, confirming the role of the activation of NKT cells in the adjuvant mechanism of α-GalCer. - Vaccination with αGalCer Combined with STxB-Ova Induces Protection Against Established Tumors
- C57BL6 mice were grafted with EG7 tumor, a thymoma transfected with cDNA encoding ovalbumin mice, and three days after were treated with PBS, 5 μg STx-B-Ova, 2 μg αGalCer or the combination of both (
FIG. 9 ). - Mice vaccinated three days after subcutaneous graft of EG7 with the combination of STxB-Ova and αGalCer, showed a significant regression of tumor. In contrast mice immunized with STxB-Ova alone or αGalCer alone did not control the growth of the tumor.
- Vaccination with C-αGalCer Combined with STxB-Ova Induces Protection Against Established Tumors
- C57BL6 mice are grafted with EG7 tumor, a thymoma transfected with cDNA encoding ovalbumin mice, and three days after are treated with PBS, 5 μg STx-B-Ova, 2 μg C-αGalCer, or the combination STx-B-Ova/C-αGalCer.
- Mice vaccinated three days after subcutaneous graft of EG7 with the combination of STx-B-Ova/C-αGalCer will show a significant regression of tumor. In contrast mice immunized with STxB-Ova, or C-αGalCer alone will not control the growth of the tumor.
Claims (22)
1. A method of breaking tolerance against a self antigens said method comprising administering to a mammal in need of such treatment a composition comprising
a) a B subunit of Shiga toxin or a functional equivalent thereof which binds to the Gb3 receptor, complexed with an antigen and
b) at least one ligand of CD1 that stimulates NK T cells, wherein said ligand is a glycolipid, a phospholipid, a glycosphingolipid, a derivative or an analogue thereof, wherein said composition breaks tolerance against self antigens and stimulates dendritic cells and wherein there is synergy between said B subunit of Shiga toxin or a functional equivalent thereof which binds to the Gb3 receptor, complexed with an antigen and said at least one ligand of CD1 that stimulates NK T cells.
2. The method according to claim 1 , wherein the functional equivalent of the B subunit of Shiga toxin is administered which binds to the Gb3 receptor has at least 60% amino acid sequence identity to the B subunit of Shiga toxin.
3. The method according to claim 1 , wherein said ligand of CD1 is a ligand of CD1d is administered.
4. The method according to claim 1 , wherein said ligand that is administered is chosen from disialogamgloside (GD3), phosphotidylethanolamine (PE) or phosphatidylinositol (P1).
5. The method according to claim 1 , wherein said ligand that is administered is a glycosylceramide or an analog or a derivative thereof.
6. The method according to claim 5 , wherein said glycosylceramide that is administered is selected from the group consisting of α-GalCer, α-GlcCer, Galα1-6Galα1-1′Cer, Galα1-6Glcα1-1′Cer, Galα1-2Galα1-1′Cer, Galα1-3Galα1-1′Cer and a derivative thereof.
7. The method according to claim 6 , wherein the glycosylceramide α-GalCer that is administered is (2S,3S,4S)-1-O-(α-D-galactopyranosyl)-2-(N-hexacosanoylamino)-1,3,4,-octadecanetriol.
8. The method according to claim 6 , wherein the glycosylceramide that is administered is α-GalCer is (2S,3S,4S)-1-O-(α-D-galactopyranoxy)-2-(N-hexacosanoylamino)-3,4,-octadecanetriol (KRN7000).
9. The method according to claim 5 , wherein said ligand that is administered is selected from the group consisting of 3-O-sulfo-α-GalCer, α-GalCer, and OCH compound and α-C-GalCer.
10. The method according to claim 5 , wherein said glycosylceramide that is administered is α-C-GalCer.
11. The method according to claim 6 , wherein said glycosylceramide that is administered is PBA-57.
12. The method according to claim 1 , wherein said ligand that is administered is a microbe derived glycolipid.
13. The method according to claim 1 , wherein said ligand that is administered is
a Sphingomonas species-derived glycosphingolipid selected from the group consisting of GSL-1 and GSL′1 or
a Borrelia species derived glycolipid selected from the group consisting of BbGL-I and BgGL-II or
a Mycobacteria species derived phosphoglycolipid PIM.
14. The method according to claim 1 , wherein said composition is administered mucosally, transdermally, subcutaneously or intramuscularly.
15. The method according to claim 1 , wherein said at least one ligand that stimulates NK T cells is administered before, simultaneously or after the B subunit of Shiga toxin or functional equivalent thereof which is able to bind Gb3 receptor cells which is complexed to an antigen.
16. The method according to claim 1 , wherein said composition is administered in a therapeutically effective amount for stimulating an immune response against an antigen in said mammal.
17. The method according to claim 16 , wherein said antigen is administered at a dose of 0.1 to 1,000 μg.
18. The method according to claim 1 , wherein said mammal is a human.
19. The method according to claim 1 , wherein said antigen is a tumor antigen, a viral antigen or a bacterial antigen.
20. The method according to claim 1 , further comprising a pharmaceutically acceptable carrier.
21. The method according to claim 1 , wherein said composition is administered as a vaccine.
22. The method according to claim 21 , wherein said vaccine is initially administered followed by one or more booster administrations.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/174,286 US20140205630A1 (en) | 2006-12-28 | 2014-02-06 | Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US87735406P | 2006-12-28 | 2006-12-28 | |
EP06292066A EP1938836A1 (en) | 2006-12-28 | 2006-12-28 | Compositions comprising a B subunit of shiga toxin and a means stimulating NKT cells |
EP06292066.5 | 2006-12-28 | ||
PCT/EP2007/064556 WO2008080926A1 (en) | 2006-12-28 | 2007-12-26 | Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells |
US52140410A | 2010-03-11 | 2010-03-11 | |
US14/174,286 US20140205630A1 (en) | 2006-12-28 | 2014-02-06 | Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2007/064556 Division WO2008080926A1 (en) | 2006-12-28 | 2007-12-26 | Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells |
US12/521,404 Division US8685408B2 (en) | 2006-12-28 | 2007-12-26 | Compositions comprising a B subunit of Shiga toxin and a means stimulating NKT cells |
Publications (1)
Publication Number | Publication Date |
---|---|
US20140205630A1 true US20140205630A1 (en) | 2014-07-24 |
Family
ID=39203258
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/521,404 Expired - Fee Related US8685408B2 (en) | 2006-12-28 | 2007-12-26 | Compositions comprising a B subunit of Shiga toxin and a means stimulating NKT cells |
US14/174,286 Abandoned US20140205630A1 (en) | 2006-12-28 | 2014-02-06 | Compositions comprising a b subunit of shiga toxin and a means stimulating nkt cells |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/521,404 Expired - Fee Related US8685408B2 (en) | 2006-12-28 | 2007-12-26 | Compositions comprising a B subunit of Shiga toxin and a means stimulating NKT cells |
Country Status (5)
Country | Link |
---|---|
US (2) | US8685408B2 (en) |
EP (2) | EP1938836A1 (en) |
JP (1) | JP5345950B2 (en) |
CA (1) | CA2673969A1 (en) |
WO (1) | WO2008080926A1 (en) |
Cited By (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9814780B2 (en) | 2010-08-10 | 2017-11-14 | Ecole Polytechnique Federale De Lausanne (Epfl) | Compositions for inducing antigen-specific tolerance |
US9850296B2 (en) | 2010-08-10 | 2017-12-26 | Ecole Polytechnique Federale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10046056B2 (en) | 2014-02-21 | 2018-08-14 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US20190201480A1 (en) * | 2015-02-23 | 2019-07-04 | Institut Curie | Combined vaccination/radioterapy for cancer treatment |
US10392437B2 (en) | 2010-08-10 | 2019-08-27 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10821157B2 (en) | 2014-02-21 | 2020-11-03 | Anokion Sa | Glycotargeting therapeutics |
US10946079B2 (en) | 2014-02-21 | 2021-03-16 | Ecole Polytechnique Federale De Lausanne | Glycotargeting therapeutics |
US10953101B2 (en) | 2014-02-21 | 2021-03-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11253579B2 (en) | 2017-06-16 | 2022-02-22 | The University Of Chicago | Compositions and methods for inducing immune tolerance |
Families Citing this family (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP1229045A1 (en) | 2001-02-01 | 2002-08-07 | Institut Curie | Universal carrier for targeting molecules to Gb3 receptor expressing cells |
US7645873B2 (en) | 2003-03-20 | 2010-01-12 | The Scripps Research Institute | 6″-amino-6″-deoxygalactosylceramides |
DK2056842T3 (en) | 2006-04-07 | 2013-01-14 | Univ Chicago | Modified galactosylceramide for the treatment of cancerous diseases |
US8916164B2 (en) * | 2007-08-29 | 2014-12-23 | Abivax | Methods of enhancing adjuvaticity of vaccine compositions |
EP2058011A1 (en) | 2007-11-07 | 2009-05-13 | Wittycell | Nkt cell activating gycolipids covalently bound antigens and/or drug |
DK2231145T3 (en) * | 2007-12-05 | 2014-12-08 | Abivax | Use of glycosylceramider for enhancing the immune response to antigen |
BRPI0914069A2 (en) | 2008-10-08 | 2016-09-27 | Vincent Serra | vaccine composition for use against influenza |
MY171201A (en) | 2012-04-26 | 2019-10-01 | Riken | New carbamate glycolipid and use thereof |
KR102606179B1 (en) | 2016-09-14 | 2023-11-28 | 아비박스 | Combinations containing ABX196 for the treatment of cancer |
JP7125760B2 (en) * | 2019-06-14 | 2022-08-25 | 国立研究開発法人理化学研究所 | Cells that stimulate the immune system and pharmaceutical compositions containing the cells |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2005112991A2 (en) * | 2004-05-21 | 2005-12-01 | Glaxosmithkline Biologicals Sa | Vaccines |
US7632514B2 (en) * | 2001-02-01 | 2009-12-15 | Institute Curie | Universal carrier for targeting molecules to Gb3 receptor expressing cells |
US20100028415A1 (en) * | 2005-04-12 | 2010-02-04 | Haynes Barton F | Method of Inducing Neutralizing Antibodies to Human Immunodeficiency Virus |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA2323733A1 (en) * | 1998-04-13 | 1999-10-21 | Michael B. Brenner | Vaccine compositions comprising cd-1 antigens and t-cell stimulating compound and methods of use thereof |
CA2453880A1 (en) * | 2001-07-25 | 2003-02-06 | New York University | Use of glycosylceramides as adjuvants for vaccines against infections and cancer |
-
2006
- 2006-12-28 EP EP06292066A patent/EP1938836A1/en not_active Withdrawn
-
2007
- 2007-12-26 EP EP07858153.5A patent/EP2125012B1/en not_active Not-in-force
- 2007-12-26 WO PCT/EP2007/064556 patent/WO2008080926A1/en active Application Filing
- 2007-12-26 JP JP2009543466A patent/JP5345950B2/en not_active Expired - Fee Related
- 2007-12-26 CA CA002673969A patent/CA2673969A1/en not_active Abandoned
- 2007-12-26 US US12/521,404 patent/US8685408B2/en not_active Expired - Fee Related
-
2014
- 2014-02-06 US US14/174,286 patent/US20140205630A1/en not_active Abandoned
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7632514B2 (en) * | 2001-02-01 | 2009-12-15 | Institute Curie | Universal carrier for targeting molecules to Gb3 receptor expressing cells |
WO2005112991A2 (en) * | 2004-05-21 | 2005-12-01 | Glaxosmithkline Biologicals Sa | Vaccines |
US20100028415A1 (en) * | 2005-04-12 | 2010-02-04 | Haynes Barton F | Method of Inducing Neutralizing Antibodies to Human Immunodeficiency Virus |
Non-Patent Citations (3)
Title |
---|
Fujii et al ( J. Exp. Med., vol. 198, no. 2 July 2003).. * |
Haicheur et al, J. Immunology, 2000, 165:3301-3308. * |
Kawano et al (International Immunology, vol. 11, no. 6, pp. 881-887, 1999) . * |
Cited By (24)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10265416B2 (en) | 2010-08-10 | 2019-04-23 | École Polytechnique Fédérale de Lausanna (EPFL) | Compositions for generation of immune tolerance to specific antigens |
US9850296B2 (en) | 2010-08-10 | 2017-12-26 | Ecole Polytechnique Federale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US9878048B2 (en) | 2010-08-10 | 2018-01-30 | Ecole Polytechnique Federale De Lausanne (Epfl) | Compositions for generating immune tolerance by targeting erythrocytes |
US9901645B2 (en) | 2010-08-10 | 2018-02-27 | Ecole Polytechnique Fedrale de Lausanne (EPFL) | Methods for reducing immune responses |
US9901646B2 (en) | 2010-08-10 | 2018-02-27 | Ecole Polytechnique Federale De Lausanne (Epfl) | Methods for induction of antigen-specific immune tolerance |
US11884721B2 (en) | 2010-08-10 | 2024-01-30 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10919963B2 (en) | 2010-08-10 | 2021-02-16 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10265415B2 (en) | 2010-08-10 | 2019-04-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Compositions for inducing antigen-specific tolerance |
US11246943B2 (en) | 2010-08-10 | 2022-02-15 | École Polytechnique Fédérale De Lausanne (Epfl) | Antigen-specific tolerance and compositions for induction of same |
US10392437B2 (en) | 2010-08-10 | 2019-08-27 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US10471155B2 (en) | 2010-08-10 | 2019-11-12 | École Polytechnique Fédérale De Lausanne (Epfl) | Antigen-specific tolerance and compositions for induction of same |
US10800838B2 (en) | 2010-08-10 | 2020-10-13 | École Polytechnique Fédérale De Lausanne (Epfl) | Erythrocyte-binding therapeutics |
US9814780B2 (en) | 2010-08-10 | 2017-11-14 | Ecole Polytechnique Federale De Lausanne (Epfl) | Compositions for inducing antigen-specific tolerance |
US10821157B2 (en) | 2014-02-21 | 2020-11-03 | Anokion Sa | Glycotargeting therapeutics |
US10940209B2 (en) | 2014-02-21 | 2021-03-09 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US10946079B2 (en) | 2014-02-21 | 2021-03-16 | Ecole Polytechnique Federale De Lausanne | Glycotargeting therapeutics |
US10953101B2 (en) | 2014-02-21 | 2021-03-23 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11654188B2 (en) | 2014-02-21 | 2023-05-23 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11666638B2 (en) | 2014-02-21 | 2023-06-06 | Ecole Polytechnique Federale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11793882B2 (en) | 2014-02-21 | 2023-10-24 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US11801305B2 (en) | 2014-02-21 | 2023-10-31 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US10046056B2 (en) | 2014-02-21 | 2018-08-14 | École Polytechnique Fédérale De Lausanne (Epfl) | Glycotargeting therapeutics |
US20190201480A1 (en) * | 2015-02-23 | 2019-07-04 | Institut Curie | Combined vaccination/radioterapy for cancer treatment |
US11253579B2 (en) | 2017-06-16 | 2022-02-22 | The University Of Chicago | Compositions and methods for inducing immune tolerance |
Also Published As
Publication number | Publication date |
---|---|
WO2008080926A1 (en) | 2008-07-10 |
EP1938836A1 (en) | 2008-07-02 |
CA2673969A1 (en) | 2008-07-10 |
JP5345950B2 (en) | 2013-11-20 |
JP2010514731A (en) | 2010-05-06 |
US8685408B2 (en) | 2014-04-01 |
US20100196417A1 (en) | 2010-08-05 |
EP2125012A1 (en) | 2009-12-02 |
EP2125012B1 (en) | 2018-09-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8685408B2 (en) | Compositions comprising a B subunit of Shiga toxin and a means stimulating NKT cells | |
US20090035330A1 (en) | Vaccine Composition Comprising B-Subunit Of E. coli Heat Toxin And An Antigen And An Adjuvant | |
US20080069832A1 (en) | Vaccines | |
US20070212329A1 (en) | Vaccine Compositions Comprising An Interleukin 18 And Saponin Adjuvant System | |
NZ545948A (en) | Improvements in vaccination | |
US20070212328A1 (en) | Immunogenic Compositions | |
CN111315406A (en) | Liposome formulations comprising saponins and methods of use thereof | |
US20040037840A1 (en) | Novel therapeutic vaccine formulations | |
US20100266672A1 (en) | Vaccines | |
WO2002034287A2 (en) | Therapeutic vaccine formulations containing chitosan | |
US20100196451A1 (en) | Vaccines Containing Non-Live Antigenic Vectors | |
US20110268757A1 (en) | Use of phenol-soluble modulins for vaccine development | |
EP1716866A1 (en) | Proteoliposomes and derivatives thereof as cytotoxic response-inducing adjuvants and resulting formulations | |
Alving et al. | Design and selection of vaccine adjuvants: principles and practice | |
MXPA06003862A (en) | Immunogenic compositions |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: UNIVERSITE PARIS DESCARTES, FRANCE Free format text: CHANGE OF NAME;ASSIGNOR:DESCARTES PARIS 5, UNIVERSITE RENE;REEL/FRAME:032449/0950 Effective date: 20090421 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |