US20140065695A1 - Peptides and methods for inducing cell death - Google Patents
Peptides and methods for inducing cell death Download PDFInfo
- Publication number
- US20140065695A1 US20140065695A1 US13/875,066 US201313875066A US2014065695A1 US 20140065695 A1 US20140065695 A1 US 20140065695A1 US 201313875066 A US201313875066 A US 201313875066A US 2014065695 A1 US2014065695 A1 US 2014065695A1
- Authority
- US
- United States
- Prior art keywords
- amino acid
- conh
- seq
- cooh
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 395
- 238000000034 method Methods 0.000 title claims abstract description 56
- 230000001939 inductive effect Effects 0.000 title claims abstract description 10
- 102000004196 processed proteins & peptides Human genes 0.000 title abstract description 186
- 230000030833 cell death Effects 0.000 title description 8
- 230000000845 anti-microbial effect Effects 0.000 claims abstract description 101
- 238000003782 apoptosis assay Methods 0.000 claims abstract description 48
- 230000005522 programmed cell death Effects 0.000 claims abstract description 47
- 230000000694 effects Effects 0.000 claims abstract description 29
- 230000001093 anti-cancer Effects 0.000 claims abstract description 27
- 230000003110 anti-inflammatory effect Effects 0.000 claims abstract description 20
- 230000001028 anti-proliverative effect Effects 0.000 claims abstract description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 231
- 235000018102 proteins Nutrition 0.000 claims description 116
- 102000004169 proteins and genes Human genes 0.000 claims description 116
- 108090000623 proteins and genes Proteins 0.000 claims description 116
- 235000001014 amino acid Nutrition 0.000 claims description 39
- 229940024606 amino acid Drugs 0.000 claims description 37
- 150000001413 amino acids Chemical class 0.000 claims description 36
- 125000000539 amino acid group Chemical group 0.000 claims description 27
- CCSWQBHQKWCWOD-NSHDSACASA-N (2s)-2-(anthracen-1-ylamino)propanoic acid Chemical compound C1=CC=C2C=C3C(N[C@@H](C)C(O)=O)=CC=CC3=CC2=C1 CCSWQBHQKWCWOD-NSHDSACASA-N 0.000 claims description 10
- 235000018417 cysteine Nutrition 0.000 claims description 8
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 claims description 8
- 150000003573 thiols Chemical group 0.000 claims description 8
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 7
- 239000004475 Arginine Substances 0.000 claims description 6
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 6
- 239000004472 Lysine Substances 0.000 claims description 6
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 6
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 5
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 claims description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 5
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 5
- 239000004473 Threonine Substances 0.000 claims description 5
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 5
- 229960001230 asparagine Drugs 0.000 claims description 5
- 235000009582 asparagine Nutrition 0.000 claims description 5
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 5
- 206010028980 Neoplasm Diseases 0.000 abstract description 43
- 208000015181 infectious disease Diseases 0.000 abstract description 26
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 25
- 201000011510 cancer Diseases 0.000 abstract description 22
- 201000010099 disease Diseases 0.000 abstract description 21
- 238000011282 treatment Methods 0.000 abstract description 18
- 208000023275 Autoimmune disease Diseases 0.000 abstract description 11
- 230000002265 prevention Effects 0.000 abstract description 8
- 238000003745 diagnosis Methods 0.000 abstract description 7
- 208000037979 autoimmune inflammatory disease Diseases 0.000 abstract description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 264
- 239000012190 activator Substances 0.000 description 89
- 210000004027 cell Anatomy 0.000 description 82
- 239000000562 conjugate Substances 0.000 description 76
- 239000012636 effector Substances 0.000 description 76
- 241000282414 Homo sapiens Species 0.000 description 47
- 230000004913 activation Effects 0.000 description 35
- 210000001519 tissue Anatomy 0.000 description 32
- 230000005764 inhibitory process Effects 0.000 description 31
- 239000000126 substance Substances 0.000 description 31
- 230000036961 partial effect Effects 0.000 description 30
- 238000001228 spectrum Methods 0.000 description 29
- 230000001225 therapeutic effect Effects 0.000 description 29
- 238000006467 substitution reaction Methods 0.000 description 28
- 208000006930 Pseudomyxoma Peritonei Diseases 0.000 description 25
- 230000001575 pathological effect Effects 0.000 description 25
- 239000013641 positive control Substances 0.000 description 24
- 238000004458 analytical method Methods 0.000 description 22
- 108700000707 bcl-2-Associated X Proteins 0.000 description 22
- 102000055102 bcl-2-Associated X Human genes 0.000 description 22
- 150000001875 compounds Chemical class 0.000 description 22
- 239000012154 double-distilled water Substances 0.000 description 22
- 239000013642 negative control Substances 0.000 description 22
- 230000008685 targeting Effects 0.000 description 21
- 210000000056 organ Anatomy 0.000 description 20
- 229920001184 polypeptide Polymers 0.000 description 20
- 244000000010 microbial pathogen Species 0.000 description 19
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 18
- 230000006870 function Effects 0.000 description 18
- 239000000203 mixture Substances 0.000 description 18
- 239000003814 drug Substances 0.000 description 17
- 244000005700 microbiome Species 0.000 description 16
- 102000035195 Peptidases Human genes 0.000 description 15
- 108091005804 Peptidases Proteins 0.000 description 15
- 238000010586 diagram Methods 0.000 description 15
- 239000004365 Protease Substances 0.000 description 14
- 241000894006 Bacteria Species 0.000 description 13
- 102100021186 Granulysin Human genes 0.000 description 13
- 101710168479 Granulysin Proteins 0.000 description 13
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 13
- 238000009472 formulation Methods 0.000 description 12
- 230000012010 growth Effects 0.000 description 12
- 230000000813 microbial effect Effects 0.000 description 12
- 235000019419 proteases Nutrition 0.000 description 12
- 241000588626 Acinetobacter baumannii Species 0.000 description 11
- 238000003556 assay Methods 0.000 description 11
- 239000003795 chemical substances by application Substances 0.000 description 11
- 210000003470 mitochondria Anatomy 0.000 description 11
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 10
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 10
- 230000008827 biological function Effects 0.000 description 10
- 239000000872 buffer Substances 0.000 description 10
- -1 but not limited to Chemical class 0.000 description 10
- 238000013461 design Methods 0.000 description 10
- 210000004881 tumor cell Anatomy 0.000 description 10
- 229920000936 Agarose Polymers 0.000 description 9
- 208000035473 Communicable disease Diseases 0.000 description 9
- 230000002378 acidificating effect Effects 0.000 description 9
- 239000012528 membrane Substances 0.000 description 9
- 230000004048 modification Effects 0.000 description 9
- 238000012986 modification Methods 0.000 description 9
- 244000052769 pathogen Species 0.000 description 9
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 8
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 8
- 230000002159 abnormal effect Effects 0.000 description 8
- 230000001640 apoptogenic effect Effects 0.000 description 8
- 244000052616 bacterial pathogen Species 0.000 description 8
- 230000027455 binding Effects 0.000 description 8
- 230000003115 biocidal effect Effects 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 210000004899 c-terminal region Anatomy 0.000 description 8
- 244000053095 fungal pathogen Species 0.000 description 8
- 230000004807 localization Effects 0.000 description 8
- 230000007246 mechanism Effects 0.000 description 8
- 230000001613 neoplastic effect Effects 0.000 description 8
- 230000000069 prophylactic effect Effects 0.000 description 8
- 229940124597 therapeutic agent Drugs 0.000 description 8
- 241000222122 Candida albicans Species 0.000 description 7
- 102000004190 Enzymes Human genes 0.000 description 7
- 108090000790 Enzymes Proteins 0.000 description 7
- 241000233866 Fungi Species 0.000 description 7
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 7
- 102000001708 Protein Isoforms Human genes 0.000 description 7
- 108010029485 Protein Isoforms Proteins 0.000 description 7
- 241000191967 Staphylococcus aureus Species 0.000 description 7
- 230000008499 blood brain barrier function Effects 0.000 description 7
- 210000001218 blood-brain barrier Anatomy 0.000 description 7
- 239000003086 colorant Substances 0.000 description 7
- 229940088598 enzyme Drugs 0.000 description 7
- 230000003641 microbiacidal effect Effects 0.000 description 7
- 150000007523 nucleic acids Chemical class 0.000 description 7
- 125000002924 primary amino group Chemical class [H]N([H])* 0.000 description 7
- 230000008569 process Effects 0.000 description 7
- 238000011160 research Methods 0.000 description 7
- 241000588724 Escherichia coli Species 0.000 description 6
- 101700012268 Holin Proteins 0.000 description 6
- 206010061218 Inflammation Diseases 0.000 description 6
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 6
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 6
- 238000002802 antimicrobial activity assay Methods 0.000 description 6
- 230000006907 apoptotic process Effects 0.000 description 6
- 210000004556 brain Anatomy 0.000 description 6
- 230000021615 conjugation Effects 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 229940079593 drug Drugs 0.000 description 6
- 229940023064 escherichia coli Drugs 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 125000001165 hydrophobic group Chemical group 0.000 description 6
- 230000004054 inflammatory process Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 230000002438 mitochondrial effect Effects 0.000 description 6
- 102000039446 nucleic acids Human genes 0.000 description 6
- 108020004707 nucleic acids Proteins 0.000 description 6
- 230000001717 pathogenic effect Effects 0.000 description 6
- 230000009467 reduction Effects 0.000 description 6
- 238000006722 reduction reaction Methods 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 238000002560 therapeutic procedure Methods 0.000 description 6
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 5
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 5
- 102000010565 Apoptosis Regulatory Proteins Human genes 0.000 description 5
- 108010063104 Apoptosis Regulatory Proteins Proteins 0.000 description 5
- 244000063299 Bacillus subtilis Species 0.000 description 5
- 235000014469 Bacillus subtilis Nutrition 0.000 description 5
- 101100222092 Caenorhabditis elegans csp-3 gene Proteins 0.000 description 5
- 108090000371 Esterases Proteins 0.000 description 5
- 102000013535 Proto-Oncogene Proteins c-bcl-2 Human genes 0.000 description 5
- 108010090931 Proto-Oncogene Proteins c-bcl-2 Proteins 0.000 description 5
- 125000003277 amino group Chemical group 0.000 description 5
- 239000004599 antimicrobial Substances 0.000 description 5
- 239000002246 antineoplastic agent Substances 0.000 description 5
- 108700039689 bcl-2 Homologous Antagonist-Killer Proteins 0.000 description 5
- 102000055574 bcl-2 Homologous Antagonist-Killer Human genes 0.000 description 5
- 108010007734 bcl-Associated Death Protein Proteins 0.000 description 5
- 102000007348 bcl-Associated Death Protein Human genes 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 230000036755 cellular response Effects 0.000 description 5
- 238000003776 cleavage reaction Methods 0.000 description 5
- 230000000052 comparative effect Effects 0.000 description 5
- 230000006378 damage Effects 0.000 description 5
- 230000014509 gene expression Effects 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 230000003204 osmotic effect Effects 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 230000008823 permeabilization Effects 0.000 description 5
- 239000002953 phosphate buffered saline Substances 0.000 description 5
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 239000000523 sample Substances 0.000 description 5
- 230000007017 scission Effects 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 238000005556 structure-activity relationship Methods 0.000 description 5
- 239000000725 suspension Substances 0.000 description 5
- 230000002123 temporal effect Effects 0.000 description 5
- 102100026596 Bcl-2-like protein 1 Human genes 0.000 description 4
- 108090001007 Interleukin-8 Proteins 0.000 description 4
- 108090001060 Lipase Proteins 0.000 description 4
- 102000004882 Lipase Human genes 0.000 description 4
- 239000004367 Lipase Substances 0.000 description 4
- 108060003100 Magainin Proteins 0.000 description 4
- 102000002274 Matrix Metalloproteinases Human genes 0.000 description 4
- 108010000684 Matrix Metalloproteinases Proteins 0.000 description 4
- 239000003242 anti bacterial agent Substances 0.000 description 4
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 4
- 229940095731 candida albicans Drugs 0.000 description 4
- 150000001718 carbodiimides Chemical class 0.000 description 4
- 125000002091 cationic group Chemical group 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000002512 chemotherapy Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 229940127089 cytotoxic agent Drugs 0.000 description 4
- 230000034994 death Effects 0.000 description 4
- 230000007123 defense Effects 0.000 description 4
- 208000035475 disorder Diseases 0.000 description 4
- 229960004679 doxorubicin Drugs 0.000 description 4
- 230000001747 exhibiting effect Effects 0.000 description 4
- 230000009036 growth inhibition Effects 0.000 description 4
- 230000002209 hydrophobic effect Effects 0.000 description 4
- 239000012642 immune effector Substances 0.000 description 4
- 229940121354 immunomodulator Drugs 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 235000019421 lipase Nutrition 0.000 description 4
- 230000003647 oxidation Effects 0.000 description 4
- 238000007254 oxidation reaction Methods 0.000 description 4
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 238000002864 sequence alignment Methods 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000009885 systemic effect Effects 0.000 description 4
- 238000012384 transportation and delivery Methods 0.000 description 4
- 230000007923 virulence factor Effects 0.000 description 4
- 239000000304 virulence factor Substances 0.000 description 4
- 238000012800 visualization Methods 0.000 description 4
- 241000589291 Acinetobacter Species 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 108010036694 Dynamin I Proteins 0.000 description 3
- 102000000108 Dynamin-1 Human genes 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 206010018910 Haemolysis Diseases 0.000 description 3
- 101000765923 Homo sapiens Bcl-2-like protein 1 Proteins 0.000 description 3
- 102000015888 Mitofusin-1 Human genes 0.000 description 3
- 108050004122 Mitofusin-1 Proteins 0.000 description 3
- 206010028851 Necrosis Diseases 0.000 description 3
- 102100021010 Nucleolin Human genes 0.000 description 3
- 102000004503 Perforin Human genes 0.000 description 3
- 108010056995 Perforin Proteins 0.000 description 3
- 241001240958 Pseudomonas aeruginosa PAO1 Species 0.000 description 3
- 230000009471 action Effects 0.000 description 3
- QWCKQJZIFLGMSD-UHFFFAOYSA-N alpha-aminobutyric acid Chemical compound CCC(N)C(O)=O QWCKQJZIFLGMSD-UHFFFAOYSA-N 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 230000000118 anti-neoplastic effect Effects 0.000 description 3
- 239000000427 antigen Substances 0.000 description 3
- 102000036639 antigens Human genes 0.000 description 3
- 108091007433 antigens Proteins 0.000 description 3
- 229940034982 antineoplastic agent Drugs 0.000 description 3
- 125000004429 atom Chemical group 0.000 description 3
- 230000001363 autoimmune Effects 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 210000003763 chloroplast Anatomy 0.000 description 3
- 230000001268 conjugating effect Effects 0.000 description 3
- 238000009792 diffusion process Methods 0.000 description 3
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 3
- 238000012377 drug delivery Methods 0.000 description 3
- 210000002889 endothelial cell Anatomy 0.000 description 3
- 210000003743 erythrocyte Anatomy 0.000 description 3
- 230000008588 hemolysis Effects 0.000 description 3
- 102000058067 human BCL2L1 Human genes 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 208000027866 inflammatory disease Diseases 0.000 description 3
- 230000028709 inflammatory response Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 239000002054 inoculum Substances 0.000 description 3
- 230000003834 intracellular effect Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 230000000155 isotopic effect Effects 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 230000003211 malignant effect Effects 0.000 description 3
- 101150108984 mfn-1 gene Proteins 0.000 description 3
- 239000002105 nanoparticle Substances 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 108010044762 nucleolin Proteins 0.000 description 3
- 230000008506 pathogenesis Effects 0.000 description 3
- 238000010647 peptide synthesis reaction Methods 0.000 description 3
- 230000035699 permeability Effects 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 238000012913 prioritisation Methods 0.000 description 3
- 230000002797 proteolythic effect Effects 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 3
- 201000000849 skin cancer Diseases 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 239000001974 tryptic soy broth Substances 0.000 description 3
- 108010050327 trypticase-soy broth Proteins 0.000 description 3
- 238000002604 ultrasonography Methods 0.000 description 3
- 210000005166 vasculature Anatomy 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- GMKMEZVLHJARHF-UHFFFAOYSA-N (2R,6R)-form-2.6-Diaminoheptanedioic acid Natural products OC(=O)C(N)CCCC(N)C(O)=O GMKMEZVLHJARHF-UHFFFAOYSA-N 0.000 description 2
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 2
- OYIFNHCXNCRBQI-UHFFFAOYSA-N 2-aminoadipic acid Chemical compound OC(=O)C(N)CCCC(O)=O OYIFNHCXNCRBQI-UHFFFAOYSA-N 0.000 description 2
- RDFMDVXONNIGBC-UHFFFAOYSA-N 2-aminoheptanoic acid Chemical compound CCCCCC(N)C(O)=O RDFMDVXONNIGBC-UHFFFAOYSA-N 0.000 description 2
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 2
- 241001232615 Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 Species 0.000 description 2
- 241000588624 Acinetobacter calcoaceticus Species 0.000 description 2
- 241001148231 Acinetobacter haemolyticus Species 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 108010050820 Antimicrobial Cationic Peptides Proteins 0.000 description 2
- 102000014133 Antimicrobial Cationic Peptides Human genes 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 102100030009 Azurocidin Human genes 0.000 description 2
- 241000193830 Bacillus <bacterium> Species 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 244000197813 Camelina sativa Species 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 102000003952 Caspase 3 Human genes 0.000 description 2
- 108090000397 Caspase 3 Proteins 0.000 description 2
- 201000007336 Cryptococcosis Diseases 0.000 description 2
- 241000221204 Cryptococcus neoformans Species 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 101000957747 Drosophila melanogaster Transmembrane GTPase Marf Proteins 0.000 description 2
- 108010044191 Dynamin II Proteins 0.000 description 2
- 102000014347 Dynamin-2 Human genes 0.000 description 2
- 241000194032 Enterococcus faecalis Species 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- 102100020997 Fractalkine Human genes 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- JUQLUIFNNFIIKC-YFKPBYRVSA-N L-2-aminopimelic acid Chemical compound OC(=O)[C@@H](N)CCCCC(O)=O JUQLUIFNNFIIKC-YFKPBYRVSA-N 0.000 description 2
- AGPKZVBTJJNPAG-UHNVWZDZSA-N L-allo-Isoleucine Chemical compound CC[C@@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-UHNVWZDZSA-N 0.000 description 2
- SNDPXSYFESPGGJ-UHFFFAOYSA-N L-norVal-OH Natural products CCCC(N)C(O)=O SNDPXSYFESPGGJ-UHFFFAOYSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- AKCRVYNORCOYQT-YFKPBYRVSA-N N-methyl-L-valine Chemical compound CN[C@@H](C(C)C)C(O)=O AKCRVYNORCOYQT-YFKPBYRVSA-N 0.000 description 2
- KSPIYJQBLVDRRI-UHFFFAOYSA-N N-methylisoleucine Chemical compound CCC(C)C(NC)C(O)=O KSPIYJQBLVDRRI-UHFFFAOYSA-N 0.000 description 2
- 108010077895 Sarcosine Proteins 0.000 description 2
- 206010040047 Sepsis Diseases 0.000 description 2
- 108010022999 Serine Proteases Proteins 0.000 description 2
- 102000012479 Serine Proteases Human genes 0.000 description 2
- 208000000453 Skin Neoplasms Diseases 0.000 description 2
- 241000193998 Streptococcus pneumoniae Species 0.000 description 2
- 241000193996 Streptococcus pyogenes Species 0.000 description 2
- 108010022394 Threonine synthase Proteins 0.000 description 2
- 108090000190 Thrombin Proteins 0.000 description 2
- 102000005497 Thymidylate Synthase Human genes 0.000 description 2
- 208000024248 Vascular System injury Diseases 0.000 description 2
- 208000012339 Vascular injury Diseases 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 230000032683 aging Effects 0.000 description 2
- 150000001408 amides Chemical class 0.000 description 2
- 125000000129 anionic group Chemical group 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 230000005775 apoptotic pathway Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 230000002886 autophagic effect Effects 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 239000012620 biological material Substances 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000009134 cell regulation Effects 0.000 description 2
- 210000003169 central nervous system Anatomy 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 238000011443 conventional therapy Methods 0.000 description 2
- 239000002254 cytotoxic agent Substances 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 231100000135 cytotoxicity Toxicity 0.000 description 2
- 230000003412 degenerative effect Effects 0.000 description 2
- YSMODUONRAFBET-UHFFFAOYSA-N delta-DL-hydroxylysine Natural products NCC(O)CCC(N)C(O)=O YSMODUONRAFBET-UHFFFAOYSA-N 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- VEVRNHHLCPGNDU-MUGJNUQGSA-O desmosine Chemical compound OC(=O)[C@@H](N)CCCC[N+]1=CC(CC[C@H](N)C(O)=O)=C(CCC[C@H](N)C(O)=O)C(CC[C@H](N)C(O)=O)=C1 VEVRNHHLCPGNDU-MUGJNUQGSA-O 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 230000006866 deterioration Effects 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000007876 drug discovery Methods 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 229940032049 enterococcus faecalis Drugs 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 229930013356 epothilone Natural products 0.000 description 2
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 238000013467 fragmentation Methods 0.000 description 2
- 238000006062 fragmentation reaction Methods 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- BTCSSZJGUNDROE-UHFFFAOYSA-N gamma-aminobutyric acid Chemical compound NCCCC(O)=O BTCSSZJGUNDROE-UHFFFAOYSA-N 0.000 description 2
- 102000034356 gene-regulatory proteins Human genes 0.000 description 2
- 108091006104 gene-regulatory proteins Proteins 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 235000015220 hamburgers Nutrition 0.000 description 2
- 230000002949 hemolytic effect Effects 0.000 description 2
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 2
- 206010020718 hyperplasia Diseases 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000036737 immune function Effects 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 208000026278 immune system disease Diseases 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- RGXCTRIQQODGIZ-UHFFFAOYSA-O isodesmosine Chemical compound OC(=O)C(N)CCCC[N+]1=CC(CCC(N)C(O)=O)=CC(CCC(N)C(O)=O)=C1CCCC(N)C(O)=O RGXCTRIQQODGIZ-UHFFFAOYSA-O 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 230000002101 lytic effect Effects 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 230000028161 membrane depolarization Effects 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 239000003094 microcapsule Substances 0.000 description 2
- 230000017074 necrotic cell death Effects 0.000 description 2
- 208000015122 neurodegenerative disease Diseases 0.000 description 2
- 230000002314 neuroinflammatory effect Effects 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 230000003472 neutralizing effect Effects 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 230000004962 physiological condition Effects 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229920000306 polymethylpentene Polymers 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 239000000376 reactant Substances 0.000 description 2
- 230000008261 resistance mechanism Effects 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- JQWHASGSAFIOCM-UHFFFAOYSA-M sodium periodate Chemical compound [Na+].[O-]I(=O)(=O)=O JQWHASGSAFIOCM-UHFFFAOYSA-M 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 150000003431 steroids Chemical class 0.000 description 2
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- YSMODUONRAFBET-WHFBIAKZSA-N threo-5-hydroxy-L-lysine Chemical compound NC[C@@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-WHFBIAKZSA-N 0.000 description 2
- 229960004072 thrombin Drugs 0.000 description 2
- 208000008732 thymoma Diseases 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- BJBUEDPLEOHJGE-UHFFFAOYSA-N (2R,3S)-3-Hydroxy-2-pyrolidinecarboxylic acid Natural products OC1CCNC1C(O)=O BJBUEDPLEOHJGE-UHFFFAOYSA-N 0.000 description 1
- JHTPBGFVWWSHDL-UHFFFAOYSA-N 1,4-dichloro-2-isothiocyanatobenzene Chemical compound ClC1=CC=C(Cl)C(N=C=S)=C1 JHTPBGFVWWSHDL-UHFFFAOYSA-N 0.000 description 1
- SVUOLADPCWQTTE-UHFFFAOYSA-N 1h-1,2-benzodiazepine Chemical compound N1N=CC=CC2=CC=CC=C12 SVUOLADPCWQTTE-UHFFFAOYSA-N 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- XABCFXXGZPWJQP-UHFFFAOYSA-N 3-aminoadipic acid Chemical compound OC(=O)CC(N)CCC(O)=O XABCFXXGZPWJQP-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 208000007860 Anus Neoplasms Diseases 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241000228193 Aspergillus clavatus Species 0.000 description 1
- 241000228197 Aspergillus flavus Species 0.000 description 1
- 241001225321 Aspergillus fumigatus Species 0.000 description 1
- 102000004321 Atrophin-1 Human genes 0.000 description 1
- 108090000806 Atrophin-1 Proteins 0.000 description 1
- 101710154607 Azurocidin Proteins 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 102100023932 Bcl-2-like protein 2 Human genes 0.000 description 1
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 102400000967 Bradykinin Human genes 0.000 description 1
- 101800004538 Bradykinin Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 241000589567 Brucella abortus Species 0.000 description 1
- 241001509299 Brucella canis Species 0.000 description 1
- 241001148106 Brucella melitensis Species 0.000 description 1
- 241001148111 Brucella suis Species 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 102100036189 C-X-C motif chemokine 3 Human genes 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 241000222173 Candida parapsilosis Species 0.000 description 1
- 241000222178 Candida tropicalis Species 0.000 description 1
- 241000222157 Candida viswanathii Species 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 102000004041 Caspase 7 Human genes 0.000 description 1
- 108090000567 Caspase 7 Proteins 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108010078239 Chemokine CX3CL1 Proteins 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 241001647372 Chlamydia pneumoniae Species 0.000 description 1
- 241001647378 Chlamydia psittaci Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 241001508813 Clavispora lusitaniae Species 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 206010053567 Coagulopathies Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 102000016574 Complement C3-C5 Convertases Human genes 0.000 description 1
- 108010067641 Complement C3-C5 Convertases Proteins 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- 102000036292 Death effector domains Human genes 0.000 description 1
- 108091010866 Death effector domains Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 102000043859 Dynamin Human genes 0.000 description 1
- 108700021058 Dynamin Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 241000305071 Enterobacterales Species 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000194031 Enterococcus faecium Species 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000589602 Francisella tularensis Species 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 208000021309 Germ cell tumor Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 102100038393 Granzyme H Human genes 0.000 description 1
- 101710113220 Granzyme H Proteins 0.000 description 1
- QXZGBUJJYSLZLT-UHFFFAOYSA-N H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH Natural products NC(N)=NCCCC(N)C(=O)N1CCCC1C(=O)N1C(C(=O)NCC(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CO)C(=O)N2C(CCC2)C(=O)NC(CC=2C=CC=CC=2)C(=O)NC(CCCN=C(N)N)C(O)=O)CCC1 QXZGBUJJYSLZLT-UHFFFAOYSA-N 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 206010019851 Hepatotoxicity Diseases 0.000 description 1
- 241000228404 Histoplasma capsulatum Species 0.000 description 1
- 102100032822 Homeodomain-interacting protein kinase 1 Human genes 0.000 description 1
- 101000904691 Homo sapiens Bcl-2-like protein 2 Proteins 0.000 description 1
- 101000947193 Homo sapiens C-X-C motif chemokine 3 Proteins 0.000 description 1
- 101000854520 Homo sapiens Fractalkine Proteins 0.000 description 1
- 101001066404 Homo sapiens Homeodomain-interacting protein kinase 1 Proteins 0.000 description 1
- 101001008922 Homo sapiens Kallikrein-11 Proteins 0.000 description 1
- 101000638154 Homo sapiens Transmembrane protease serine 2 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- LCWXJXMHJVIJFK-UHFFFAOYSA-N Hydroxylysine Natural products NCC(O)CC(N)CC(O)=O LCWXJXMHJVIJFK-UHFFFAOYSA-N 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- 102100027612 Kallikrein-11 Human genes 0.000 description 1
- 102100038356 Kallikrein-2 Human genes 0.000 description 1
- 101710176220 Kallikrein-2 Proteins 0.000 description 1
- SNDPXSYFESPGGJ-BYPYZUCNSA-N L-2-aminopentanoic acid Chemical compound CCC[C@H](N)C(O)=O SNDPXSYFESPGGJ-BYPYZUCNSA-N 0.000 description 1
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- GMKMEZVLHJARHF-WHFBIAKZSA-N LL-2,6-diaminopimelic acid Chemical compound OC(=O)[C@@H](N)CCC[C@H](N)C(O)=O GMKMEZVLHJARHF-WHFBIAKZSA-N 0.000 description 1
- 241000589242 Legionella pneumophila Species 0.000 description 1
- 241000589929 Leptospira interrogans Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000030070 Malignant epithelial tumor of ovary Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 description 1
- 241000235048 Meyerozyma guilliermondii Species 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100493631 Mus musculus Bcl2l2 gene Proteins 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 1
- 208000031888 Mycoses Diseases 0.000 description 1
- OLYPWXRMOFUVGH-LURJTMIESA-N N(2)-methyl-L-lysine Chemical compound CN[C@H](C(O)=O)CCCCN OLYPWXRMOFUVGH-LURJTMIESA-N 0.000 description 1
- PQNASZJZHFPQLE-UHFFFAOYSA-N N(6)-methyllysine Chemical compound CNCCCCC(N)C(O)=O PQNASZJZHFPQLE-UHFFFAOYSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- OLNLSTNFRUFTLM-BYPYZUCNSA-N N-ethyl-L-asparagine Chemical compound CCN[C@H](C(O)=O)CC(N)=O OLNLSTNFRUFTLM-BYPYZUCNSA-N 0.000 description 1
- OLNLSTNFRUFTLM-UHFFFAOYSA-N N-ethylasparagine Chemical compound CCNC(C(O)=O)CC(N)=O OLNLSTNFRUFTLM-UHFFFAOYSA-N 0.000 description 1
- 108010065338 N-ethylglycine Proteins 0.000 description 1
- YPIGGYHFMKJNKV-UHFFFAOYSA-N N-ethylglycine Chemical compound CC[NH2+]CC([O-])=O YPIGGYHFMKJNKV-UHFFFAOYSA-N 0.000 description 1
- 108010049175 N-substituted Glycines Proteins 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 208000034176 Neoplasms, Germ Cell and Embryonal Diseases 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000036110 Neuroinflammatory disease Diseases 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 1
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 1
- 206010031096 Oropharyngeal cancer Diseases 0.000 description 1
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 1
- 208000007571 Ovarian Epithelial Carcinoma Diseases 0.000 description 1
- 206010061328 Ovarian epithelial cancer Diseases 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 102000016387 Pancreatic elastase Human genes 0.000 description 1
- 108010067372 Pancreatic elastase Proteins 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 241000222051 Papiliotrema laurentii Species 0.000 description 1
- 208000030852 Parasitic disease Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 108010043958 Peptoids Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000235645 Pichia kudriavzevii Species 0.000 description 1
- 241000142787 Pneumocystis jirovecii Species 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000004403 Prostatic Hyperplasia Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 101800004937 Protein C Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 108010030852 RP-1 peptide Proteins 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 241000606695 Rickettsia rickettsii Species 0.000 description 1
- 208000004337 Salivary Gland Neoplasms Diseases 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 241000293871 Salmonella enterica subsp. enterica serovar Typhi Species 0.000 description 1
- 101800001700 Saposin-D Proteins 0.000 description 1
- 102400000827 Saposin-D Human genes 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 102100025517 Serpin B9 Human genes 0.000 description 1
- 101710156153 Serpin B9 Proteins 0.000 description 1
- 241000607760 Shigella sonnei Species 0.000 description 1
- 244000191761 Sida cordifolia Species 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 206010068771 Soft tissue neoplasm Diseases 0.000 description 1
- 241001279364 Stachybotrys chartarum Species 0.000 description 1
- 241000191963 Staphylococcus epidermidis Species 0.000 description 1
- 241001147691 Staphylococcus saprophyticus Species 0.000 description 1
- 241000193985 Streptococcus agalactiae Species 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 201000009365 Thymic carcinoma Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102100031989 Transmembrane protease serine 2 Human genes 0.000 description 1
- 241000589884 Treponema pallidum Species 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 102100031988 Tumor necrosis factor ligand superfamily member 6 Human genes 0.000 description 1
- 108050002568 Tumor necrosis factor ligand superfamily member 6 Proteins 0.000 description 1
- 102000007537 Type II DNA Topoisomerases Human genes 0.000 description 1
- 108010046308 Type II DNA Topoisomerases Proteins 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 206010046431 Urethral cancer Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 108010067973 Valinomycin Proteins 0.000 description 1
- 108010059993 Vancomycin Proteins 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 206010073696 Wallerian degeneration Diseases 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- RTJVUHUGTUDWRK-CSLCKUBZSA-N [(2r,4ar,6r,7r,8s,8ar)-6-[[(5s,5ar,8ar,9r)-9-(3,5-dimethoxy-4-phosphonooxyphenyl)-8-oxo-5a,6,8a,9-tetrahydro-5h-[2]benzofuro[6,5-f][1,3]benzodioxol-5-yl]oxy]-2-methyl-7-[2-(2,3,4,5,6-pentafluorophenoxy)acetyl]oxy-4,4a,6,7,8,8a-hexahydropyrano[3,2-d][1,3]d Chemical compound COC1=C(OP(O)(O)=O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](OC(=O)COC=4C(=C(F)C(F)=C(F)C=4F)F)[C@@H]4O[C@H](C)OC[C@H]4O3)OC(=O)COC=3C(=C(F)C(F)=C(F)C=3F)F)[C@@H]3[C@@H]2C(OC3)=O)=C1 RTJVUHUGTUDWRK-CSLCKUBZSA-N 0.000 description 1
- ATBOMIWRCZXYSZ-XZBBILGWSA-N [1-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxy-3-hexadecanoyloxypropan-2-yl] (9e,12e)-octadeca-9,12-dienoate Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(COP(O)(=O)OCC(O)CO)OC(=O)CCCCCCC\C=C\C\C=C\CCCCC ATBOMIWRCZXYSZ-XZBBILGWSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000007059 acute toxicity Effects 0.000 description 1
- 231100000403 acute toxicity Toxicity 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 229960002684 aminocaproic acid Drugs 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000025164 anoikis Effects 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 230000001775 anti-pathogenic effect Effects 0.000 description 1
- 229960005475 antiinfective agent Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 201000011165 anus cancer Diseases 0.000 description 1
- 230000009925 apoptotic mechanism Effects 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229940091771 aspergillus fumigatus Drugs 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 238000002869 basic local alignment search tool Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940049706 benzodiazepine Drugs 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000005936 beta-Galactosidase Human genes 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 238000001574 biopsy Methods 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- QXZGBUJJYSLZLT-FDISYFBBSA-N bradykinin Chemical compound NC(=N)NCCC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(=O)NCC(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CO)C(=O)N2[C@@H](CCC2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)CCC1 QXZGBUJJYSLZLT-FDISYFBBSA-N 0.000 description 1
- 229940056450 brucella abortus Drugs 0.000 description 1
- 229940038698 brucella melitensis Drugs 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 208000035269 cancer or benign tumor Diseases 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 150000003857 carboxamides Chemical class 0.000 description 1
- 230000005779 cell damage Effects 0.000 description 1
- 208000037887 cell injury Diseases 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000010094 cellular senescence Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 230000007541 cellular toxicity Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 208000011654 childhood malignant neoplasm Diseases 0.000 description 1
- 229940038705 chlamydia trachomatis Drugs 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 230000010428 chromatin condensation Effects 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 230000035602 clotting Effects 0.000 description 1
- 238000011260 co-administration Methods 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- FCFNRCROJUBPLU-UHFFFAOYSA-N compound M126 Natural products CC(C)C1NC(=O)C(C)OC(=O)C(C(C)C)NC(=O)C(C(C)C)OC(=O)C(C(C)C)NC(=O)C(C)OC(=O)C(C(C)C)NC(=O)C(C(C)C)OC(=O)C(C(C)C)NC(=O)C(C)OC(=O)C(C(C)C)NC(=O)C(C(C)C)OC1=O FCFNRCROJUBPLU-UHFFFAOYSA-N 0.000 description 1
- 239000000039 congener Substances 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 229940127096 cytoskeletal disruptor Drugs 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000001784 detoxification Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- ZGSPNIOCEDOHGS-UHFFFAOYSA-L disodium [3-[2,3-di(octadeca-9,12-dienoyloxy)propoxy-oxidophosphoryl]oxy-2-hydroxypropyl] 2,3-di(octadeca-9,12-dienoyloxy)propyl phosphate Chemical compound [Na+].[Na+].CCCCCC=CCC=CCCCCCCCC(=O)OCC(OC(=O)CCCCCCCC=CCC=CCCCCC)COP([O-])(=O)OCC(O)COP([O-])(=O)OCC(OC(=O)CCCCCCCC=CCC=CCCCCC)COC(=O)CCCCCCCC=CCC=CCCCCC ZGSPNIOCEDOHGS-UHFFFAOYSA-L 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- JJJFUHOGVZWXNQ-UHFFFAOYSA-N enbucrilate Chemical compound CCCCOC(=O)C(=C)C#N JJJFUHOGVZWXNQ-UHFFFAOYSA-N 0.000 description 1
- 229950010048 enbucrilate Drugs 0.000 description 1
- 201000006828 endometrial hyperplasia Diseases 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- YSMODUONRAFBET-UHNVWZDZSA-N erythro-5-hydroxy-L-lysine Chemical compound NC[C@H](O)CC[C@H](N)C(O)=O YSMODUONRAFBET-UHNVWZDZSA-N 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000003492 excitotoxic effect Effects 0.000 description 1
- 231100000063 excitotoxicity Toxicity 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 229940118764 francisella tularensis Drugs 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 229960003692 gamma aminobutyric acid Drugs 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- ZRALSGWEFCBTJO-UHFFFAOYSA-N guanidine group Chemical group NC(=N)N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 230000007686 hepatotoxicity Effects 0.000 description 1
- 231100000304 hepatotoxicity Toxicity 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 230000007440 host cell apoptosis Effects 0.000 description 1
- QJHBJHUKURJDLG-UHFFFAOYSA-N hydroxy-L-lysine Natural products NCCCCC(NO)C(O)=O QJHBJHUKURJDLG-UHFFFAOYSA-N 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 230000002390 hyperplastic effect Effects 0.000 description 1
- 230000003463 hyperproliferative effect Effects 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 125000002883 imidazolyl group Chemical group 0.000 description 1
- 230000008076 immune mechanism Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 230000001506 immunosuppresive effect Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 239000012678 infectious agent Substances 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 230000000266 injurious effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 201000008893 intraocular retinoblastoma Diseases 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 230000010220 ion permeability Effects 0.000 description 1
- YWXYYJSYQOXTPL-SLPGGIOYSA-N isosorbide mononitrate Chemical compound [O-][N+](=O)O[C@@H]1CO[C@@H]2[C@@H](O)CO[C@@H]21 YWXYYJSYQOXTPL-SLPGGIOYSA-N 0.000 description 1
- 238000012804 iterative process Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229940115932 legionella pneumophila Drugs 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 230000031852 maintenance of location in cell Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 238000011177 media preparation Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 210000000716 merkel cell Anatomy 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229910021645 metal ion Inorganic materials 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229960003085 meticillin Drugs 0.000 description 1
- 230000003158 microbiostatic effect Effects 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000004065 mitochondrial dysfunction Effects 0.000 description 1
- 229960001156 mitoxantrone Drugs 0.000 description 1
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 229940051866 mouthwash Drugs 0.000 description 1
- 210000004877 mucosa Anatomy 0.000 description 1
- 208000018795 nasal cavity and paranasal sinus carcinoma Diseases 0.000 description 1
- 230000001338 necrotic effect Effects 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 230000004987 nonapoptotic effect Effects 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 229960003104 ornithine Drugs 0.000 description 1
- 201000006958 oropharynx cancer Diseases 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 238000005192 partition Methods 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 210000000680 phagosome Anatomy 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- CZAKJJUNKNPTTO-AJFJRRQVSA-N precursor Z hydrate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@@H]1C(O)(O)[C@H]1[C@@H]2NC(N=C(NC2=O)N)=C2N1 CZAKJJUNKNPTTO-AJFJRRQVSA-N 0.000 description 1
- 230000001855 preneoplastic effect Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 1
- 230000001023 pro-angiogenic effect Effects 0.000 description 1
- 230000000861 pro-apoptotic effect Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 210000005267 prostate cell Anatomy 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 229960000856 protein c Drugs 0.000 description 1
- 238000000455 protein structure prediction Methods 0.000 description 1
- 230000005588 protonation Effects 0.000 description 1
- 238000004451 qualitative analysis Methods 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000000700 radioactive tracer Substances 0.000 description 1
- 238000005932 reductive alkylation reaction Methods 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 210000005084 renal tissue Anatomy 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 229940075118 rickettsia rickettsii Drugs 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 229940115939 shigella sonnei Drugs 0.000 description 1
- 102000034285 signal transducing proteins Human genes 0.000 description 1
- 108091006024 signal transducing proteins Proteins 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000004088 simulation Methods 0.000 description 1
- 201000008261 skin carcinoma Diseases 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 238000007711 solidification Methods 0.000 description 1
- 230000008023 solidification Effects 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 238000002798 spectrophotometry method Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 210000002330 subarachnoid space Anatomy 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000012385 systemic delivery Methods 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 229950003999 tafluposide Drugs 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 208000037816 tissue injury Diseases 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 238000002723 toxicity assay Methods 0.000 description 1
- 231100000041 toxicology testing Toxicity 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- BJBUEDPLEOHJGE-IMJSIDKUSA-N trans-3-hydroxy-L-proline Chemical compound O[C@H]1CC[NH2+][C@@H]1C([O-])=O BJBUEDPLEOHJGE-IMJSIDKUSA-N 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 108010036927 trypsin-like serine protease Proteins 0.000 description 1
- 230000002476 tumorcidal effect Effects 0.000 description 1
- 230000004222 uncontrolled growth Effects 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- FCFNRCROJUBPLU-DNDCDFAISA-N valinomycin Chemical compound CC(C)[C@@H]1NC(=O)[C@H](C)OC(=O)[C@@H](C(C)C)NC(=O)[C@@H](C(C)C)OC(=O)[C@H](C(C)C)NC(=O)[C@H](C)OC(=O)[C@@H](C(C)C)NC(=O)[C@@H](C(C)C)OC(=O)[C@H](C(C)C)NC(=O)[C@H](C)OC(=O)[C@@H](C(C)C)NC(=O)[C@@H](C(C)C)OC1=O FCFNRCROJUBPLU-DNDCDFAISA-N 0.000 description 1
- 229960000653 valrubicin Drugs 0.000 description 1
- ZOCKGBMQLCSHFP-KQRAQHLDSA-N valrubicin Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)CCCC)[C@H]1C[C@H](NC(=O)C(F)(F)F)[C@H](O)[C@H](C)O1 ZOCKGBMQLCSHFP-KQRAQHLDSA-N 0.000 description 1
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical compound O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 1
- 229960003165 vancomycin Drugs 0.000 description 1
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
- 230000008734 wallerian degeneration Effects 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N47/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom not being member of a ring and having no bond to a carbon or hydrogen atom, e.g. derivatives of carbonic acid
- A01N47/40—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom not being member of a ring and having no bond to a carbon or hydrogen atom, e.g. derivatives of carbonic acid the carbon atom having a double or triple bond to nitrogen, e.g. cyanates, cyanamides
- A01N47/42—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom not being member of a ring and having no bond to a carbon or hydrogen atom, e.g. derivatives of carbonic acid the carbon atom having a double or triple bond to nitrogen, e.g. cyanates, cyanamides containing —N=CX2 groups, e.g. isothiourea
- A01N47/44—Guanidine; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6415—Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4747—Apoptosis related proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2795/00—Bacteriophages
- C12N2795/00011—Details
- C12N2795/10011—Details dsDNA Bacteriophages
- C12N2795/10031—Uses of virus other than therapeutic or vaccine, e.g. disinfectant
Definitions
- the present invention relates generally to compositions and methods for inducing cell death, and more specifically to peptides and compositions having antimicrobial, anti-cancer, anti-inflammatory and/or anti-proliferative activity and methods of using the peptides and compositions as therapeutics.
- Programmed cell death pathways are known to exist in most if not all organisms on Earth, ranging from microbes to man. Proteins that effect this function, also known as apoptosis, have been identified in human, other mammals, plants, protozoa, fungi, and bacteria, among other forms of life. In humans, these proteins target the mitochondria, causing permeabilization, dissipation of the membrane potential, activation of intracellular signaling pathways, and ultimate death of the cell. Eukaryotic pathogens also contain mitochondria, and mitochondria are now widely accepted by evolutionary biologists to be decedents of specialized symbiotic bacteria in eukaryotic cells.
- prokaryotic proteins have necessarily evolved to control prokaryotic symbionts (eg. mitochondria, chloroplasts) or competitors, and directly or indirectly prompt death of microbes or infected or abnormal cells.
- prokaryotic symbionts eg. mitochondria, chloroplasts
- prokaryotic symbionts eg. mitochondria, chloroplasts
- mechanisms of action eg., membrane interaction or perturbation that can lead to programmed cell death.
- proteins may serve as excellent templates for novel therapeutic molecules, and reveal new insights into host-pathogen co-evolution, cancer biology, and other disease prevention, pathogenesis and treatment.
- Embodiments of the invention provide isolated peptides, protides and conjugates having novel peptide sequences which are able to induce antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
- Peptides, protides and conjugates provided by the invention comprise, consist essentially of, or consist of amino acid sequences represented by SEQ ID NOS:1-263 and 288-289.
- peptides, protides and conjugates described herein have conservative amino acid substitutions or alternative residues at specific locations within a peptide sequence.
- Non-limiting examples of such substitutions or alternative residues include when the amino acid residue is represented by (x) a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue can be substituted, or alternatively, when the amino acid residue is represented by (b) a lysine, an arginine, an asparagine, a glutamine or a basic residue can be substituted, or alternatively, when the amino acid residue is represented by (j) a cysteine or a thiol residue can be substituted, or alternatively, when the amino acid residue is represented by (o) an anthrylalanine or other non-natural amino acid can be substituted.
- Embodiments of the invention also provide methods of inducing programmed cell death in a cell by exposing the cell to an isolated peptide, protide or conjugate described herein.
- the methods can be used in the diagnosis, prevention, or treatment of a disease, such as an infection, cancer, autoimmune disease, or inflammatory disease.
- FIG. 1 shows the amino acid sequence of exemplary programmed cell death/holin-like proteins (Dnm-1 (SEQ ID NO:280), Bax (SEQ IN NO:281) and Bcl-2 (SEQ ID NO:282)) identified in Homo sapiens.
- Dnm-1 SEQ ID NO:280
- Bax SEQ IN NO:281
- Bcl-2 SEQ ID NO:282
- FIG. 2 shows the amino acid sequence of exemplary programmed cell death proteins (CidA (SEQ ID NO:283) and LrgA (SEQ IN NO:284)) identified in Staphylococcus aureus.
- FIG. 3 shows the amino acid sequence of exemplary candidate proteins (Perforin 1 from Bos taurus (SEQ ID NO:285), Bcl-2 from Homo sapiens (SEQ ID NO:286), and BCL-W from Homo sapiens (SEQ ID NO:287)) used for the iterative primary structure analysis of the protein databases (Blastp and/or equivalent thereof) available from the National Center for Biotechnology Information utilizing the basic local alignment sequence tool (BLAST).
- BLAST basic local alignment sequence tool
- FIG. 4 shows an exemplary data score table sorted by alignment score using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- ClustalW the multisequence alignment tool
- FIG. 5 shows exemplary multisequence alignments using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- FIG. 6 shows a phylogram of candidate programmed cell death effector peptides using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- FIG. 7 shows a similarity alignment of helical region 1 (amino acids- ⁇ 450-490) between candidate peptides identified in the phylogram of FIG. 6 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- FIG. 8 shows a similarity alignment of helical region 2 (amino acids- ⁇ 540-560) between candidate peptides identified in the phylogram of FIG. 6 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- FIG. 9 shows a similarity alignment of helical region 3 (amino acids- ⁇ 590-620) between candidate peptides identified in the phylogram of FIG. 6 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- FIG. 10 shows a cladogram of candidate programmed cell death effector molecule subset 1 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- ClustalW the multisequence alignment tool
- FIG. 11 shows a similarity alignment of helical region 1/subset 1 (amino acids- ⁇ 180-225) between candidate programmed cell death effector molecules identified in the cladogram of FIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- FIG. 12 shows a similarity alignment of helical region 2/subset 1 (amino acids- ⁇ 270-290) between candidate programmed cell death effector molecules identified in the cladogram of FIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- ClustalW the multisequence alignment tool
- FIG. 13 shows a similarity alignment of helical region 3/subset 1 (amino acids- ⁇ -320-360) between candidate programmed cell death effector molecules identified in the cladogram of FIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- ClustalW the multisequence alignment tool
- FIG. 14 shows a similarity alignment of helical region 4/subset 1 (amino acids- ⁇ 490-530) between candidate programmed cell death effector molecules identified in the cladogram of FIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI.
- ClustalW the multisequence alignment tool
- FIG. 15 shows a secondary structure diagram of human Bcl-2, isoform 1 or 2.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence NREIVMKYIHYKLS (residues 1-14 of SEQ ID NO:48) of a peptide predicted to have antimicrobial activity is shown in yellow.
- FIG. 16 shows a secondary structure diagram of human Bcl-2, isoform 1 or 2.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence HLALRQAGDDFSRRYR having a peptide predicted to have antimicrobial activity (SEQ ID NO:53) is shown in yellow.
- FIG. 17 shows a secondary structure diagram of human Bcl-xL.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence SQSNRELVVDFLSYKLSQK (SEQ ID NO:288) of a peptide predicted to have antimicrobial activity is shown in yellow.
- amino acid sequence SQSNRELVVDFLSYKLSQK (SEQ ID NO:288) has also been identified as being conserved in multiple PCD-effector templates, including human Bcl-xL and Bcl-x ⁇ , murine Bcl-x ⁇ , and various related proteins.
- FIG. 18 shows a secondary structure diagram of human Bcl-W.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence TRALVADFVGYKLRQK (residues 1-16 of SEQ ID NO:14) of a peptide predicted to have antimicrobial activity is shown in yellow.
- FIG. 19 shows a secondary structure diagram of human Bax.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils.
- the arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence RVVALFYFASKLVLKALCTK (residues 1-20 of SEQ ID NO:7) of a peptide predicted to have antimicrobial activity is shown in yellow.
- FIG. 20 shows a secondary structure diagram of human CTL Granulysin.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence RDYRTCLTIVQKLKKM having a peptide predicted of have antimicrobial activity is shown in yellow.
- FIG. 21 shows secondary structure diagram of human CTL Granulysin.
- Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction.
- the amino acid sequence QKLKKIVIVDKPTQRSVSN (SEQ ID NO:289) of a peptide predicted to have antimicrobial activity is shown in yellow.
- FIG. 22 shows a secondary structure ribbon diagram of human Bax (1F16) protein. Helix-1, residues 104-129 are represented in red.
- FIG. 23 shows a secondary structure ribbon diagram of human Bax Helix-1, residues 104-129.
- Structure A shows the location of positive residues in blue.
- Structure B shows the most hydrophilic residues in blue and the most hydrophobic in brown.
- FIG. 24 shows a secondary structure ribbon diagram of human Bax (1F16) protein. Helix-2, residues 168-190 are represented in red.
- FIG. 25 shows a secondary structure ribbon diagram of human Bax Helix-2, residues 168-190.
- Structure A shows the location of positive residues in blue.
- Structure B shows the most hydrophilic residues as represented in blue and the most hydrophobic residues as represented in brown.
- FIG. 26 panels A-D, show three dimensional alignments between human Bax Helix-1, residues 104-129 vs. IL-8 helix, residues 55-72.
- Panel A shows a sequence alignment based on the following structural alignment.
- Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 104-129 (Red) and IL-8, residues 56-72 (Blue), whereas panel C shows an axial view of the same alignment.
- Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment.
- RMSD root mean square deviation
- FIG. 27 panels A-D, show three dimensional alignments between human Bax helix, residues 168-190 vs. IL-8 helix, residues 55-72.
- Panel A shows a sequence alignment based on the following structural alignment.
- Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 168-190 (Red) and IL-8, residues 55-72 (Blue), whereas panel C shows an axial view of the same alignment.
- Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment.
- RMSD root mean square deviation
- FIG. 28 panels A-D, show three dimensional alignments between human Bax helix, residues 104-129 vs. magainin residues 1-16.
- For the alignment analyses comparative sequences of X and Y length are entered, and the computation prioritizes which span of those length are most comparable.
- Panel A shows a sequence alignment based on the following structural alignment.
- Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 104-129 (Red) and magainin, residues 1-16 (Blue), whereas panel C shows an axial view of the same alignment.
- Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment.
- RMSD root mean square deviation
- FIG. 29 panels A-D, show three dimensional alignments between human Bax helix, residues 168-190 vs. magainin residues 1-16.
- For the alignment analyses comparative sequences of X and Y length are entered, and the computation prioritizes which span of those length are most comparable.
- Panel A shows a sequence alignment based on the following structural alignment.
- Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 168-190 (Red) and magainin, residues 1-16 (Blue), whereas panel C shows an axial view of the same alignment.
- Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment.
- RMSD root mean square deviation
- FIG. 30 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4, LrgA-I-4 and CidA-II-12 against pathogenic bacteria and fungi at pH 7.5.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations.
- FIG. 31 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4, LrgA-I-4 and CidA-II-12 against pathogenic bacteria and fungi at pH 5.5.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations.
- FIG. 32 shows a histogram of the antimicrobial spectra of exemplary peptides Dnm2-II-4, Dnm1-IV-2, Ncl-VIII-6 and Mfn1-II-2 against pathogenic bacteria and fungi at pH 7.5.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations.
- FIG. 33 shows a histogram of the antimicrobial spectra of exemplary peptides Dnm2-II-4, Dnm1-IV-2, Ncl-VIII-6 and Mfn1-II-2 against pathogenic bacteria and fungi at pH 5.5.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations.
- FIG. 34 shows a histogram of the antimicrobial spectra of exemplary peptides BclWP-I-4, Csp3-II-12, BclXb-I-2 and BaxP-I-18 against pathogenic bacteria and fungi at pH 7.5.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations.
- FIG. 35 shows a histogram of the antimicrobial spectra of exemplary peptides BclWP-I-4, Csp3-II-12, BclXb-I-2 and BaxP-I-18 against pathogenic bacteria and fungi at pH 5.5.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations.
- FIG. 36 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa CRM27853 at pH 5.5.
- Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 37 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa PA 01 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 38 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa XEN 5 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 39 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii 19606 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 40 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii 17978 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 41 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter calcoaceticus 23055 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 42 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter haemolyticus 17906 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 43 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #ATCC at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 44 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #1 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 45 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #6 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 46 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #12 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 47 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa CRM27853 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 48 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa PA 01 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 49 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa XEN 5 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 50 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii 19606 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 51 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii 17978 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 52 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter calcoaceticus 23055 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 53 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter haemolyticus 17906 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 54 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #ATCC at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 55 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #1 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 56 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #6 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- FIG. 57 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #12 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown.
- the size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar.
- Embodiments provided by the invention are based in part on the observations that 1) programmed cell death and apoptosis pathway proteins contain archetype sequences that confer membrane interacting/modifying domains similar to those of antimicrobial or other host defense peptides; 2) such sequences encode helical or other sequence and/or 3D structural signatures; and 3) such peptides exert antimicrobial and anti-cancer cell activities.
- such peptides induce or regulate programmed cell death or related responses in target cells (e.g. microbial pathogens, cancer cells, etc.) leading to death of these cells. It is also contemplated that the mechanisms of action of peptides based on programmed cell death may activate archetypal apoptosis pathways in target cells, thus killing the target cell and circumventing resistance to existing antimicrobial, anti-cancer, or other preventive or therapeutic agents.
- target cells e.g. microbial pathogens, cancer cells, etc.
- the mechanisms of action of peptides based on programmed cell death may activate archetypal apoptosis pathways in target cells, thus killing the target cell and circumventing resistance to existing antimicrobial, anti-cancer, or other preventive or therapeutic agents.
- Embodiments of the invention provide that novel antimicrobial, anti-cancer, anti-inflammatory and/or anti-proliferative activity peptides reside in peptide sequences of programmed cell death effector proteins by virtue of the evolutionary necessity for control of microbial and cancer cell survival by increasingly complex eukaryotic systems/symbionts.
- mitochondrial, chloroplast, and/or nuclear-encoded proteins capable of activating and/or modulating programmed cell death pathways are contemplated to be evolutionary relatives/descendents of polypeptides that originally provided a survival advantage in the face of microbial or neoplastic challenge.
- the peptides, protides and conjugates described herein have the potential to create, augment, or improve several existing therapeutic, prophylactic, diagnostic, and basic research problems.
- these peptides, protides and conjugates can address the problem of antibiotic-resistant infections and antineoplastic-resistant cancers.
- the peptides, protides and conjugates may serve as immunotherapeutic agents to enhance or restore efficacy of endogenous host defenses.
- these peptides, protides and conjugates will increase efficacy of conventional agents (such as antibiotics or anti-neoplastic agents), enhance immune functions, and activate or inactivate apoptotic mechanisms of cell regulation associated with aging or other degenerative conditions, and many other potential applications.
- peptides, protides and conjugates can be used as diagnostic probes in isotopic or non-isotopic forms to localize or characterize diseases or conditions containing signatures such as those characteristic of microbial, neoplastic, necrotic, apoptotic, or other tissues or cells.
- extensions of the above concepts are applicable to the construction, design, delivery, and use of such peptides as research reagents.
- novel concepts relating to structure-activity relationships in programmed cell death proteins enabled the design of novel antimicrobial, anti-cancer, anti-inflammatory and anti-proliferative peptides, protides and conjugates.
- These peptides and compositions are useful as diagnostic, prophylactic, and/or therapeutic agents that exploit programmed cell death pathways in pathogens, cancer cells, autoimmune cells, and other disease-caused cells and tissues.
- Specific examples of peptides, variants, congeners, and mimetics of these molecules are included herein.
- Embodiments of the invention provide conjugates in which one given molecule can represent or include one or more antimicrobial, anti-cancer, anti-inflammatory, immunomodulatory peptide and one or more non-peptide functional motifs or domains, or combinations of these.
- Embodiments of the invention also provide protides which are multifunctional and context-activated polypeptides that have two or more effectors with individually distinct biological functions and one or more corresponding activator sites that can each initiate or amplify the biological function of one or more effectors upon context-activation. Therefore, peptides, protides and conjugates exemplified herein are relevant to Antibiotide, Immodulotide, Antineotide, Apoptide, and/or Cascatide class peptides.
- novel concepts, peptide design strategies, and exemplifying peptides encompass conceptual as well as material inventions. Moreover, variations upon these fundamental themes are applicable to novel therapeutic agents and strategies in virtually any area of medicine, including, but not limited to diagnosis, prevention, and therapy of infectious diseases, cancer and cancer-like diseases, immune and autoimmune disorders, cardiology, aging, and/or other conditions or disease states. Furthermore, the novel peptides based on programmed cell death effectors described herein represent agents and strategies to treat human, animal, and agricultural diseases. Other applications include their use in diagnosis, prevention, or research of diseases, or as research tools to investigate pathogenesis, apoptosis, or related biological phenomena.
- Embodiments of the invention herein provide an isolated peptide comprising one or more amino acid sequences selected from the group consisting of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the amino acid residue represented by (j) is a cysteine or a thio
- the isolated peptide comprises one or more amino acid sequence, identified from the Bax protein, which are represented by amino acid sequences of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 264, 270 and 271.
- the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-W protein, which are represented by amino acid sequences of SEQ ID NOS: 17, 18, 19, 21-25, 269 and 272.
- the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-x ⁇ protein, which are represented by amino acid sequences of SEQ ID NOS: 30, 31-36 and 273.
- the isolated peptide comprises one or more amino acid sequence, identified from the Bak protein, which are represented by amino acid sequences of SEQ ID NOS: 39-47. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 49-52. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-2 isoform 1 protein, which are represented by amino acid sequences of SEQ ID NOS: 54-57. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Mth-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 59-63 and 274.
- the isolated peptide comprises one or more amino acid sequence, identified from the Mfn-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 66-75. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Dnm-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 84-93 and 275. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Dnm-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 102-106, 108-121, 267, 276 and 277.
- the isolated peptide comprises one or more amino acid sequence, identified from the Ncl protein, which are represented by amino acid sequences of SEQ ID NOS: 132-175. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Csp3 protein, which are represented by amino acid sequences of SEQ ID NOS: 179-187, 266 and 278. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bad protein, which are represented by amino acid sequences of SEQ ID NOS: 191-199. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Prf-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 205-209 and 211-223.
- the isolated peptide comprises one or more amino acid sequence, identified from the Granulysin protein, which are represented by amino acid sequences of SEQ ID NOS: 227-235. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the CidA protein, which are represented by amino acid sequences of SEQ ID NOS: 238-243, 245-247, 265 and 279. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the LrgA protein, which are represented by amino acid sequences of SEQ ID NOS: 249-251. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Lambda S21 protein, which are represented by amino acid sequences of SEQ ID NOS: 253-256. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Holin protein, which are represented by amino acid sequences of SEQ ID NOS: 260-263 and 268.
- Embodiments of the invention provide an isolated peptide consisting of an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 2, 5, 7, 9, 12, 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289, wherein the peptide induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
- the isolated peptide consists of one or more amino acid sequence, identified from the Bax protein, which are represented by amino acid sequences of SEQ ID NOS: 1, 2, 5, 7, 9 and 12. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bcl-W protein, which are represented by amino acid sequences of SEQ ID NOS: 14-16 and 20. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bcl-x ⁇ protein, which are represented by amino acid sequences of SEQ ID NOS: 26-29. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bak protein, which are represented by amino acid sequences of SEQ ID NOS: 37 or 38.
- the isolated peptide consists of the amino acid sequence, identified from the Bcl-2 protein, which is represented by amino acid sequence of SEQ ID NO: 48. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the Bcl-2 isoform 1 protein, which is represented by amino acid sequence of SEQ ID NOS: 53. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Mfn-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 58 or 64. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Mfn-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 65 or 72.
- the isolated peptide consists of one or more amino acid sequence, identified from the Dnm-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 76-83. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Dnm-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 94-101, 107 and 114. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Ncl protein, which are represented by amino acid sequences of SEQ ID NOS: 122-131 and 170.
- the isolated peptide consists of one or more amino acid sequence, identified from the Csp3 protein, which are represented by amino acid sequences of SEQ ID NOS: 176-178. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bad protein, which are represented by amino acid sequences of SEQ ID NOS: 188-190. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Prf-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 200-204 and 210. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Granulysin protein, which are represented by amino acid sequences of SEQ ID NOS: 224-226.
- the isolated peptide consists of one or more amino acid sequence, identified from the CidA protein, which are represented by amino acid sequences of SEQ ID NOS: 236, 237 and 244. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the LrgA protein, which is represented by amino acid sequence of SEQ ID NOS: 248. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the Lambda S21 protein, which is represented by amino acid sequences of SEQ ID NOS: 252. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Holin protein, which are represented by amino acid sequences of SEQ ID NOS: 257-259.
- the isolated peptide consists of one or more amino acid sequence, identified from human Bcl-xL protein, which is represented by the amino acid sequence SEQ ID NO: 288 or human CTL Granulysin, which is represented by the amino acid sequence SEQ ID NO: 289.
- an isolated peptide as described herein has a C-terminus comprising a carboxamide.
- Embodiments of the invention are intended to be used as in ways similar to antibiotic, anti-cancer, or similar medical administration either as local (e.g. topical, oral rinse, inhaled, nebulized, etc.) or systemic (oral ingestion, intravenous, intramuscular, etc) agents.
- the peptides may be used as research tools for basic molecular biology, microbiology, biochemistry or other disciplines as they relate broadly to cellular or molecular biology, infection and immunity, cell regulation and apoptosis, gene expression, signal transduction, or any other area of investigation in which a concept, approach, or specific peptide or may be used.
- the invention provides novel isolated peptides having one or more continuous amino acids sequences.
- a “peptide” generally has from about 3 to about 100 amino acids, whereas a polypeptide or protein has about 100 or more amino acids, up to a full length sequence translated from a gene. Additionally, as used herein a peptide can be a subsequence or a portion of a polypeptide or protein.
- the size of at least one peptide may comprise, but is not limited to, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 amino acid residues.
- amino acid residue refers to any naturally or non-naturally occurring amino acid, any amino acid derivative or any amino acid mimic known in the art.
- the residues of the peptide are sequential, without any non-amino acid interrupting the sequence of amino acid residues.
- the sequence may comprise one or more non-amino acid moieties.
- the sequence of residues of the peptide may be interrupted by one or more non-amino acid moieties.
- the term peptide encompasses amino acid sequences comprising at least one of the 20 common amino acids found in naturally occurring proteins, or at least one modified or unusual or non-natural amino acid, including, but not limited to, Anthrylalanine, 2 Aminoadipic acid (Aad), N Ethylasparagine (EtAsn), 3 Aminoadipic acid (Baad), Hydroxylysine (Hyl), ⁇ alanine, ⁇ Amino propionic acid (Bala), allo Hydroxylysine (AHyl), 2 Aminobutyric acid (Abu), 3 Hydroxyproline (3Hyp), 4 Aminobutyric acid (4Abu), 4 Hydroxyproline (4Hyp), 6 Aminocaproic acid (Acp), Isodesmosine (Ide), 2 Aminoheptanoic acid (Ahe), allo Isoleucine (AIle), 2 Aminoisobutyric acid (Aib), N Methryla
- a peptide containing one or more mimetic structures having a similar charge and spatial or steric arrangements as the reference amino acid residues is included within the definition of the term so long as the peptide containing the mimetic portion exhibits a similar or enhanced activity as compared with the reference peptide.
- a peptide described herein includes such mimetics as chemically modified peptides, peptide-like molecules containing non-naturally occurring amino acids, and peptoids, which are peptide-like molecules resulting from oligomeric assembly of N-substituted glycines, with similar or enhanced activity as compared with the reference protide upon which the mimetic is derived or having any other property desired by the user, for example, enhanced biostability (see, for example, Goodman and Ro, Peptidomimetics for Drug Design, in “Burger's Medicinal Chemistry and Drug Discovery” Vol. 1 (ed. M. E.
- Mimetics also include constrained-structures so as to maintain optimal spacing and charge interactions of the amino acid or of the amino acid functional groups. Those skilled in the art know or can determine what structures constitute functionally equivalent amino acid analogs and amino acid mimetics useful for preparation of a peptide described herein.
- amino acid analogs and mimetics can be found described in, for example, Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, Eds. Gross and Meinhofer, Vol. 5, p. 341, Academic Press, Inc., New York, N.Y. (1983), the entire volume of which is incorporated herein by reference.
- Other examples include peralkylated amino acids, particularly permethylated amino acids. See, for example, Combinatorial Chemistry, Eds. Wilson and Czarnik, Ch. 11, p. 235, John Wiley & Sons Inc., New York, N.Y. (1997), which is incorporated herein by reference in its entirety.
- Yet other examples include amino acids whose amide portion and, therefore, the amide backbone of the resulting peptide, has been replaced, for example, by a sugar ring, steroid, benzodiazepine or carbo cycle. See, for example, Burger's Medicinal Chemistry and Drug Discovery, supra, Ch. 15, pp. 619 620, which is incorporated herein by reference in its entirety.
- Methods for synthesizing peptides, polypeptides, peptidomimetics and proteins are well known in the art (see, for example, U.S. Pat. No. 5,420,109; Bodanzsky, Principles of Peptide Synthesis (1st ed. & 2d rev. ed.), Springer-Verlag, New York, N.Y. (1984 & 1993), see Chapter 7; Stewart and Young, Solid Phase Peptide Synthesis, (2d ed.), Pierce Chemical Co., Rockford, Ill. (1984), each of which is incorporated-herein by reference in its entirety).
- the peptide, protide or conjugate can comprise conservatively substituted sequences or alternative residues at specifically identified positions described herein, for example, residues identified in SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263.
- a conservative substitution refers to replacement of a given amino acid residue with a residue having similar physiochemical characteristics.
- conservative substitutions include (1) non-polar amino acids (Gly, Ala, Val, Leu, and Ile); (2) polar neutral amino acids (Cys, Met, Ser, Thr, Asn, and Gln); (3) polar acidic amino acids (Asp and Glu); (4) polar basic amino acids (Lys, Arg and His); and (5) aromatic amino acids (Phe, Trp, Tyr, and His).
- Other such conservative substitutions include substitutions of entire regions having similar hydrophobicity characteristics or substitution of one H-bond donor/acceptor with another H-bond donor/acceptor.
- An alternative residue refers to a residue that may not be traditionally considered a conservative substitution, but when substituted at the designated position does not adversely effect the functional characteristics of the peptide.
- Hydrogen bonding is a non-covalent type of bonding between molecules or within them, intermolecularly or intramolecularly, and in the context of the peptides described herein include H-bond between amino acids.
- the H-bond donor is the molecule that has a hydrogen atom bonded to a highly electronegative, small atom with available valence.
- H—O, H—N, and H—F bonds are extremely polar and as a result, the electron density is easily withdrawn from the hydrogen atom towards the electronegative atom.
- the partially positive hydrogen in one molecule attracts to partially negative lone pair of the electronegative atom on the other molecule, i.e. an H-bond acceptor, and thus a H-bond forms as a result of such an interaction.
- a “basic” residue refer to an amino acid residue which has a second basic group, which can be, but is not limited to, an amino group (i.e. lysine), a guanidine group (i.e. arginine), or an imidazole ring (i.e. histidine).
- a “thiol” residue refers to an amino acid residue which has a functional sulfur-hydrogen present in the side chain (i.e. cysteine or methionine).
- a thiol residue, such as cysteine can also play an important role in the folding and stability of some peptides and proteins through the formation of disulfide bonds.
- a pathological condition appropriate for treatment with a peptide, protide or conjugate described here can be a symptomatic disease or other abnormal condition or injury of a mammalian cell or tissue.
- pathological conditions include, for example, hyperproliferative and unregulated neoplastic cell growth, degenerative conditions, inflammatory diseases, autoimmune diseases and infectious diseases.
- Hyperplastic and cancer cells proliferate in an unregulated manner, causing destruction of tissues and organs.
- Specific examples of hyperplasias include benign prostatic hyperplasia and endometrial hyperplasia.
- Abnormal cellular growth can also result from infectious diseases in which foreign organisms cause excessive growth.
- human papilloma viruses can cause abnormal growth of tissues.
- the growth of cells infected by a pathogen is abnormal due to the alteration of the normal condition of a cell resulting from the presence of a foreign organism.
- infectious diseases include DNA and RNA viral diseases, bacterial diseases, fungal diseases, and protozoal or parasitic diseases.
- the cells mediating autoimmune and inflammatory diseases are aberrantly regulated which results in, for example, the continued proliferation and activation of immune mechanisms with the destruction of tissues and organs.
- anti-inflammatory activity refers to a cellular response to a substance or treatment that reduces inflammation
- anti-proliferative activity refers to a cellular response to a substance that prevents the proliferation or uncontrolled dividing of cells.
- autoimmune diseases include, for example, rheumatoid arthritis and systemic lupus erythmatosis.
- degenerative disease include osteoarthritis and Alzheimer's disease.
- infectious diseases, degenerative diseases, autoimmune diseases and inflammatory diseases are intended to include all classes and types of these pathological conditions. Those skilled in the art will know the various classes and types of proliferative, neoplastic, infectious, autoimmune and inflammatory diseases.
- cancer is intended to include all known cancers, whether characterized as malignant, benign, soft tissue or solid tumors, or hematologic tumors relating to cells in circulation, such as Anal Cancer, Basal Cell Carcinoma, Bladder Cancer, Bone Cancer (Osteosarcoma and Malignant Fibrous Histiocytoma), Brain Tumor, Breast Cancer, Bronchial Tumors, Burkitt Lymphoma, Central Nervous System Lymphoma, Cervical Cancer, Childhood Cancers, Colon Cancer, Colorectal Cancer, Eye Cancer (Intraocular Melanoma or Retinoblastoma), Gallbladder Cancer, Gastric (Stomach) Cancer, Germ Cell Tumor, Head and Neck Cancer, Kidney (Renal Cell) Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer (Non-Small Cell), L
- anti-cancer activity refers to a cellular response to a substance that kills or inhibits the growth of a cancer cell.
- Cancer cells typically display uncontrolled growth (division beyond the normal limits), invasion (intrusion on and destruction of adjacent tissues), and sometimes metastasis (spread to other locations in the body via lymph or blood).
- Peptides, protides and conjugates described herein which have anti-cancer activity can kill the cancer cell or prevent the invasion or metastasis of the cancer cell into other tissues. It is contemplated that the mechanism of action through which this activity occurs is through the programmed cell death or related responses in the cells.
- Antimicrobial activity refers to a cellular response to a substance that kills or inhibits the growth of a microorganism, such as bacteria, fungi or protozoans. Peptides described herein which have antimicrobial activity can either kill the microorganism (microbicidal) or prevent the growth of the microorganism (microbistatic). In some aspects, the peptides, protides and conjugates described herein show antimicrobial activity again pathogenic microorganisms.
- a “pathogenic microorganism” refers to a microorganism that causes a disease, disorder or condition, which is commonly referred to as an infection.
- Pathogenic microorganisms are well known to one of skill in the art and include pathogenic bacteria such as Acinotobacter baumannii, Acinotobacter calcoaceticus, Acinotobacter haemolyticus, Bordetella pertussis, Borrelia burgdorferi, Brucella abortus, Brucella canis, Brucella melitensis, Brucella suis, Campylobacter jejuni, Chlamydia pneumoniae, Chlamydia psittaci, Chlamydia trachomatis, Clostridium botulinum, Clostridium difficile, Clostridium perfringens, Clostridium tetani, Corynebacterium diphtheriae, Enterococcus faecalis, Enterococcus faecum, Escherichia coli, Francisella tularensis, Haemophilus influenzae, Helicobacter pylori, Legionella pneumophila
- Microbial pathogens exhibiting resistance to one or more antibiotics can now commonly be found in community and nosocomial settings.
- Antibiotic resistant pathogens currently of the greatest concern are methicillin (multiple) resistant Staphylococcus aureus (MRSA), vancomycin resistant Enterococcus faecalis and Enterococcus faecium (VRE), multi-drug-resistant Streptococcus pneumoniae (MDRSPn) or Streptococcus pyogenes (MDRBRSPy), Pseudomonas aeruginosa (MDRA), and Candida albicans (MDRCA).
- MRSA methicillin (multiple) resistant Staphylococcus aureus
- VRE vancomycin resistant Enterococcus faecalis and Enterococcus faecium
- MDRSPn multi-drug-resistant Streptococcus pneumoniae
- MDRBRSPy Streptococcus pyogenes
- PCD Programmed cell death
- apoptosisin type I cell-death
- autophagic type II cell death
- Apoptosisin also known as apoptosis, is a series of biochemical events leading to a characteristic cell morphology including blebbing, loss of membrane asymmetry and attachment, cell shrinkage, nuclear fragmentation, chromatin condensation and chromosomal DNA fragmentation known as laddering.
- Autophagic PCD is a catabolic process involving the degradation of a cell's own components and organelles through the lysosomal machinery prior to the nucleus being destroyed. Additionally, in some aspects, PCD refers to other pathways that have been described including non-apoptotic (i.e. caspase-independent) programmed cell-death, necrosis-like programmed cell death, anoikis, excitotoxicity and Wallerian degeneration.
- Embodiments of the invention provide a context-activated protide having at least one activator site and two or more effectors, wherein at least one effector comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the
- Embodiments of the invention also provide a context-activated protide comprising at least one activator site and two or more effectors, wherein at least one effector comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 2, 5, 7, 9, 12, 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289, wherein the at least one effector induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity
- the protide has at least one effector comprising an amino acid sequence, identified from the Bax protein, referenced by the amino acid sequence of SEQ ID NOS: 1-13, 264, 270 and 271. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-W protein, referenced by the amino acid sequence of SEQ ID NOS: 14-25, 269 and 272. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-x ⁇ protein, referenced by the amino acid sequence of SEQ ID NOS: 26-36 and 273.
- the protide has at least one effector comprising an amino acid sequence, identified from the Bak protein, referenced by the amino acid sequence of SEQ ID NOS: 37-47. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 48-52. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-2 isoform 1 protein, referenced by the amino acid sequence of SEQ ID NOS: 53-57.
- the protide has at least one effector comprising an amino acid sequence, identified from the Mfn-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 58-64 and 274. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Mfn-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 65-75. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Dnm-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 76-93 and 275.
- the protide has at least one effector comprising an amino acid sequence, identified from the Dnm-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 94-121, 267, 276 and 277. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Ncl protein, referenced by the amino acid sequence of SEQ ID NOS: 122-175. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Csp3 protein, referenced by the amino acid sequence of SEQ ID NOS: 176-187, 266 and 278.
- the protide has at least one effector comprising an amino acid sequence, identified from the Bad protein, referenced by the amino acid sequence of SEQ ID NOS: 188-199. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Prf-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 200-223. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Granulysin protein, referenced by the amino acid sequence of SEQ ID NOS: 224-235.
- the protide has at least one effector comprising an amino acid sequence, identified from the CidA protein, referenced by the amino acid sequence of SEQ ID NOS: 236-247, 265 and 279. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the LrgA protein, referenced by the amino acid sequence of SEQ ID NOS: 248-251. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Lambda S21 protein, referenced by the amino acid sequence of SEQ ID NOS: 252-256.
- the protide has at least one effector comprising an amino acid sequence, identified from the Holin protein, referenced by the amino acid sequence of SEQ ID NOS: 257-263 and 268.
- the protide has at least one effector comprising an amino acid sequence, identified from human Bcl-xL protein, which is represented by the amino acid sequence SEQ ID NO: 288 or human CTL Granulysin, which is represented by the amino acid sequence SEQ ID NO: 289.
- the activator site is context-activated.
- the invention also provides that upon context-activation, the protide initiate programmed cell death of the target cells.
- the context-activation results from a physiological condition, such as, but not limited to acidity, alkalinity, ionic strength or osmotic strength.
- the context-activation results from association with an activator molecule.
- the activator molecules can modify the activator site upon association.
- modification of the activator site includes cleavage of the activator site.
- the activoator molecule is an enzyme, such as a protease, esterase or lipase.
- the activator is expressed by a pathogenic microorganism as described herein.
- the activator is present in the context of a tumor cell, such as a tumor-specific protease.
- a tumor-specific protease is a matrix bound protein such as matrix metalloproteinase.
- the activator is present in the context of an inflammatory response, wherein activators such as thrombin, bradykinin, elastase and metalloproteinase are expressed.
- protide refers to a mosaic molecule composed of two or more peptide or non-peptide functional domains, referred to as effectors, and one or more corresponding activator sites.
- a protide can consist of an indefinite number of effector and activator domains that can vary in function, activation, position, continuity, or sequence. Additional examples of protide compositions and designs are described in U.S. Patent Application Publication 2006-0074016, 2006-0135416 and U.S. Pat. No. 7,067,621, which are herein incorporated by reference.
- the protides described herein have two or more distinct biological functions and are designed to be activated within a defined or characteristic context.
- the protides described herein have at least one activator site and two or more effectors, wherein at least one of the effectors has and amino acid sequence of a peptide described herein.
- Protides have the advantage of designs that can be customized, engineered, chosen, or combined to allow for highly selective correspondence to or association with or unique to a specific pathological condition or etiology.
- the distinct biological functions can further be associated with distinct functional aims, for example, therapy, prevention, amplification and detoxification.
- a multifunctional, context-activated protide can be designed to be activated in any context desired by the user, a feature which makes the protides useful to applications in many areas of medicine and biomedical research, including, for example, diagnosis, imaging, detection, speciation or other specification, prevention/prophylaxis, and therapy of a wide range of pathological conditions such as infectious diseases, neoplastic diseases, immune and autoimmune disorders, cardiovascular conditions, disorders in metabolism or physiology, diseases of inheritance or genetic abnormality, a variety of pathological conditions associated with gene expression, mitochondrial dysfunction or regulation, as well as cell death and/or cellular senescence.
- pathological conditions such as infectious diseases, neoplastic diseases, immune and autoimmune disorders, cardiovascular conditions, disorders in metabolism or physiology, diseases of inheritance or genetic abnormality, a variety of pathological conditions associated with gene expression, mitochondrial dysfunction or regulation, as well as cell death and/or cellular senescence.
- the peptides, protides and conjugate described herein are useful based on their ability to circumvent or minimize conventional resistance mechanisms by pathogens or tumor cells.
- this can be the result of activation by activators that are present outside of the target cell such that the peptides, protides or conjugate need not necessarily enter the target cell to be activated and to achieve subsequent efficacy, thus minimizing the likelihood for resistance due to reduced target access or increased efflux of the peptides, protides or conjugate.
- resistance can be induced by the presence of the anti-infective agent itself.
- protides can be designed to be activated by such microbial counter-responses or virulence factors.
- the more of the activator that is made by the organism the more protide activation results, yielding an expected amplification of the anti-pathogenic efficacy of the protide.
- decreased production of the activators can translate in turn to decreased presence or function of these same activators such as virulence factors or mediators of pathogenesis, in essence turning off the pathogenic potential of the target cell, or reducing its ability to protect itself from otherwise normal host defenses.
- protides can be beneficial by reconstituting tumor cell or microbial pathogen susceptibility to conventional therapeutic agents, to which these pathogenic cells would otherwise be resistant.
- the protides can either be activated from upregulation of resistance- or virulence factor expression, or can impact efficacy by effecting the downregulation of virulence factor expression by pathogenic cells or organisms.
- activators can be present or generated.
- An activator useful for activation of a protide of the invention can be advantageously selected based on a high concentration in the immediate proximity of the infection locus so as to allow for activation of the majority of protides in the desired context.
- One skilled in the art will be able to select an activator that represents the desired activation context.
- context-activation can be designed to specifically occur in the local context of infection so as to effect optimal relative protide effector concentrations in specific contexts of infection.
- the protides and methods of the invention also minimize the potential for inadvertent host cytotoxicity in areas that do not represent the context. Therefore, in the absence of infection, the protide activators are either absent or are present at concentrations insufficient for effective protide activation, thereby minimizing inadvertent or indiscriminant acute toxicity.
- protides can also be designed to become activated to diagnose, prevent, or treat infection in unique and/or specific biochemical or physiological contexts associated with microbial pathogens.
- biochemical or environmental contexts include ionic, osmotic, pH, oxidation/reduction, or other conditions that are unique to, characteristic of, or present in the context of infection or disease processes that occur upon infection, or host responses to these events.
- a protide can be designed to require the influence of protonation, conformation change, or other modification that occurs uniquely or disproportionately in the context of acidic pH, to activate the protide or its ensuing effectors by altering their structure-activity relationship(s) from inactive to active.
- genitourinary tissues such as renal-tissues or genitourinary mucosa, can exhibit pH values that are decreased normally, or in the setting of infection.
- a protide designed to be activated only under such acidic conditions could be designed to either be vulnerable to activation in these conditions, or directly activated by these conditions, and thus would be predicted to be active only in such contexts.
- protides can be designed to be inactive in particular contexts or conditions, such as conditions of relatively high osmotic strength or relatively high pH, so as to minimize or prevent untoward or toxic effects such as nephro- or hepatotoxicity.
- activation as well as leukocyte accumulation are conditions associated with infection.
- a fundamental strategy of host defense phagocytes is to phagocytize the microbial pathogen, subjecting it to the harsh environment of the acidic phagolysosome. The compartment so created can become acidified to pH values of 5.5 or lower as the leukocyte responds to the pathogen.
- a protide can be designed that is activated or has amplified or antimicrobial activities, for example, by pH, phagolysosomal enzymes or reactants, or a combination of these conditions, or can amplify or potentiate the antimicrobial mechanisms of leukocytes or other host cells within such settings, so as to inhibit or kill pathogens that enter such cells.
- Protide activation also can include conformational, oxidation or reduction-mediated changes in disulfide array, assembly into multimers of two or more homomeric (identical) or heteromeric (non-identical) effectors, or other modifications of the protide and/or its subsequent effectors.
- protide activation is triggered as a result of protide accumulation, or its resulting effector components, so as to achieve or surpass threshold concentrations required to optimize or catalyze activation or activity through multimerization or other modification in structure or function of the protide or its effectors.
- activation can involve combinations of the protide activation strategies described above.
- a protide can be designed that is not responsive to an activator unless both the protide and the activator are present within a context associated with or resulting from infection or other disease.
- context-activated refers to the initiation, activation or amplification of a biological or other desired, for example, diagnostic or prophylactic function of one or more protide effectors in a particular temporal, spatial, pathological and/or biochemical context. Context-activation can be initiated by direct or indirect interaction between a protide activator site and a corresponding activator that is selectively associated with the particular context. As used herein, context-activation encompasses activation in a wide variety of contexts that can include, for example, local, regional, systemic, and/or temporal proximity; as well as the presence or absence of an etiological agent, pathologic condition, or characteristic components thereof.
- context need not be limited to a place, time or quality, but also can be the presence or absence of an activator, for example, an enzyme elaborated by an organism such as, for example, a specific strain of bacteria.
- the context for activation can consequently be of any breadth desired by the user, for example, can target a class of organisms or cell types, for example, by using an activator that is ubiquitous to the targeted class, or can alternatively have a more narrow focus by using an activator that represents a more narrowly defined target, for example, a particular genus, organism, species, subspecies, strain, or cell or tissue type.
- the context can be associated with a pathological condition, but also can be selected to represent a non-pathological environment, for example, in prophylactic applications of the invention practiced to preserve a normal or homeostatic condition.
- effector refers to the peptide or non-peptide functional domains of a protide provide herein that have specific individual functions, which are initiated or amplified upon activation and achieve specific functions relating to the diagnosis, prevention, or treatment of a disease.
- a protide has at least two effector domains with distinct, complementary and/or synergistic biological functions.
- An effector is inactive or exhibits relatively reduced or attenuated biological activity unless an activator, by virtue of either its presence or absence, alters or facilitates or allows the altering of its corresponding activator site and, as a result, initiates or amplifies the diagnostic, prophylactic, therapeutic, or other biological function(s) of the effector(s).
- effectors can be induced by the same activator site.
- Peptide and non-peptide effectors can be present in the same protide, which can be referred to as a hybrid protide.
- a protide can consist exclusively of peptide effectors, also referred to as a peptide protide.
- a protide of the invention can consist exclusively of non-peptidic effectors.
- the biological function(s) of an effector that corresponds to a protide described herein can be, for example, antimicrobial, immunomodulatory, pro- or anti-inflammatory, tumoricidal, pro- or anti-apoptotic, pro- and anti-angiogenic and/or hemolytic.
- a protide of the invention can be bifunctional or multifunctional, with two or more unique complementary effectors, and one or more activators as determined by specific effector and activator site domains engineered into the mosaic protide, which can be activated by specific molecules or conditions present in unique or strategic contexts of interest.
- effectors can include one or more antimicrobial, anti-neoplastic, anti-inflammatory, immunomodulatory, or other peptide or non-peptide functional domains, or combinations thereof.
- an activator site when used in reference to a protide of the invention, refers to a domain of the protide that, in the presence of an activator, initiates, promotes, amplifies or modulates the specific biological function of one or more effectors.
- an activator site can be modified, cleaved, processed or otherwise altered in the presence of an activator.
- an activator site can be sensitive either to the absolute presence or absence of an activator as well as can be sensitive to a threshold concentration of an activator rather than its mere presence.
- An activator site useful in the invention can include one or more sites for cleavage, modification, processing or other triggering by strategic activators, which can be, for example, proteases, esterases, lipases, or other endogenous enzymatic activators or cascades generated by or associated with a specific condition such as, for example, the presence of pathogenic microorganisms, damaged or inflamed tissues, or hematologic or solid neoplastic or pre-neoplastic cells or tumors.
- strategic activators can be, for example, proteases, esterases, lipases, or other endogenous enzymatic activators or cascades generated by or associated with a specific condition such as, for example, the presence of pathogenic microorganisms, damaged or inflamed tissues, or hematologic or solid neoplastic or pre-neoplastic cells or tumors.
- Such an activator site also can be selected to exploit contexts associated with biochemical or physical conditions such as requisite acidity or alkalinity, for example, acidic phagolysomes containing intracellular bacteria or fungi; or ionic or osmotic strength, for example, in a renal context, that represent a specific pathologic or non-pathologic context. Furthermore, an activator site can be selected to exploit normal rather than a pathologic context.
- An activator site can be subject to proteolytic as well as non-proteolytic activation.
- the activator site can be located within the peptide moiety, and require a protease activator.
- the non-proteolytic activator can target a non-proteinaceous substrate component of the protide.
- a protide of the invention can include an esterase activator and can link peptide and/or non-peptide moieties (eg. a protide consisting of peptide and conventional antibiotic effectors) by means of an ester bond.
- protide can include, for example, lipase- (lipid cleaving), nuclease- (nucleic acid cleaving), and kinase or phosphatase- (phosphate addition or removal) sensitive activators that target substrates other than peptides.
- lipase- lipid cleaving
- nuclease- nucleic acid cleaving
- kinase or phosphatase- phosphate addition or removal
- kinase or phosphatase- phosphate addition or removal
- an activator refers to a molecule or condition that, by altering the activator site, causes the liberation or onset of a specific diagnostic or biological function of effector(s).
- an activator can be a normal or abnormal exogenous or endogenous cell, structure or molecule, a condition or milieu (normal or abnormal), or a combination thereof that is associated with a specific context in which activation of the protide is desired.
- an activator can be selected based on its presence in a temporal, spatial, or physiological context, which can be normal or abnormal, that is associated with the desired context for protide activation.
- An activator can consequently include physiological conditions including, for example, acidity, alkalinity, conditions of oxidation or reduction, and/or ionic and/or osmotic strength, that are associated with a particular context, and modulate protide activation.
- an activator can be a structure or molecule, for example, an enzyme, that is present in a particular spatial, temporal or pathological context.
- the activator molecule can modify the activator site upon association, for example, by cleavage or other modification that results in activation in the particular context, or can facilitate interaction between protide and activator(s).
- the activator molecule can be an enzyme including, for example, protease, esterase, lipase, nucleases or peptidase.
- an activator site can encompass one or more domains for cleavage, modification, processing or any other type of liberation by an activator, for example, a protease, esterase, lipase or other endogenous or exogenous enzymatic activator or cascade.
- an activator for example, a protease, esterase, lipase or other endogenous or exogenous enzymatic activator or cascade.
- the choice of one or more activator sites that correspond to specific activators depends directly on the desired context for activation.
- an activator can be a particular pathologic setting or condition that is chosen based on its association with a particular etiological agent or host response.
- one or more effectors are liberated so as to achieve a specific function relating to, for example, the treatment, prevention, or diagnosis of a targeted disease.
- An activator site can thus be strategically designed to become activated in temporal and spatial proximity to activator expression, thereby allowing the activation of a protide to be targeted to a particular context and over time so as to maximize the desired therapeutic or prophylactic effect, while minimizing untoward or undesirable toxicities or other side effects.
- an activator site is selected based on its correspondence and/or association with the context in which the two or more protide effectors are to be liberated so as to initiate or potentiate their functions. Therefore, as long as an activator is associated with the context, the invention can be practiced with any context desired.
- a protide can be designed based on virtually any context desired, including, for example, vascular injury, presence of a neoplasm or cancer, infection, and inflammation.
- the protide is an antimicrobial protide, which also can be referred to as an antimicrotide.
- Cleavage sites for strategic proteases can be engineered into multifunctional antimicrobial protides so as to represent the activator site of the protide.
- the inactive protide Upon activation of the protease in the localized or generalized context of tissue injury or infection, as selected by the user, the inactive protide is cleaved, liberating independent and active molecules to effect their respective biological functions.
- the mosaic protide construct Prior to and beyond the setting of activation of the strategic protease representing the activator, the mosaic protide construct is relatively inactive both with respect to antimicrobial function and host cell toxicity.
- a mosaic protide construct can consist of an indefinite number (1 through n) of effector and activator domains that can vary in function, activation, position, continuity, or sequence. Effectors corresponding to one or more protides activated by the same or distinct activators also can function synergistically, and/or can recombine in a manner facilitating their complementary functions.
- a protide activator can be selected that specifically represents this particular context, for example, a clotting cascade protease such as thrombin, or a complement fixing protease such as a C3 convertase, for example, C4B2A or C3bBb.
- a protide activator can be selected that represents a broader constellation of symptoms or conditions, such as sepsis, in which corresponding activators can include serine proteases associated with systemic inflammation, sepsis, or injury, such as activated protein C.
- a further embodiment of the invention encompasses anti-neoplastic protides, which also are referred to as antineotides.
- Many tumor cells produce or overexpress characteristic activators, such as matrix metalloproteinases (MMP) or other enzymes that are not expressed by, or at levels much higher than normal cells. Consequently, the activator can be a tumor-specific protease, for example, a matrix metalloproteinase or thymidylate synthase (TS), which is overexpressed in the majority of cancers.
- MMP matrix metalloproteinases
- TS thymidylate synthase
- a tumor-specific protease also can be associated with a more narrow neoplastic context, such as a serine protease that is specifically expressed in prostate cells, for example, PSA, human kallikrein-2 (hK2), human kallikrein-11 (hK11) and TMPRSS2.
- a serine protease that is specifically expressed in prostate cells, for example, PSA, human kallikrein-2 (hK2), human kallikrein-11 (hK11) and TMPRSS2.
- Embodiment of the invention provide a conjugate having one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263 and a moiety, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the amino acid residue represented by (j) is a cysteine or a thio
- Embodiments of the invention also provide a conjugate having one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 2, 5, 7, 9, 12, 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289 and a moiety, wherein said conjugate induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
- the conjugate has at least one or more amino acid sequence, identified from the Bax protein, referenced by the amino acid sequence of SEQ ID NOS: 1-13, 264, 270 and 271. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-W protein, referenced by the amino acid sequence of SEQ ID NOS: 14-25, 269 and 272. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-x ⁇ protein, referenced by the amino acid sequence of SEQ ID NOS: 26-36 and 273.
- the conjugate has at least one or more amino acid sequence, identified from the Bak protein, referenced by the amino acid sequence of SEQ ID NOS: 37-47. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 48-52. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-2 isoform 1 protein, referenced by the amino acid sequence of SEQ ID NOS: 53-57. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Mth-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 58-64 and 274.
- the conjugate has at least one or more amino acid sequence, identified from the Mfn-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 65-75. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Dnm-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 76-93 and 275. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Dnm-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 94-121, 267, 276 and 277.
- the conjugate has at least one or more amino acid sequence, identified from the Ncl protein, referenced by the amino acid sequence of SEQ ID NOS: 122-175. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Csp3 protein, referenced by the amino acid sequence of SEQ ID NOS: 176-187, 266 and 278. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bad protein, referenced by the amino acid sequence of SEQ ID NOS: 188-199. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Prf-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 200-223.
- the conjugate has at least one or more amino acid sequence, identified from the Granulysin protein, referenced by the amino acid sequence of SEQ ID NOS: 224-235. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the CidA protein, referenced by the amino acid sequence of SEQ ID NOS: 236-247, 265 and 279. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the LrgA protein, referenced by the amino acid sequence of SEQ ID NOS: 248-251.
- the conjugate has at least one or more amino acid sequence, identified from the Lambda S21 protein, referenced by the amino acid sequence of SEQ ID NOS: 252-256. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Holin protein, referenced by the amino acid sequence of SEQ ID NOS: 257-263 and 268. In one aspect, the conjugate has at least one or more amino acid sequence, identified from human Bcl-xL protein, which is represented by the amino acid sequence SEQ ID NO: 288 or human CTL Granulysin, which is represented by the amino acid sequence SEQ ID NO: 289.
- the moiety comprises a therapeutic agent, a targeting peptide or a label.
- therapeutic agent is a cytotoxic agent, such as an antibiotic or a chemotherapeutic agent.
- the targeting peptide selectively homes a conjugate described herein to a microorganism, a tumor tissue, tumor cell or tumor vasculature.
- the targeting peptide selectively homes the conjugate to an immune regulatory cell or an immune effector cell.
- the conjugate described herein has a targeting peptide, such as, but not limited to, an antibody or a fragment thereof.
- the moiety of the conjugate described herein is a label, such as a radioisotope or a dye.
- conjugate refers to a peptide having an amino acid sequence as described herein linked to a moiety.
- a “moiety” is used broadly to mean a physical, chemical, or biological material that is linked to a peptide for the purpose of targeting the peptide to a select organ, tissue or cell type or providing an additional functional group to the peptide.
- a moiety is a biologically useful moiety such as therapeutic moiety, a diagnostic moiety or a drug delivery vehicle.
- a moiety can be a therapeutic agent, for example, a cancer chemotherapeutic agent.
- Cancer chemotherapeutic agents are well known to one of skill in the art and include, without limitation, alkylating agents such as cyclophosphamide, mechlorethamine, chlorambucil and melphalan, anthracyclines such as daunorubicin, doxorubicin, epirubicin, idarubicin, mitoxantrone and valrubicin, cytoskeletal disruptors such as paclitaxel and docetaxel, epothilones such as epothilones A through F, inhibitors of topoisomerase II such as etoposide, teniposide and tafluposide, nucleotide analogs and precursor analogs such as azacitidine, azathioprine, capecitabine, cytarabine, doxifluridine, fluorouracil, gemcitabine, mercaptopurine, methotrexate, and tioguanine, peptide antibiotic
- a moiety when linked to a peptide, provides a conjugate useful for treating a cancer in a subject.
- a moiety can be a drug delivery vehicle such as a chambered microdevice, a cell, a liposome or a virus, which can contain an agent such as a drug or a nucleic acid.
- a moiety also can be a targeting peptide or nucleic acid, to which a peptide as described herein is grafted for the purpose of directing the peptide to a selected organ, tissue, tumor or cell (Smith et al., J. Biol. Chem. 269:32788-32795 (1994); Goldman et al., Cancer Res. 15:1447-1451 (1997) and U.S. Pat. No. 6,576,239, each of which is incorporated herein by reference).
- a targeting peptide or nucleic acid can be expressed as a fusion protein with a desired peptide such that the peptide or nucleic acid targets the grafted peptide to a selected tumor tissue, tumor cell or tumor vasculature.
- a desired peptide which is grafted to the tumor homing peptide, can be a polypeptide involved in initiating a programmed cell death pathway as described herein or inducing any other cellular response resulting in anti-cancer activity.
- targeting peptides which can be grafted to a peptide as described herein having antimicrobial activity, include peptides that selectively home to a microorganism.
- peptide sequences have been identified that selectively bind to surface molecules of fugal pathogens such as invasive Aspergillus species as described in U.S. Patent Application 2005-0187161. Still further, the invention provides a conjugate wherein the targeting peptide selectively homes the desired peptide to a cell involved in the immune response, including immune regulatory cells such as lymphocytes or immune effector cells such as macrophages or granulocytes.
- Conjugates provided herein include these and other exemplary peptide or nucleic acid sequences grafted to a peptide described herein. tumor tissue, tumor cell, tumor vasculature, immune regulatory cell or immune effector cell.
- a “targeting peptide” is a peptide comprising a contiguous sequence of amino acids, which is characterized by selective localization to an organ, tissue, or cell type. Selective localization may be determined, for example, by methods disclosed below, wherein the putative targeting peptide sequence is incorporated into a protein that is displayed on the outer surface of a phage. Administration to a subject of a library of such phage that have been genetically engineered to express a multitude of such targeting peptides of different amino acid sequence is followed by collection of one or more organs, tissues, or cell types from the subject and identification of phage found in that organ, tissue, or cell type.
- a phage expressing a targeting peptide sequence is considered to be selectively localized to a tissue or organ if it exhibits greater binding in that tissue or organ compared to a control tissue or organ.
- selective localization of a targeting peptide should result in a two-fold or higher enrichment of the phage in the target organ, tissue, or cell type, compared to a control organ, tissue, or cell type.
- Selective localization resulting in at least a three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, ten-fold or higher enrichment in the target organ compared to a control organ, tissue or cell type is more preferred.
- a phage expressing a targeting peptide sequence that exhibits selective localization preferably shows an increased enrichment in the target organ compared to a control organ when phage recovered from the target organ are reinjected into a second host for another round of screening. Further enrichment may be exhibited following a third round of screening.
- Another alternative means to determine selective localization is that phage expressing the putative target peptide preferably exhibit a two-fold, more preferably a three-fold or higher enrichment in the target organ or tissue compared to control phage that express a non-specific peptide or that have not been genetically engineered to express any putative target peptides.
- Targeting peptide and “homing peptide” are used synonymously herein.
- a targeting peptide is useful, for example, for targeting a desired peptide to the selected tumor as discussed above.
- a targeting peptide in conjunction with a detectable label can be used to identify the delivery of a desired peptide to a sample.
- sample is used in its broadest sense to mean a cell, tissue, organ or portion thereof, including a tumor, that is isolated from the body.
- a sample can be, for example, a histologic section or a specimen obtained by biopsy or cells that are placed in or adapted to tissue culture.
- antibody is well-known in the art and refers to a protein functionally defined as a binding protein and structurally defined as comprising an amino acid sequence that is recognized by one of skill in the art as having variable and constant regions.
- a typical antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” and one “heavy” chain. The N-terminal portion of each chain defines the variable region of about 100 to about 110 amino acids, which are primarily responsible for antigen recognition and binding.
- V H variable heavy chain
- V L variable light chain regions refer to these light and heavy chains, respectively.
- the variable region includes the segments of Framework 1 (FR1), CDR1, Framework 2 (FR2), CDR2, Framework 3, CDR3 and Framework 4 (FR4).
- Antibodies are typically divided into five major classes, IgM, IgG, IgA, IgD, and IgE, based on their constant region structure and immune function.
- the constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotypes.
- Heavy chains ⁇ , ⁇ and ⁇ have a constant region composed of three tandem (in a line) Ig domains, and a hinge region for added flexibility; heavy chains ⁇ and ⁇ have a constant region composed of four immunoglobulin domains.
- Antibody classes can also be divided into subclasses, for example, there are four IgG subclasses IgG1, IgG2, IgG3 and IgG4.
- the structural characteristics that distinguish these subclasses from each other are known to those of skill in the art and can include the size of the hinge region and the number and position of the interchain disulfide bonds between the heavy chains.
- the constant region also determines the mechanism used to destroy the bound antigen.
- a light chain has two successive regions: one constant region, which are designated as ⁇ and ⁇ , and one variable region.
- the term “functional fragment” when used in reference to the antibodies described herein is intended to refer to a portion of the antibody including heavy or light chain polypeptides which still retains some or all or the binding activity of the antibody.
- Such functional fragments can include, for example, antibody functional fragments such as Fab, F(ab) 2 Fv, and single chain Fv (scFv).
- Other functional fragments can include, for example, heavy or light chain polypeptides, variable region polypeptides or CDR polypeptides or portions thereof so long as such functional fragments retain binding activity, specificity, inhibitory and activation activity.
- polypeptides encompassing, for example, modified forms of naturally occurring amino acids such as D-stereoisomers, non-naturally occurring amino acids, amino acid analogues and mimetics so long as such polypeptides retain functional activity as defined above.
- a moiety can be a detectable label such a radiolabel or can be a cytotoxic agent, including a toxin such as ricin or a drug such as a chemotherapeutic agent or can be a physical, chemical or biological material such as a liposome, microcapsule, micropump or other chambered microdevice, which can be used, for example, as a drug delivery system.
- a detectable label such as radiolabel
- a cytotoxic agent including a toxin such as ricin or a drug such as a chemotherapeutic agent
- a physical, chemical or biological material such as a liposome, microcapsule, micropump or other chambered microdevice, which can be used, for example, as a drug delivery system.
- a detectable label such as radiolabel
- a cytotoxic agent including a toxin such as ricin or a drug such as a chemotherapeutic agent
- can be a physical, chemical or biological material such as
- label refers a compound has at least one element, isotope or chemical compound attached to enable the detection of the compound.
- labels fall into three classes: a) isotopic labels, which may be radioactive or heavy isotopes; b) immune labels, which may be antibodies or antigens; and c) colored or fluorescent dyes.
- the labels may be incorporated into a HIPK1 nucleic acids, proteins and antibodies at any position.
- the label should be capable of producing, either directly or indirectly, a detectable signal.
- the detectable moiety may be a radioisotope, such as 3 H, 14 C, 32 P, 35 S, or 125 I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
- a radioisotope such as 3 H, 14 C, 32 P, 35 S, or 125 I
- a fluorescent or chemiluminescent compound such as fluorescein isothiocyanate, rhodamine, or luciferin
- an enzyme such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
- Any method known in the art for conjugating the antibody to the label may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al.,
- Peptides, protides and conjugates which are identified herein, can be synthesized in required quantities using routine methods of solid state peptide synthesis or can be purchased from commercial sources (for example, Anaspec; San Jose Calif.) and a desired moiety can be linked to the peptide.
- Several methods useful for linking a moiety to a peptide are known in the art, depending on the particular chemical characteristics of the molecule. For example, methods of linking haptens to carrier proteins as used routinely in the field of applied immunology (see, for example, Harlow and Lane, supra, 1988; Hermanson, supra, 1996).
- a moiety such as a therapeutic or diagnostic agent can be conjugated to a peptide using, for example, carbodiimide conjugation (Bauminger and Wilchek, Meth. Enzymol. 70:151-159 (1980), which is incorporated herein by reference).
- Carbodiimides comprise a group of compounds that have the general formula R—N ⁇ C ⁇ N—R′, where R and R′ can be aliphatic or aromatic, and are used for synthesis of peptide bonds. The preparative procedure is simple, relatively fast, and is carried out under mild conditions.
- Carbodiimide compounds attack carboxylic groups to change them into reactive sites for free amino groups.
- Carbodiimide conjugation has been used to conjugate a variety of compounds to carriers for the production of antibodies.
- the water soluble carbodiimide, 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide is particularly useful for conjugating a moiety to a peptide and was used to conjugate doxorubicin to tumor homing peptides (U.S. Patent Application Publication 2004-0131623).
- the conjugation of doxorubicin and a tumor homing peptide requires the presence of an amino group, which is provided by doxorubicin, and a carboxyl group, which is provided by the peptide.
- EDC also can be used to prepare active esters such as N-hydroxysuccinimide (NHS) ester.
- NHS N-hydroxysuccinimide
- the NHS ester which binds only to amino groups, then can be used to induce the formation of an amide bond with the single amino group of a moiety.
- EDC and NHS in combination is commonly used for conjugation in order to increase yield of conjugate formation (Bauminger and Wilchek, supra, 1980).
- An agar radial diffusion assay has been used as described herein to determine antimicrobial activities of proteins against microbial pathogens in vitro.
- One million CFU will be mixed into 10 ml (i.e., 1 ⁇ 10 5 CFU/ml) of melted 1% agarose (in 10 mM NaHPO 4 and cooled to 42° C.) containing minimal nutrient and adjusted to either pH 5.5 or pH 7.2.
- the agar is solidified in culture dishes, and sample wells are formed.
- Peptides at various concentrations are dissolved in 10 ⁇ l of 0.01% acetic acid buffer (pH 5.5 or 7.2), loaded into individual wells, and incubated at 37° C. for three hours.
- the plate is then overlayed with 1% agarose containing nutrients and incubated (37° C., for at least 24 hours). Peptides purified by RP-HPLC lacking antimicrobial activity are tested in parallel as controls. Zones of inhibition are measured to quantify antimicrobial activity. This assay will not distinguish between microbicidal and microbiostatic actions, but is highly sensitive to peptides with one or both functions.
- Minimum inhibitory (MIC) and microbiocidal concentration (MMC) assays can also be performed, and may include a microvolume assay which is used to quantitatively screen peptides for antimicrobial activities.
- suspensions of bacteria or fungi in appropriate media are placed in 100-200 ⁇ l final volumes in microtiter plates.
- Poly-L-lysine coated or otherwise positively charged plates are used for these assays, since cationic peptides may bind to anionic surfaces.
- Purified peptides are then serially diluted, descending from 100 ⁇ g/ml.
- Organisms are inoculated into wells to a concentration of 1 ⁇ 10 5 CFU/ml, and plates incubated (37° C., for at least 24 hours).
- Well turbidities are then assessed visually and by spectrophotometry to quantify growth inhibition versus wells containing no peptide.
- MMCs are then determined by quantitative culture of MIC wells exhibiting no visible growth.
- Microbicidal kinetics of purified peptides are assessed by resuspending the peptides in 0.01% acetic acid buffer (pH 5.5 or 7.2), and organisms are resuspended to a concentration of 1 ⁇ 10 5 CFU/ml in 50-250 ⁇ l of sterile buffer containing peptide concentrations from 0 to 40 ⁇ g/ml.
- Controls contain buffer alone or non-antimicrobial proteins and organism as above. Mixtures are incubated at 37° C. for up to 48 hours, after which aliquots are quantitatively cultured and incubated for 24 to 48 hours. Killing is expressed as decrease in logarithm 10 surviving CFU/ml.
- the limit of sensitivity in microbicidal assays is considered to be a 1 log reduction in viable cells.
- Flow cytometry can also be used to examine kinetics and mechanisms of the action of the peptides on bacterial membrane integrity and energetics.
- Peptides which differ in activity or specificity for their ability to depolarize and/or permeabilize microbial membranes can also be compared by analysis of membrane depolarization, and permeabilization.
- DiOC 5 is a charged lipophilic dye which partitions into the cytoplasm, and is dependent on intact transmembrane potential ( ⁇ ) for intracellular retention.
- Organisms prepared as above are labeled in darkness for 30 minutes at about 20° C.
- Organisms are resuspended to a concentration of 5 ⁇ 10 8 CFU/ml in K + MEM containing an individual peptide, and incubated at 37° C.
- Organisms are washed, sonicated, counted, and resuspended in K + MEM buffer. Reductions in mean DiOC 5 fluorescence relative to controls are interpreted to represent loss of DiOC 5 , indicating membrane depolarization. Positive control cells exposed to valinomycin, as well as control cells not exposed to any peptides, are analyzed for DiOC 5 fluorescence in parallel.
- Propidium iodide is excluded from cells with normal membrane integrity, but enters cells permealized to molecules ⁇ 2 nm in diameter, and can be stimulated to emit fluorescence at >620 nm.
- Organisms prepared as above are resuspended to a concentration of 5 ⁇ 10 8 CFU/ml in K + MEM containing a selected peptide, and incubated for pre-selected times (ranging from zero up to about 120 minutes) at 37° C. Cells are washed in fresh K + MEM, sonicated, counted, and resuspended in K + MEM buffer containing 20 ⁇ M propidium iodide.
- Control cells exposed to ethanol positive control for permeabilization
- Increases in mean propidium iodide fluorescence relative to control cells are interpreted to indicate increases in permeability.
- Erythrocyte permeabilizing and hemolytic activities of peptides exhibiting potent microbicidal activity are also studied as indicators of potential in vivo toxicity.
- Four-percent (vol/vol) of washed human erythrocytes (in PBS alone, or in PBS plus 10% heat-inactivated PNHS are incubated with selected peptides ranging in concentration up to 100 times greater than geometric mean MICs. After 24 hours of incubation at 37° C., erythrocyte permeabilization and hemolysis are determined spectrophotometrically. Permeabilization and hemolysis will be compared to buffers alone, and with a triton X-100 control (100% hemolysis).
- Endothelial cell injury due to peptides can also be measured using a standard 51 Cr release assay, described in Filler et al., J Infect Dis., 164:928-935 (1991); Filler, et al., Infect Immun. 62:1064-1069 (1994); Filler et al., Infect Immun. 63:976-983 (1995). Briefly, endothelial cells in 96 well tissue culture plates are incubated with Na 5 1 CrO 4 overnight. The following day, the unincorporated isotope tracer is removed by rinsing, and peptides in 0.01% acetic acid buffer are added to the endothelial cells. Control wells are exposed to buffer alone. After a predetermined incubation period, the medium is aspirated and the amount of 51 Cr released into the medium is measured by scintillation. This approach facilitates toxicity screening of multiple peptides simultaneously, and minimizes the amount of peptide necessary for assessment.
- Each antimicrobial and toxicity assay described above is performed independently a minimum of two times, and means ⁇ standard error is calculated for each peptide under varying exposure conditions (concentration or pH) as compared with control samples.
- Statistical analyses of microbicidal data are performed using Student t test or Kruskall-Wallis rank sum analysis for non-parametric data, and corrected for multiple comparisons as appropriate.
- the yield of moiety/peptide conjugate formed is determined using routine methods. For example, HPLC or capillary electrophoresis or other qualitative or quantitative method can be used (see, for example, Liu et al., J. Chromatogr. 735:357-366 (1996); Rose et al., J. Chromatogr. 425:419-412 (1988), each of which is incorporated herein by reference).
- HPLC or capillary electrophoresis or other qualitative or quantitative method can be used (see, for example, Liu et al., J. Chromatogr. 735:357-366 (1996); Rose et al., J. Chromatogr. 425:419-412 (1988), each of which is incorporated herein by reference).
- the skilled artisan will recognize that the choice of a method for determining yield of a conjugation reaction depends, in part, on the physical and chemical characteristics of the specific moiety and peptide.
- the reaction products can be desalted to remove any free
- Embodiments of the invention provide a method of inducing programmed cell death in a cell, including contacting the cell with an isolated peptide, protide or conjugate described herein.
- the cell is a microorganism, or in some aspects a pathogenic microorganism.
- the pathogenic microorganism is Staphylococcus aureus, Escherichia coli, Salmonella typhimurium, Pseudomonas aeruginosa, Bacillus subtilis, Acinotobacter baumannii, Acinotobacter calcoaceticus, Acinotobacter haemolyticus, Pseudomonas aeruginosa, Candida albicans .
- the cell is a tumor cell, including both a malignant and non-malignant tumor cell, or in a preferred aspect a malignant cell.
- the cell is an immune regulatory cell or an immune effector cell.
- a peptide, protide or conjugate of the invention useful for practicing the methods of the invention can be formulated and administered by those skilled in the art in a manner and in an amount appropriate for the pathological condition to be treated, for example, an infection, neoplastic disorder, inflammation; the rate or amount of inflammation; the weight, gender, age and health of the individual; the biochemical nature, bioactivity, bioavailability and side effects of the particular compound; and in a manner compatible with concurrent treatment regimens.
- An appropriate amount and formulation for decreasing the severity of a pathological condition in humans can be extrapolated from credible animal models known in the art of the particular disorder.
- the dosage of a therapeutic substance has to be adjusted based on the binding affinity of the substance, such that a lower dose of a substance exhibiting significantly higher binding affinity can be administered compared to the dosage necessary for a substance with lower binding affinity.
- a peptide, protide or conjugate described herein several factors can be taken into account when determining the proper dosage. For example, for a protide, the nature of the protide effectors and their bioactivity upon activation, the anticipated concentration of activator and the responsiveness of the activator site to presence of the activator, may be taken into account.
- the total amount of peptide, protide or conjugate can be administered as a single dose or by infusion over a relatively short period of time, or can be administered in multiple doses administered over a more prolonged period of time.
- Such considerations will depend on a variety of case-specific factors such as, for example, whether the disease category is characterized by acute episodes or gradual or chronic deterioration.
- the substance can be administered as a single dose or by infusion of several large doses in a relatively short period of time.
- the substance can be administered in a slow-release matrice, which can be implanted for systemic delivery or at the site of the target tissue, which means an area proximal to the desired context.
- Contemplated matrices useful for controlled release of therapeutic compounds are well known in the art, and include materials such as DepoFoamTM, biopolymers, micropumps, and the like.
- the peptides, protides and conjugates administered in the methods of the invention can be administered to the individual by any number of routes known in the art including, for example, systemically, such as intravenously or intraarterially.
- a therapeutic peptide, protide or conjugate can be provided in the form of isolated and substantially purified polypeptides in pharmaceutically acceptable formulations using formulation methods known to those of ordinary skill in the art. These formulations can be administered by standard routes, including for example, topical, transdermal, intraperitoneal, intracranial, intracerebroventricular, intracerebral, intravaginal, intrauterine, oral, rectal or parenteral such as intravenous, intraspinal, intrathecal, subcutaneous or intramuscular routes.
- Intrathecal administration of a therapeutic peptide, protide or conjugate into the intradural or subarachnoid space can be an appropriate route for decreasing the severity of a neuroinflammatory condition.
- Intravenous administration of a therapeutic substance containing a peptide, protide or conjugate also is a preferred route for practicing the invention.
- a therapeutic substance administered in the methods of the invention can be incorporated into biodegradable polymers allowing for sustained release of the substance useful for prophylactic and reconstitutive applications described above. Biodegradable polymers and their use are described, for example, in Brem et al., J. Neurosurg. 74:441 446 (1991), which is incorporated herein by reference.
- the methods for treating a particular pathological condition additionally can be practiced in conjunction with other therapies.
- the methods of the invention can be practiced prior to, during, or subsequent to conventional cancer treatments such as surgery, chemotherapy, including administration of cytokines and growth factors, radiation or other methods known in the art.
- the methods of the invention can be practiced prior to, during, or subsequent to conventional treatments, such as antibiotic administration, against infectious agents or other methods known in the art.
- Treatment of pathological conditions of autoimmune disorders also can be accomplished by combining the methods of the invention for inducing an immune response with conventional treatments for the particular autoimmune diseases.
- Conventional treatments include, for example, chemotherapy, steroid therapy, insulin and other growth factor and cytokine therapy, passive immunity and inhibitors of T cell receptor binding.
- the peptides, protides and conjugates of the invention can be administered in conjunction with these or other methods known in the art and at various times prior, during or subsequent to initiation of conventional treatments.
- treatments for pathological conditions characterized by aberrant cell growth see, for example, The Merck Manual, Sixteenth Ed, (Berkow, R., Editor) Rahway, N.J., 1992.
- administration of a peptide, protide or conjugate can be, for example, simultaneous with or delivered in alternative administrations with the conventional therapy, including multiple administrations.
- Simultaneous administration can be, for example, together in the same formulation or in different formulations delivered at about the same time or immediately in sequence.
- Alternating administrations can be, for example, delivering a peptide, protide or conjugate formulation and a conventional therapeutic treatment in temporally separate administrations.
- Temporally separate administrations of a peptide, protide or conjugate and conventional therapy can use different modes of delivery and routes.
- a therapeutic peptide, protide or conjugate containing substance administered in the methods of the invention also can be administered as a solution or suspension together with a pharmaceutically acceptable medium.
- a pharmaceutically acceptable medium can include, for example, sterile aqueous solvents such as sodium phosphate buffer, phosphate buffered saline, normal saline or Ringer's solution or other physiologically buffered saline, or other solvent or vehicle such as a glycol, glycerol, an oil such as olive oil or an injectable organic ester.
- a pharmaceutically acceptable medium can additionally contain physiologically acceptable compounds that act, for example, stabilize the neutralizing agent, increase its solubility, or increase its absorption.
- physiologically acceptable compounds include, for example, carbohydrates such as glucose, sucrose or dextrans; antioxidants such as ascorbic acid or glutathione; receptor mediated permeabilizers, which can be used to increase permeability of the blood-brain barrier; chelating agents such as EDTA, which disrupts microbial membranes; divalent metal ions such as calcium or magnesium; low molecular weight proteins; lipids or liposomes; or other stabilizers or excipients.
- carbohydrates such as glucose, sucrose or dextrans
- antioxidants such as ascorbic acid or glutathione
- receptor mediated permeabilizers which can be used to increase permeability of the blood-brain barrier
- chelating agents such as EDTA, which disrupts microbial membranes
- divalent metal ions such as calcium or magnesium
- low molecular weight proteins such as calcium or magnesium
- lipids or liposomes or other stabilizers or excipients.
- Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions such as the pharmaceutically acceptable mediums described above.
- the solutions can additionally contain, for example, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient.
- Other formulations include, for example, aqueous and non-aqueous sterile suspensions which can include suspending agents and thickening agents.
- the formulations can be presented in unit-dose or multi-dose containers, for example, sealed ampules and vials, and can be stored in a lyophilized condition requiring, for example, the addition of the sterile liquid carrier, immediately prior to use.
- Extemporaneous injection solutions and suspensions can be prepared from sterile powders, granules and tablets of the kind previously described.
- the neutralizing agent can be incorporated into liposomes (Gregoriadis, Liposome Technology, Vols. I to III, 2nd ed. (CRC Press, Boca Raton Fla. (1993)).
- Liposomes which consist of phospholipids or other lipids, are nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer.
- a therapeutic peptide, protide or conjugate containing substance administered in the methods of the invention can also be prepared as nanoparticles.
- Adsorbing peptide compounds onto the surface of nanoparticles has proven effective in delivering peptide drugs to the brain (see Kreuter et al., Brain Research 674:171 174 (1995)).
- Exemplary nanoparticles are colloidal polymer particles of poly-butylcyanoacrylate with a therapeutic protide-containing substance to be administered in the methods of the invention adsorbed onto the surface and then coated with polysorbate 80.
- Image-guided ultrasound delivery of a therapeutic peptide, protide or conjugate containing substance administered in the methods of the invention through the blood-brain barrier to selected locations in the brain can be utilized as described in U.S. Pat. No. 5,752,515. Briefly, to deliver a therapeutic substance past the blood-brain barrier a selected location in the brain is targeted and ultrasound used to induce a change detectable by imaging in the central nervous system (CNS) tissues and/or fluids at that location. At least a portion of the brain in the vicinity of the selected location is imaged, for example, via magnetic resonance imaging (MRI), to confirm the location of the change.
- An therapeutic substance administered in the methods of the invention into the patient's bloodstream can be delivered to the confirmed location by applying ultrasound to effect opening of the blood-brain barrier at that location and, thereby, to induce uptake of the substance.
- CNS central nervous system
- receptor mediated permeabilizers can be used to increase the permeability of the blood-brain barrier to molecules such as therapeutic, prophylactic or diagnostic substances as described in U.S. Pat. Nos. 5,268,164; 5,506,206; and 5,686,416.
- receptor mediated permeabilizers can be intravenously co-administered to a host with molecules whose desired destination is the cerebrospinal fluid compartment of the brain, for example, in the treatment of a neuroinflammatory condition.
- the permeabilizer polypeptides or conformational analogues thereof allow therapeutic substances to penetrate the blood-brain barrier and arrive at their target destination which can be selected based on its proximity to the desired activation context.
- Such polypeptides can be designed as part of strategic invention protides.
- a therapeutic peptide, protide or conjugate containing substance can advantageously be formulated with a second therapeutic compound such as an anti-inflammatory compound, antimicrobial compound, chemotherapeutic compound, immunosuppressive compound or any other compound that manages the same or different aspects of the particular disease.
- a therapeutic substance can advantageously be formulated with a second therapeutic compound such as an antibiotic.
- Contemplated methods of treating a pathological condition by administering to a subject a therapeutically effective amount of a peptide, protide or conjugate therefore include administering a therapeutic substance useful in the methods of the invention alone, in combination with, or in sequence with, such other compounds.
- combination therapies can consist of fusion proteins, where a therapeutic substance useful for treating a particular pathological condition is linked to a heterologous protein, such as an invention protide.
- Candidate proteins representing a variety of nuclear- or mitochondrial-encoded programmed cell death effector and/or modulatory molecules from eukaryotic sources were identified for comparison. When candidate proteins were compared, similarities in sequences and helical domains that have amphipathic and cationic characteristics were identified. Analogues were also identified where possible from prokaryotic sources.
- Template proteins were initially chosen based on the following: 1) mammalian or other eukaryotic cell nuclear-encoded peptides with structure-activity relationships to antimicrobial peptide sequences that afford interaction/control/inhibition of mitochondria or chloroplast symbionts, or host cell apoptosis (examples include Bax, Bcl-W, dynamin, mitofusin, nucleolin, and other programmed cell death effector proteins); and 2) structural and/or functional homologues of such proteins in prokaryotes (examples include CidA/B, LrgA/B, and other holin-like or programmed cell death effector proteins).
- the identification of candidate peptide sequences was achieved through an iterative process, which included a search of protein databases for additional candidate proteins, multiseqeunce alignments of the identified candidates, followed by an integration and analysis of candidate sequences.
- FIG. 3 shows exemplary amino acid sequence used as the query sequences.
- the results from the above processes were integrated to analyze and prioritize candidate sequences.
- the criteria for their prioritization included: 1) conservation of sequence homology or motif(s); 2) homology to known antimicrobial or anti-cancer peptides; 3) similarity to known or recognized antimicrobial peptide structure-activity relationships (SAR; including presence, periodicity, and distribution of cationic, hydrophobic, and aromatic residues); and 4) visual inspection.
- mitochondria-targeting proteins such as Bcl-2, Bcl-W, Bax, and Mitofusin
- NK/Tcyto cell effectors such as Granulysin, Granzyme H, Perforin-1 and Azurocidin (CAP37)
- apoptosis/cell signaling proteins such as Fas ligand, Caspase 7 and Dynamin 1
- other related proteins such as Serpin B9 (CytoPro3)
- This analysis included visualization, qualitative, and/or quantitative analyses of candidate sequences identified above. This analysis, including 3D visualization of target sequences, conformation 3D homology, qualitative 3D analysis of target sequences, quantitative 3D analysis of target sequences and comparative 3D refinement of target sequences.
- 3D visualization of target sequences was achieved using Cn3D software available through PubMed. Exemplary 3D visualization of identified candidate peptides within the native total protein are shown in FIG. 15-21 . These results identified specific sequences as novel targets for further analysis/design.
- the conformational 3D homology of target sequences to known antimicrobial or anti-cancer template polypeptides was assessed using the threading and 3D homology fold recognition server Protein Homology/analogy Recognition Engine (PHYRE) “Protein structure prediction on the web: a case study using the Phyre server” (Kelley and Sternberg Nature Protocols 4:363-371 (2009).
- PHYRE Protein Homology/analogy Recognition Engine
- Priority target sequences identified above were visualized for qualitative analysis of distribution of 3D physicochemical attributes using the public domain UCSF software package Chimera.
- priority target sequences were quantitatively evaluated for structural homology and/or structure-activity relationships to known antimicrobial and/or anti-cancer peptides/proteins using a combinatorial extension method of Shindyalov and Bourne, Protein Engineering 11:739-747 (1998).
- the results from these analyses provided quantitative alignment of compositional elements, including charged and hydrophobic residues ( FIGS. 22-29 ).
- the results included root mean square deviation (RMSD) scores as quantitative data that allowed further prioritization of target sequences.
- RMSD root mean square deviation
- the priority target sequences emanating from the process described above were then used as novel templates for 3D analyses using VAST and/or 3Dpssm software to identify homologous sequences and discover other novel target sequences.
- a computation simulation of the antimicrobial activity of the selected sequences was conducted.
- Selected target sequences emerging from the above process were subjected to a computational assessment tool which integrates multiple physical and biochemical attributes of polypeptide sequences to generate a predicted minimal inhibitory concentration (MIC) based on the inverse of the target sequence calculated hydrophobic moment (1/MH; see U.S. Pat. No. 6,743,769).
- MIC minimal inhibitory concentration
- H 2 N-alfyfasklvlkalctkv-CONH 2 10.
- H 2 N-alfyfasklvlkal x tkv-COOH 10.
- H 2 N-alfyfasklvlkal x tkv-CONH 2 2.
- H 2 N-twqtvtifvagvltasltiwkk-COOH 2.
- H 2 N-twqtvtifvagvltasltiwkk-CONH 2 11.
- H 2 N-twqtvtifva b vltasltiwkk-COOH 11.
- H 2 N-tralva b fvgyklrqkgyv-COOH 17.
- H 2 N-tralva b fvgyklrqkgyv-CONH 2 15.
- H 2 N-trfrrtfsdlaaqlhvt-COOH 15.
- H 2 N-trfrrtfsdlaaqlhvt-CONH 2 18.
- H 2 N-trfr b tfsdlaaqlhvt-COOH 18.
- H 2 N-rrlregnwasvrtvlt b avalgalvtvgaffask-COOH 22.
- H 2 N-rrlregnwasvrtvlt b avalgalvtvgaffask-CONH 2 23.
- H 2 N-kasflragvypervgdk-CONH 2 91. H 2 N-kasflragvyp b rvgdk-COOH 91. H 2 N-kasflragvyp b rvgdk-CONH 2 92. H 2 N-kasflragvypervg b k-COOH 92. H 2 N-kasflragvypervg b k-CONH 2 93. H 2 N-kasflragvyp b rvg b k-COOH 93. H 2 N-kasflragvyp b rvg b k-CONH 2 Underlined residues indicate substitutions; b k, r, n, q, other natural/non-natural basic residue.
- H 2 N-r xb alrralsqylt b rarwr-CONH 2 204 H 2 N-nlnhghlkfryhar-COOH 204.
- x s, t, y, other natural/non-natural H-bond donor/acceptor residue.
- H 2 N-qkifhlpla b sivglflfylllqfkiv-COOH 238.
- H 2 N-qkifhlpla b sivglflfylllqfkiv-CONH 2 239.
- H 2 N-qkifhlpla b sivglflfyl g lqfkiv-COOH 240.
- the following assay is designed to measure the relative antimicrobial activity of peptides by determining zones of growth inhibition.
- the top eleven prioritized target sequences identified in Example I were synthesized by solid-phase chain extension synthesis using conventional techniques. Each synthetic peptide was purified by RP-HPLC, and authenticated for purity and correct sequence by mass spectroscopy. Stock concentrations of the synthetic peptides were prepared at 1 mg/mL in 0.01% acetic acid and adjusted to pH 7.2. Synthetic peptides were assessed for antimicrobial efficacy, spectra, and conditional optima (pH 5.5 or 7.5) using the following modified radial diffusion assay, as detailed in Yount and Yeaman, PNAS 1010:7363-7368 (2004).
- Molecular grade agarose (1.0%) in 10 mM NaH 2 PO 4 H 2 O was prepared, pH adjusted to 7.5 or 5.5, and autoclaved for 15 minutes at 121° C., then held in a waterbath set at 48° C. until used.
- Mueller Hinton II overlay agarose was prepared by adding molecular grade agarose to Mueller Hinton II Broth at a final concentration of 1.0%, pH adjusted to 7.5 or 5.5, autoclaved for 10 minutes at 121° C., and then held at 48° C. until used.
- TLB Trypticase Soy Broth
- 10 mL Trypticase Soy Broth
- the cells were collected by centrifugation, washed in PBS, then 0.01% acetic acid adjusted to pH 7.2.
- the pellet was resuspended in TSB and standardized to a 0.5 McFarland turbidity standard.
- a 10 ⁇ l aliquot of the inoculum is added to 10 mL of the pH-adjusted 1.0% molecular grade agarose cooled to 48° C. resulting in a final inoculum concentration of 5 ⁇ 10 5 CFU/mL.
- the suspension is poured into a 15 ⁇ 100 mm Petri dish and allowed to solidify.
- the synthetic peptides identified in Table 22 were assayed for antimicrobial activity against known pathogenic microorganisms. These pathogenic microorganisms included five species of bacteria ( Staphylococcus aureus, Escherichia coli, Salmonella typhimurium, Pseudomonas aeruginosa and Bacillus subtilis ) and one species of fungi ( Candida albicans ) (see Table 23). Zones of growth inhibition were measured and were grouped as complete and/or partial growth zones for the assayed microorganism. Zones were considered complete clearance when there was no visible growth (i.e. completely clear or free of growth). Zones were considered partial clearance when growth was impeded or partially cleared (i.e.
- the lack of a zone is an indication of no antimicrobial activity of the test peptide against the target organism under the conditions tested.
- FIGS. 30 , 32 and 34 85% (46/54) of all peptide and microorganism combinations tested at neutral pH showed antimicrobial activity.
- the majority of peptides also maintained antimicrobial activity under acidic conditions, i.e. pH 5.5 ( FIGS. 31 , 33 and 35 ), albeit at a reduced level.
- the acidic pH reduced the antimicrobial activity of all peptides when tested against Staphylococcus aureus .
- 64% (7/11), 73% (8/11) and 73% (8/11) of the peptides showed lesser antimicrobial activity when tested against Escherichia coli, Pseudomonas aeruginosa and Salmonella typhimurium , respectively ( FIGS.
- Such molecules can target mitochondria, are often comprised of 20-60 amino acids, have the potential to form amphipathic ⁇ -helices that segregate hydrophobic and hydrophilic facets, and have one facet that is positively charged.
- the peptides described herein are highly consistent with such molecules. Therefore, the peptides described herein which have antimicrobial activity will also have anti-cancer, anti-inflammatory, anti-rheumatologic and other efficacy by virtue of their likelihood to target mitochondria and induce or cause dysfunctions in programmed cell death circuits.
- Example II utilizing the same antimicrobial assay above, the antimicrobial activity of peptides Hol-III-4 (SEQ ID NO: 268) and Ncl-VIII-6 (SEQ ID NO: 152 was determined by identifying zones of growth inhibition.
- Hol-III-4 and Ncl-VIII-6 peptides were assayed for antimicrobial activity against a panel of drug-resistant Gram-negative bacterial pathogens, specifically Pseudomonas aeruginosa , and various Acinetobacter spp. strains.
- the efficacies of these peptides were tested in the context of pH 5.5 ( FIGS. 36-46 ) and pH 7.5 ( FIGS. 47-57 ) conditions, and compared with other peptides known to have antimicrobial activity (e.g. RP-1, 6W-RP-1 (a 6-Trp variant of RP-1), IK, and PMP-2), in the radial diffusion assay.
- the RP-1 peptide is well known in the art to have antimicrobial activity, as illustrated in Yeaman et al., Antimicrobial Agents and Chemotherapy, 46(12):3883-3891 (2002).
- the 6W-RP-1 peptide is a 6-Trp variant of RP-1, which also has antimicrobial activity, as illustrated in Kilelee et al, Antimicrobial Agents and Chemotherapy 54(10):4476-4479 (2010).
- PMP is the C-terminal helix of the consensus molecule cPMP, as shown in Table 1 (bottom row; N-AALYKKKIIKKLLES-C; as shown in Yeaman et al., Bichimica et Biophysica Acta, 1768:609-619 (2007).
- the IK peptide is designed to have a nearly maximal polar angle (maximum angle is approximately 180°).
- the results of the antimicrobial assay show that both Hol-III-4 and Ncl-VIII-6 consistently showed significant antimicrobial activity against all Pseudomonas aeruginosa , and all Acinetobacter spp. strains tested.
- the current peptides are designed from programmed cell death effector or modulating proteins. Without being bound by theory, one hypothesis is that such peptides induce microbial and other target cell death by inducing or dysregulating programmed cell death. Thus, it is possible that these peptides function via a mechanism that is not identical to the RP-1-like peptides.
- PCD peptides evolved (e.g. diverged) from antimicrobial peptide sequences, based on the view that mitochondria are modern day “bacteria”; this is one hypothesis we posed in the patent. If so, then the mechanisms may be conserved among antimicrobial helices, even if the helices come from proteins believed to have vastly divergent functions (e.g. helices from PMPs, PCD proteins, chemokines, etc).
Abstract
The invention provide isolated peptides, protides and conjugates having novel peptide sequences which are able to induce antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity. The invention also provides a method of inducing programmed cell death in a cell by contacting the cell with an isolated peptide, protide or conjugate described herein. In some aspects, the method can be used in the diagnosis, prevention, or treatment of a disease, such as an infection, cancer, autoimmune disease, or inflammatory disease.
Description
- This application is a continuation of United States Non-provisional application Ser. No. 12/932,298, filed Feb. 22, 2011, which claims the benefit of priority of U.S. Provisional application Ser. No. 61/338,747, filed Feb. 22, 2010, the entire contents of which are incorporated herein by reference.
- The present invention relates generally to compositions and methods for inducing cell death, and more specifically to peptides and compositions having antimicrobial, anti-cancer, anti-inflammatory and/or anti-proliferative activity and methods of using the peptides and compositions as therapeutics.
- Programmed cell death pathways are known to exist in most if not all organisms on Earth, ranging from microbes to man. Proteins that effect this function, also known as apoptosis, have been identified in human, other mammals, plants, protozoa, fungi, and bacteria, among other forms of life. In humans, these proteins target the mitochondria, causing permeabilization, dissipation of the membrane potential, activation of intracellular signaling pathways, and ultimate death of the cell. Eukaryotic pathogens also contain mitochondria, and mitochondria are now widely accepted by evolutionary biologists to be decedents of specialized symbiotic bacteria in eukaryotic cells.
- Given these close parallels between mitochondria and bacteria, it is contemplated that specific human, eukaryotic or prokaryotic proteins have necessarily evolved to control prokaryotic symbionts (eg. mitochondria, chloroplasts) or competitors, and directly or indirectly prompt death of microbes or infected or abnormal cells. These types of proteins exhibit similarities in structures (eg., cationic helical domains) and mechanisms of action (eg., membrane interaction or perturbation that can lead to programmed cell death). Thus, such proteins may serve as excellent templates for novel therapeutic molecules, and reveal new insights into host-pathogen co-evolution, cancer biology, and other disease prevention, pathogenesis and treatment.
- Embodiments of the invention provide isolated peptides, protides and conjugates having novel peptide sequences which are able to induce antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity. Peptides, protides and conjugates provided by the invention comprise, consist essentially of, or consist of amino acid sequences represented by SEQ ID NOS:1-263 and 288-289. In some aspects, peptides, protides and conjugates described herein have conservative amino acid substitutions or alternative residues at specific locations within a peptide sequence. Non-limiting examples of such substitutions or alternative residues include when the amino acid residue is represented by (x) a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue can be substituted, or alternatively, when the amino acid residue is represented by (b) a lysine, an arginine, an asparagine, a glutamine or a basic residue can be substituted, or alternatively, when the amino acid residue is represented by (j) a cysteine or a thiol residue can be substituted, or alternatively, when the amino acid residue is represented by (o) an anthrylalanine or other non-natural amino acid can be substituted.
- Embodiments of the invention also provide methods of inducing programmed cell death in a cell by exposing the cell to an isolated peptide, protide or conjugate described herein. In some aspects, the methods can be used in the diagnosis, prevention, or treatment of a disease, such as an infection, cancer, autoimmune disease, or inflammatory disease.
- The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
-
FIG. 1 shows the amino acid sequence of exemplary programmed cell death/holin-like proteins (Dnm-1 (SEQ ID NO:280), Bax (SEQ IN NO:281) and Bcl-2 (SEQ ID NO:282)) identified in Homo sapiens. -
FIG. 2 shows the amino acid sequence of exemplary programmed cell death proteins (CidA (SEQ ID NO:283) and LrgA (SEQ IN NO:284)) identified in Staphylococcus aureus. -
FIG. 3 shows the amino acid sequence of exemplary candidate proteins (Perforin 1 from Bos taurus (SEQ ID NO:285), Bcl-2 from Homo sapiens (SEQ ID NO:286), and BCL-W from Homo sapiens (SEQ ID NO:287)) used for the iterative primary structure analysis of the protein databases (Blastp and/or equivalent thereof) available from the National Center for Biotechnology Information utilizing the basic local alignment sequence tool (BLAST). -
FIG. 4 shows an exemplary data score table sorted by alignment score using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 5 shows exemplary multisequence alignments using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 6 shows a phylogram of candidate programmed cell death effector peptides using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 7 shows a similarity alignment of helical region 1 (amino acids-˜450-490) between candidate peptides identified in the phylogram ofFIG. 6 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 8 shows a similarity alignment of helical region 2 (amino acids-˜540-560) between candidate peptides identified in the phylogram ofFIG. 6 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 9 shows a similarity alignment of helical region 3 (amino acids-˜590-620) between candidate peptides identified in the phylogram ofFIG. 6 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 10 shows a cladogram of candidate programmed cell deatheffector molecule subset 1 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 11 shows a similarity alignment ofhelical region 1/subset 1 (amino acids-˜180-225) between candidate programmed cell death effector molecules identified in the cladogram ofFIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 12 shows a similarity alignment ofhelical region 2/subset 1 (amino acids-˜270-290) between candidate programmed cell death effector molecules identified in the cladogram ofFIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 13 shows a similarity alignment ofhelical region 3/subset 1 (amino acids-˜-320-360) between candidate programmed cell death effector molecules identified in the cladogram ofFIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 14 shows a similarity alignment ofhelical region 4/subset 1 (amino acids-˜490-530) between candidate programmed cell death effector molecules identified in the cladogram ofFIG. 10 using the multisequence alignment tool ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. -
FIG. 15 shows a secondary structure diagram of human Bcl-2,isoform -
FIG. 16 shows a secondary structure diagram of human Bcl-2,isoform -
FIG. 17 shows a secondary structure diagram of human Bcl-xL. Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction. The amino acid sequence SQSNRELVVDFLSYKLSQK (SEQ ID NO:288) of a peptide predicted to have antimicrobial activity is shown in yellow. The amino acid sequence SQSNRELVVDFLSYKLSQK (SEQ ID NO:288) has also been identified as being conserved in multiple PCD-effector templates, including human Bcl-xL and Bcl-xβ, murine Bcl-xγ, and various related proteins. -
FIG. 18 shows a secondary structure diagram of human Bcl-W. Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction. The amino acid sequence TRALVADFVGYKLRQK (residues 1-16 of SEQ ID NO:14) of a peptide predicted to have antimicrobial activity is shown in yellow. -
FIG. 19 shows a secondary structure diagram of human Bax. Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction. The amino acid sequence RVVALFYFASKLVLKALCTK (residues 1-20 of SEQ ID NO:7) of a peptide predicted to have antimicrobial activity is shown in yellow. -
FIG. 20 shows a secondary structure diagram of human CTL Granulysin. Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction. The amino acid sequence RDYRTCLTIVQKLKKM having a peptide predicted of have antimicrobial activity (residues 3-17 of SEQ ID NO:224) is shown in yellow. -
FIG. 21 shows secondary structure diagram of human CTL Granulysin. Cylinders represent alpha helices. The colors are green for alpha helices, orange for beta strands, and blue for coils. The arrows on the helix cylinders point in the N-terminal to C-terminal direction. The amino acid sequence QKLKKIVIVDKPTQRSVSN (SEQ ID NO:289) of a peptide predicted to have antimicrobial activity is shown in yellow. -
FIG. 22 shows a secondary structure ribbon diagram of human Bax (1F16) protein. Helix-1, residues 104-129 are represented in red. -
FIG. 23 shows a secondary structure ribbon diagram of human Bax Helix-1, residues 104-129. Structure A shows the location of positive residues in blue. Structure B shows the most hydrophilic residues in blue and the most hydrophobic in brown. -
FIG. 24 shows a secondary structure ribbon diagram of human Bax (1F16) protein. Helix-2, residues 168-190 are represented in red. -
FIG. 25 shows a secondary structure ribbon diagram of human Bax Helix-2, residues 168-190. Structure A shows the location of positive residues in blue. Structure B shows the most hydrophilic residues as represented in blue and the most hydrophobic residues as represented in brown. -
FIG. 26 , panels A-D, show three dimensional alignments between human Bax Helix-1, residues 104-129 vs. IL-8 helix, residues 55-72. For the alignment analyses, comparative sequences of X and Y length are entered, and the computation prioritizes which span of those length are most comparable. Panel A shows a sequence alignment based on the following structural alignment. Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 104-129 (Red) and IL-8, residues 56-72 (Blue), whereas panel C shows an axial view of the same alignment. Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment. -
FIG. 27 , panels A-D, show three dimensional alignments between human Bax helix, residues 168-190 vs. IL-8 helix, residues 55-72. For the alignment analyses, comparative sequences of X and Y length are entered, and the computation prioritizes which span of those length are most comparable. Panel A shows a sequence alignment based on the following structural alignment. Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 168-190 (Red) and IL-8, residues 55-72 (Blue), whereas panel C shows an axial view of the same alignment. Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment. -
FIG. 28 , panels A-D, show three dimensional alignments between human Bax helix, residues 104-129 vs. magainin residues 1-16. For the alignment analyses, comparative sequences of X and Y length are entered, and the computation prioritizes which span of those length are most comparable. Panel A shows a sequence alignment based on the following structural alignment. Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 104-129 (Red) and magainin, residues 1-16 (Blue), whereas panel C shows an axial view of the same alignment. Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment. -
FIG. 29 , panels A-D, show three dimensional alignments between human Bax helix, residues 168-190 vs. magainin residues 1-16. For the alignment analyses, comparative sequences of X and Y length are entered, and the computation prioritizes which span of those length are most comparable. Panel A shows a sequence alignment based on the following structural alignment. Panel B shows a horizontal view of a ribbon diagram alignment between Bax, residues 168-190 (Red) and magainin, residues 1-16 (Blue), whereas panel C shows an axial view of the same alignment. Panel D shows the same ribbon alignment as panel B, wherein the most hydrophilic residues are represented in blue and the most hydrophobic residues are represented in brown. Also included in the figure are the root mean square deviation (RMSD) score and other results from the alignment. -
FIG. 30 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4, LrgA-I-4 and CidA-II-12 against pathogenic bacteria and fungi at pH 7.5. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations. -
FIG. 31 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4, LrgA-I-4 and CidA-II-12 against pathogenic bacteria and fungi at pH 5.5. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations. -
FIG. 32 shows a histogram of the antimicrobial spectra of exemplary peptides Dnm2-II-4, Dnm1-IV-2, Ncl-VIII-6 and Mfn1-II-2 against pathogenic bacteria and fungi at pH 7.5. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations. -
FIG. 33 shows a histogram of the antimicrobial spectra of exemplary peptides Dnm2-II-4, Dnm1-IV-2, Ncl-VIII-6 and Mfn1-II-2 against pathogenic bacteria and fungi at pH 5.5. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations. -
FIG. 34 shows a histogram of the antimicrobial spectra of exemplary peptides BclWP-I-4, Csp3-II-12, BclXb-I-2 and BaxP-I-18 against pathogenic bacteria and fungi at pH 7.5. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations. -
FIG. 35 shows a histogram of the antimicrobial spectra of exemplary peptides BclWP-I-4, Csp3-II-12, BclXb-I-2 and BaxP-I-18 against pathogenic bacteria and fungi at pH 5.5. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. See Tables 22 and 23 for peptide and microorganism designations. -
FIG. 36 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa CRM27853 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 37 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstPseudomonas aeruginosa PA 01 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 38 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstPseudomonas aeruginosa XEN 5 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 39 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstAcinetobacter baumannii 19606 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 40 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstAcinetobacter baumannii 17978 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 41 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter calcoaceticus 23055 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 42 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter haemolyticus 17906 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 43 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #ATCC at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 44 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacterbaumannii HUMC # 1 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 45 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacterbaumannii HUMC # 6 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 46 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacterbaumannii HUMC # 12 at pH 5.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 47 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Pseudomonas aeruginosa CRM27853 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 48 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstPseudomonas aeruginosa PA 01 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 49 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstPseudomonas aeruginosa XEN 5 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 50 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstAcinetobacter baumannii 19606 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 51 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) againstAcinetobacter baumannii 17978 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 52 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter calcoaceticus 23055 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 53 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter haemolyticus 17906 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 54 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacter baumannii HUMC #ATCC at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 55 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacterbaumannii HUMC # 1 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 56 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacterbaumannii HUMC # 6 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. -
FIG. 57 shows a histogram of the antimicrobial spectra of exemplary peptides Hol-III-4 (SEQ ID NO. 268) and NCl-VIII-6 (SEQ ID NO. 152) against Acinetobacterbaumannii HUMC # 12 at pH 7.5. Positive control peptides RP1, 6W-RP1, IK and PMP-2, whereas the negative control of double-distilled water (DDH2O) are also shown. The size of the complete zone of inhibition (ZOI) is represented by a blue bar, whereas the size of the partial (ZOI) is represented by a red bar. - Over the last several years, unforeseen structural, functional, and evolutionary relationships among host defenses and other proteins across all kingdoms of life have been discovered. In the course of the studies described herein, unifying themes among polypeptides based on sequence formulae, functional mechanisms, and/or 3D structures have been identified. Embodiments provided by the invention are based in part on the observations that 1) programmed cell death and apoptosis pathway proteins contain archetype sequences that confer membrane interacting/modifying domains similar to those of antimicrobial or other host defense peptides; 2) such sequences encode helical or other sequence and/or 3D structural signatures; and 3) such peptides exert antimicrobial and anti-cancer cell activities. Without being bound by theory, such peptides induce or regulate programmed cell death or related responses in target cells (e.g. microbial pathogens, cancer cells, etc.) leading to death of these cells. It is also contemplated that the mechanisms of action of peptides based on programmed cell death may activate archetypal apoptosis pathways in target cells, thus killing the target cell and circumventing resistance to existing antimicrobial, anti-cancer, or other preventive or therapeutic agents.
- Embodiments of the invention provide that novel antimicrobial, anti-cancer, anti-inflammatory and/or anti-proliferative activity peptides reside in peptide sequences of programmed cell death effector proteins by virtue of the evolutionary necessity for control of microbial and cancer cell survival by increasingly complex eukaryotic systems/symbionts. Thus mitochondrial, chloroplast, and/or nuclear-encoded proteins capable of activating and/or modulating programmed cell death pathways are contemplated to be evolutionary relatives/descendents of polypeptides that originally provided a survival advantage in the face of microbial or neoplastic challenge.
- The peptides, protides and conjugates described herein have the potential to create, augment, or improve several existing therapeutic, prophylactic, diagnostic, and basic research problems. For example, therapeutically, these peptides, protides and conjugates can address the problem of antibiotic-resistant infections and antineoplastic-resistant cancers. Likewise, the peptides, protides and conjugates may serve as immunotherapeutic agents to enhance or restore efficacy of endogenous host defenses. As adjunctive agents, these peptides, protides and conjugates will increase efficacy of conventional agents (such as antibiotics or anti-neoplastic agents), enhance immune functions, and activate or inactivate apoptotic mechanisms of cell regulation associated with aging or other degenerative conditions, and many other potential applications. The scope and diversity of other uses for these peptides, protides and conjugates are considerable. For example, the peptides, protides and conjugates described herein can be used as diagnostic probes in isotopic or non-isotopic forms to localize or characterize diseases or conditions containing signatures such as those characteristic of microbial, neoplastic, necrotic, apoptotic, or other tissues or cells. Additionally, extensions of the above concepts are applicable to the construction, design, delivery, and use of such peptides as research reagents.
- As will be clear to those skilled in the art, the above novel concepts relating to structure-activity relationships in programmed cell death proteins enabled the design of novel antimicrobial, anti-cancer, anti-inflammatory and anti-proliferative peptides, protides and conjugates. These peptides and compositions are useful as diagnostic, prophylactic, and/or therapeutic agents that exploit programmed cell death pathways in pathogens, cancer cells, autoimmune cells, and other disease-caused cells and tissues. Specific examples of peptides, variants, congeners, and mimetics of these molecules are included herein. Embodiments of the invention provide conjugates in which one given molecule can represent or include one or more antimicrobial, anti-cancer, anti-inflammatory, immunomodulatory peptide and one or more non-peptide functional motifs or domains, or combinations of these. Embodiments of the invention also provide protides which are multifunctional and context-activated polypeptides that have two or more effectors with individually distinct biological functions and one or more corresponding activator sites that can each initiate or amplify the biological function of one or more effectors upon context-activation. Therefore, peptides, protides and conjugates exemplified herein are relevant to Antibiotide, Immodulotide, Antineotide, Apoptide, and/or Cascatide class peptides.
- The novel concepts, peptide design strategies, and exemplifying peptides encompass conceptual as well as material inventions. Moreover, variations upon these fundamental themes are applicable to novel therapeutic agents and strategies in virtually any area of medicine, including, but not limited to diagnosis, prevention, and therapy of infectious diseases, cancer and cancer-like diseases, immune and autoimmune disorders, cardiology, aging, and/or other conditions or disease states. Furthermore, the novel peptides based on programmed cell death effectors described herein represent agents and strategies to treat human, animal, and agricultural diseases. Other applications include their use in diagnosis, prevention, or research of diseases, or as research tools to investigate pathogenesis, apoptosis, or related biological phenomena.
- Embodiments of the invention, herein provide an isolated peptide comprising one or more amino acid sequences selected from the group consisting of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the amino acid residue represented by (j) is a cysteine or a thiol residue, wherein in the amino acid residue represented by (o) is an anthrylalanine or other non-natural amino acid and wherein the peptide induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
- In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bax protein, which are represented by amino acid sequences of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 264, 270 and 271. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-W protein, which are represented by amino acid sequences of SEQ ID NOS: 17, 18, 19, 21-25, 269 and 272. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-xβ protein, which are represented by amino acid sequences of SEQ ID NOS: 30, 31-36 and 273. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bak protein, which are represented by amino acid sequences of SEQ ID NOS: 39-47. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 49-52. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bcl-2
isoform 1 protein, which are represented by amino acid sequences of SEQ ID NOS: 54-57. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Mth-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 59-63 and 274. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Mfn-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 66-75. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Dnm-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 84-93 and 275. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Dnm-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 102-106, 108-121, 267, 276 and 277. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Ncl protein, which are represented by amino acid sequences of SEQ ID NOS: 132-175. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Csp3 protein, which are represented by amino acid sequences of SEQ ID NOS: 179-187, 266 and 278. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Bad protein, which are represented by amino acid sequences of SEQ ID NOS: 191-199. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Prf-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 205-209 and 211-223. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Granulysin protein, which are represented by amino acid sequences of SEQ ID NOS: 227-235. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the CidA protein, which are represented by amino acid sequences of SEQ ID NOS: 238-243, 245-247, 265 and 279. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the LrgA protein, which are represented by amino acid sequences of SEQ ID NOS: 249-251. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Lambda S21 protein, which are represented by amino acid sequences of SEQ ID NOS: 253-256. In one aspect, the isolated peptide comprises one or more amino acid sequence, identified from the Holin protein, which are represented by amino acid sequences of SEQ ID NOS: 260-263 and 268. - Embodiments of the invention provide an isolated peptide consisting of an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 2, 5, 7, 9, 12, 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289, wherein the peptide induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
- In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bax protein, which are represented by amino acid sequences of SEQ ID NOS: 1, 2, 5, 7, 9 and 12. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bcl-W protein, which are represented by amino acid sequences of SEQ ID NOS: 14-16 and 20. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bcl-xβ protein, which are represented by amino acid sequences of SEQ ID NOS: 26-29. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bak protein, which are represented by amino acid sequences of SEQ ID NOS: 37 or 38. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the Bcl-2 protein, which is represented by amino acid sequence of SEQ ID NO: 48. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the Bcl-2
isoform 1 protein, which is represented by amino acid sequence of SEQ ID NOS: 53. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Mfn-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 58 or 64. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Mfn-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 65 or 72. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Dnm-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 76-83. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Dnm-2 protein, which are represented by amino acid sequences of SEQ ID NOS: 94-101, 107 and 114. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Ncl protein, which are represented by amino acid sequences of SEQ ID NOS: 122-131 and 170. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Csp3 protein, which are represented by amino acid sequences of SEQ ID NOS: 176-178. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Bad protein, which are represented by amino acid sequences of SEQ ID NOS: 188-190. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Prf-1 protein, which are represented by amino acid sequences of SEQ ID NOS: 200-204 and 210. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Granulysin protein, which are represented by amino acid sequences of SEQ ID NOS: 224-226. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the CidA protein, which are represented by amino acid sequences of SEQ ID NOS: 236, 237 and 244. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the LrgA protein, which is represented by amino acid sequence of SEQ ID NOS: 248. In one aspect, the isolated peptide consists of the amino acid sequence, identified from the Lambda S21 protein, which is represented by amino acid sequences of SEQ ID NOS: 252. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from the Holin protein, which are represented by amino acid sequences of SEQ ID NOS: 257-259. In one aspect, the isolated peptide consists of one or more amino acid sequence, identified from human Bcl-xL protein, which is represented by the amino acid sequence SEQ ID NO: 288 or human CTL Granulysin, which is represented by the amino acid sequence SEQ ID NO: 289. In one aspect, an isolated peptide as described herein has a C-terminus comprising a carboxamide. - Embodiments of the invention are intended to be used as in ways similar to antibiotic, anti-cancer, or similar medical administration either as local (e.g. topical, oral rinse, inhaled, nebulized, etc.) or systemic (oral ingestion, intravenous, intramuscular, etc) agents. Additionally, the peptides may be used as research tools for basic molecular biology, microbiology, biochemistry or other disciplines as they relate broadly to cellular or molecular biology, infection and immunity, cell regulation and apoptosis, gene expression, signal transduction, or any other area of investigation in which a concept, approach, or specific peptide or may be used.
- In certain embodiments, the invention provides novel isolated peptides having one or more continuous amino acids sequences. As used herein, a “peptide” generally has from about 3 to about 100 amino acids, whereas a polypeptide or protein has about 100 or more amino acids, up to a full length sequence translated from a gene. Additionally, as used herein a peptide can be a subsequence or a portion of a polypeptide or protein. In certain embodiments the size of at least one peptide may comprise, but is not limited to, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 amino acid residues.
- As used herein, an “amino acid residue” refers to any naturally or non-naturally occurring amino acid, any amino acid derivative or any amino acid mimic known in the art. In certain embodiments, the residues of the peptide are sequential, without any non-amino acid interrupting the sequence of amino acid residues. In other embodiments, the sequence may comprise one or more non-amino acid moieties. In particular embodiments, the sequence of residues of the peptide may be interrupted by one or more non-amino acid moieties. Accordingly, the term peptide encompasses amino acid sequences comprising at least one of the 20 common amino acids found in naturally occurring proteins, or at least one modified or unusual or non-natural amino acid, including, but not limited to, Anthrylalanine, 2 Aminoadipic acid (Aad), N Ethylasparagine (EtAsn), 3 Aminoadipic acid (Baad), Hydroxylysine (Hyl), β alanine, β Amino propionic acid (Bala), allo Hydroxylysine (AHyl), 2 Aminobutyric acid (Abu), 3 Hydroxyproline (3Hyp), 4 Aminobutyric acid (4Abu), 4 Hydroxyproline (4Hyp), 6 Aminocaproic acid (Acp), Isodesmosine (Ide), 2 Aminoheptanoic acid (Ahe), allo Isoleucine (AIle), 2 Aminoisobutyric acid (Aib), N Methylglycine (MeGly), 3 Aminoisobutyric acid (Baib), N Methylisoleucine (MeIle), 2 Aminopimelic acid (Apm), 6 N Methyllysine (MeLys), 2,4 Diaminobutyric acid (Dbu), N Methylvaline (MeVal), Desmosine (Des), Norvaline (Nva), 2,2′Diaminopimelic acid (Dpm), Norleucine (Nle), 2,3 Diaminopropionic acid (Dpr), Ornithine (Orn), or N Ethylglycine (EtGly).
- A peptide containing one or more mimetic structures having a similar charge and spatial or steric arrangements as the reference amino acid residues is included within the definition of the term so long as the peptide containing the mimetic portion exhibits a similar or enhanced activity as compared with the reference peptide. It is thus understood that a peptide described herein includes such mimetics as chemically modified peptides, peptide-like molecules containing non-naturally occurring amino acids, and peptoids, which are peptide-like molecules resulting from oligomeric assembly of N-substituted glycines, with similar or enhanced activity as compared with the reference protide upon which the mimetic is derived or having any other property desired by the user, for example, enhanced biostability (see, for example, Goodman and Ro, Peptidomimetics for Drug Design, in “Burger's Medicinal Chemistry and Drug Discovery” Vol. 1 (ed. M. E. Wolff; John Wiley & Sons 1995), pages 803 861), which is incorporated herein by reference in its entirety. Mimetics also include constrained-structures so as to maintain optimal spacing and charge interactions of the amino acid or of the amino acid functional groups. Those skilled in the art know or can determine what structures constitute functionally equivalent amino acid analogs and amino acid mimetics useful for preparation of a peptide described herein.
- Specific examples of amino acid analogs and mimetics can be found described in, for example, Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, Eds. Gross and Meinhofer, Vol. 5, p. 341, Academic Press, Inc., New York, N.Y. (1983), the entire volume of which is incorporated herein by reference. Other examples include peralkylated amino acids, particularly permethylated amino acids. See, for example, Combinatorial Chemistry, Eds. Wilson and Czarnik, Ch. 11, p. 235, John Wiley & Sons Inc., New York, N.Y. (1997), which is incorporated herein by reference in its entirety. Yet other examples include amino acids whose amide portion and, therefore, the amide backbone of the resulting peptide, has been replaced, for example, by a sugar ring, steroid, benzodiazepine or carbo cycle. See, for example, Burger's Medicinal Chemistry and Drug Discovery, supra, Ch. 15, pp. 619 620, which is incorporated herein by reference in its entirety. Methods for synthesizing peptides, polypeptides, peptidomimetics and proteins are well known in the art (see, for example, U.S. Pat. No. 5,420,109; Bodanzsky, Principles of Peptide Synthesis (1st ed. & 2d rev. ed.), Springer-Verlag, New York, N.Y. (1984 & 1993), see
Chapter 7; Stewart and Young, Solid Phase Peptide Synthesis, (2d ed.), Pierce Chemical Co., Rockford, Ill. (1984), each of which is incorporated-herein by reference in its entirety). - In one aspect, the peptide, protide or conjugate can comprise conservatively substituted sequences or alternative residues at specifically identified positions described herein, for example, residues identified in SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263. In general, a conservative substitution refers to replacement of a given amino acid residue with a residue having similar physiochemical characteristics. Examples of conservative substitutions include (1) non-polar amino acids (Gly, Ala, Val, Leu, and Ile); (2) polar neutral amino acids (Cys, Met, Ser, Thr, Asn, and Gln); (3) polar acidic amino acids (Asp and Glu); (4) polar basic amino acids (Lys, Arg and His); and (5) aromatic amino acids (Phe, Trp, Tyr, and His). Other such conservative substitutions, for example, include substitutions of entire regions having similar hydrophobicity characteristics or substitution of one H-bond donor/acceptor with another H-bond donor/acceptor. An alternative residue refers to a residue that may not be traditionally considered a conservative substitution, but when substituted at the designated position does not adversely effect the functional characteristics of the peptide.
- Hydrogen bonding (H-bond) is a non-covalent type of bonding between molecules or within them, intermolecularly or intramolecularly, and in the context of the peptides described herein include H-bond between amino acids. The H-bond donor is the molecule that has a hydrogen atom bonded to a highly electronegative, small atom with available valence. For example, H—O, H—N, and H—F bonds are extremely polar and as a result, the electron density is easily withdrawn from the hydrogen atom towards the electronegative atom. The partially positive hydrogen in one molecule attracts to partially negative lone pair of the electronegative atom on the other molecule, i.e. an H-bond acceptor, and thus a H-bond forms as a result of such an interaction.
- A “basic” residue refer to an amino acid residue which has a second basic group, which can be, but is not limited to, an amino group (i.e. lysine), a guanidine group (i.e. arginine), or an imidazole ring (i.e. histidine).
- A “thiol” residue refers to an amino acid residue which has a functional sulfur-hydrogen present in the side chain (i.e. cysteine or methionine). A thiol residue, such as cysteine, can also play an important role in the folding and stability of some peptides and proteins through the formation of disulfide bonds.
- A pathological condition appropriate for treatment with a peptide, protide or conjugate described here can be a symptomatic disease or other abnormal condition or injury of a mammalian cell or tissue. Such pathological conditions include, for example, hyperproliferative and unregulated neoplastic cell growth, degenerative conditions, inflammatory diseases, autoimmune diseases and infectious diseases. Hyperplastic and cancer cells proliferate in an unregulated manner, causing destruction of tissues and organs. Specific examples of hyperplasias include benign prostatic hyperplasia and endometrial hyperplasia.
- Abnormal cellular growth can also result from infectious diseases in which foreign organisms cause excessive growth. For example, human papilloma viruses can cause abnormal growth of tissues. The growth of cells infected by a pathogen is abnormal due to the alteration of the normal condition of a cell resulting from the presence of a foreign organism. Specific examples of infectious diseases include DNA and RNA viral diseases, bacterial diseases, fungal diseases, and protozoal or parasitic diseases. Similarly, the cells mediating autoimmune and inflammatory diseases are aberrantly regulated which results in, for example, the continued proliferation and activation of immune mechanisms with the destruction of tissues and organs. Accordingly, “anti-inflammatory activity” refers to a cellular response to a substance or treatment that reduces inflammation and “anti-proliferative activity” refers to a cellular response to a substance that prevents the proliferation or uncontrolled dividing of cells. Specific examples of autoimmune diseases include, for example, rheumatoid arthritis and systemic lupus erythmatosis. Specific examples of degenerative disease include osteoarthritis and Alzheimer's disease. Similarly, the terms infectious diseases, degenerative diseases, autoimmune diseases and inflammatory diseases are intended to include all classes and types of these pathological conditions. Those skilled in the art will know the various classes and types of proliferative, neoplastic, infectious, autoimmune and inflammatory diseases.
- By specific mention of the above categories of pathological conditions, those skilled in the art will understand that such terms include all classes and types of these pathological conditions. For example, the term cancer is intended to include all known cancers, whether characterized as malignant, benign, soft tissue or solid tumors, or hematologic tumors relating to cells in circulation, such as Anal Cancer, Basal Cell Carcinoma, Bladder Cancer, Bone Cancer (Osteosarcoma and Malignant Fibrous Histiocytoma), Brain Tumor, Breast Cancer, Bronchial Tumors, Burkitt Lymphoma, Central Nervous System Lymphoma, Cervical Cancer, Childhood Cancers, Colon Cancer, Colorectal Cancer, Eye Cancer (Intraocular Melanoma or Retinoblastoma), Gallbladder Cancer, Gastric (Stomach) Cancer, Germ Cell Tumor, Head and Neck Cancer, Kidney (Renal Cell) Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer (Non-Small Cell), Lung Cancer (Small Cell), Neuroblastoma, Oral Cancer (Oropharyngeal Cancer), Ovarian Epithelial Cancer, Pancreatic Cancer, Paranasal Sinus and Nasal Cavity Cancer, Parathyroid Cancer, Penile Cancer, Prostate Cancer, Rhabdomyosarcoma, Salivary Gland Cancer, Sarcoma, Skin Cancer (Nonmelanoma), Skin Cancer (Melanoma), Skin Carcinoma (Merkel Cell), Testicular Cancer, Throat Cancer, Thymoma and Thymic Carcinoma, Thyroid Cancer, Urethral Cancer and Vaginal Cancer. Accordingly, “anti-cancer activity” refers to a cellular response to a substance that kills or inhibits the growth of a cancer cell. Cancer cells typically display uncontrolled growth (division beyond the normal limits), invasion (intrusion on and destruction of adjacent tissues), and sometimes metastasis (spread to other locations in the body via lymph or blood). Peptides, protides and conjugates described herein which have anti-cancer activity can kill the cancer cell or prevent the invasion or metastasis of the cancer cell into other tissues. It is contemplated that the mechanism of action through which this activity occurs is through the programmed cell death or related responses in the cells.
- “Antimicrobial activity” refers to a cellular response to a substance that kills or inhibits the growth of a microorganism, such as bacteria, fungi or protozoans. Peptides described herein which have antimicrobial activity can either kill the microorganism (microbicidal) or prevent the growth of the microorganism (microbistatic). In some aspects, the peptides, protides and conjugates described herein show antimicrobial activity again pathogenic microorganisms. A “pathogenic microorganism” refers to a microorganism that causes a disease, disorder or condition, which is commonly referred to as an infection. Pathogenic microorganisms are well known to one of skill in the art and include pathogenic bacteria such as Acinotobacter baumannii, Acinotobacter calcoaceticus, Acinotobacter haemolyticus, Bordetella pertussis, Borrelia burgdorferi, Brucella abortus, Brucella canis, Brucella melitensis, Brucella suis, Campylobacter jejuni, Chlamydia pneumoniae, Chlamydia psittaci, Chlamydia trachomatis, Clostridium botulinum, Clostridium difficile, Clostridium perfringens, Clostridium tetani, Corynebacterium diphtheriae, Enterococcus faecalis, Enterococcus faecum, Escherichia coli, Francisella tularensis, Haemophilus influenzae, Helicobacter pylori, Legionella pneumophila, Leptospira interrogans, Listeria monocytogenes, Mycobacterium leprae, Mycobacterium tuberculosis, Mycoplasma pneumoniae, Neisseria gonorrhoeae, Neisseria meningitides, Pseudomonas aeruginosa, Rickettsia rickettsii, Salmonella typhi, Salmonella typhimurium, Shigella sonnei, Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus saprophyticus, Streptococcus agalactiae, Streptococcus pneumoniae, Streptococcus pyogenes, Treponema pallidum, Vibrio cholerae and Yersinia pestis, pathogenic fungi such as Cryptococcus neoformans, Aspergillus fumigatus, Aspergillus flavus, Aspergillus clavatus, Cryptococcus neoformans, Cryptococcus laurentii, Crytococcus albidus, Histoplasma capsulatum, Pneumocystis jirovecii, Stachybotrys chartarum and several members of the Canidida species, such as C. albicans, C. glabrata, C. tropicalis, C. stellatoidea, C. glabrata, C. Krusei, C. parapsilosis, C. guilliermondii, C. viswanathii and C. lusitaniae. Additional examples of pathogenic microorganisms are described by Jorgensen and Pfaller in “A Clinician's Dictionary of Pathogenic Microorganisms” ASM Press (2004), which is herein incorporated by reference in its entirety.
- Human infections due to antibiotic-resistant bacteria and fungi are increasing in frequency and severity. Microbial pathogens exhibiting resistance to one or more antibiotics can now commonly be found in community and nosocomial settings. Antibiotic resistant pathogens currently of the greatest concern are methicillin (multiple) resistant Staphylococcus aureus (MRSA), vancomycin resistant Enterococcus faecalis and Enterococcus faecium (VRE), multi-drug-resistant Streptococcus pneumoniae (MDRSPn) or Streptococcus pyogenes (MDRBRSPy), Pseudomonas aeruginosa (MDRA), and Candida albicans (MDRCA).
- “Programmed cell death” or “PCD” is death of a cell in any form, mediated by an intracellular program. In contrast to other types of cell death, such as necrosis, PCD is carried out as a regulated process which generally confers advantages during an organism's life-cycle. A strategic advantage of apoptosis is that it typically does not induce broader inflammatory responses, which can be injurious and/or delay wound healing, whereas necrosis often induces considerable inflammation. PCD is commonly categorized by two types, apoptosisin (type I cell-death) or autophagic (type II cell death). Apoptosisin, also known as apoptosis, is a series of biochemical events leading to a characteristic cell morphology including blebbing, loss of membrane asymmetry and attachment, cell shrinkage, nuclear fragmentation, chromatin condensation and chromosomal DNA fragmentation known as laddering. Autophagic PCD is a catabolic process involving the degradation of a cell's own components and organelles through the lysosomal machinery prior to the nucleus being destroyed. Additionally, in some aspects, PCD refers to other pathways that have been described including non-apoptotic (i.e. caspase-independent) programmed cell-death, necrosis-like programmed cell death, anoikis, excitotoxicity and Wallerian degeneration.
- Embodiments of the invention provide a context-activated protide having at least one activator site and two or more effectors, wherein at least one effector comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the amino acid residue represented by (j) is a cysteine or a thiol residue, wherein the amino acid residue represented by (o) is an anthrylalanine or other non-natural amino acid and wherein the at least one effector induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity. Embodiments of the invention also provide a context-activated protide comprising at least one activator site and two or more effectors, wherein at least one effector comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 2, 5, 7, 9, 12, 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289, wherein the at least one effector induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity
- In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bax protein, referenced by the amino acid sequence of SEQ ID NOS: 1-13, 264, 270 and 271. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-W protein, referenced by the amino acid sequence of SEQ ID NOS: 14-25, 269 and 272. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-xβ protein, referenced by the amino acid sequence of SEQ ID NOS: 26-36 and 273. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bak protein, referenced by the amino acid sequence of SEQ ID NOS: 37-47. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 48-52. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bcl-2
isoform 1 protein, referenced by the amino acid sequence of SEQ ID NOS: 53-57. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Mfn-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 58-64 and 274. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Mfn-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 65-75. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Dnm-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 76-93 and 275. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Dnm-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 94-121, 267, 276 and 277. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Ncl protein, referenced by the amino acid sequence of SEQ ID NOS: 122-175. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Csp3 protein, referenced by the amino acid sequence of SEQ ID NOS: 176-187, 266 and 278. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Bad protein, referenced by the amino acid sequence of SEQ ID NOS: 188-199. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Prf-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 200-223. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Granulysin protein, referenced by the amino acid sequence of SEQ ID NOS: 224-235. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the CidA protein, referenced by the amino acid sequence of SEQ ID NOS: 236-247, 265 and 279. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the LrgA protein, referenced by the amino acid sequence of SEQ ID NOS: 248-251. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Lambda S21 protein, referenced by the amino acid sequence of SEQ ID NOS: 252-256. In one aspect of the invention, the protide has at least one effector comprising an amino acid sequence, identified from the Holin protein, referenced by the amino acid sequence of SEQ ID NOS: 257-263 and 268. In one aspect, the protide has at least one effector comprising an amino acid sequence, identified from human Bcl-xL protein, which is represented by the amino acid sequence SEQ ID NO: 288 or human CTL Granulysin, which is represented by the amino acid sequence SEQ ID NO: 289. - In one aspect, the activator site is context-activated. The invention also provides that upon context-activation, the protide initiate programmed cell death of the target cells. In some aspects, the context-activation results from a physiological condition, such as, but not limited to acidity, alkalinity, ionic strength or osmotic strength. In some aspects, the context-activation results from association with an activator molecule. The activator molecules can modify the activator site upon association. In some aspects, modification of the activator site includes cleavage of the activator site. In some aspects, the activoator molecule is an enzyme, such as a protease, esterase or lipase. In one aspect, the activator is expressed by a pathogenic microorganism as described herein. In another aspect, the activator is present in the context of a tumor cell, such as a tumor-specific protease. An example of a tumor-specific protease is a matrix bound protein such as matrix metalloproteinase. In another aspect, the activator is present in the context of an inflammatory response, wherein activators such as thrombin, bradykinin, elastase and metalloproteinase are expressed.
- The term “protide,” as used herein, refers to a mosaic molecule composed of two or more peptide or non-peptide functional domains, referred to as effectors, and one or more corresponding activator sites. A protide can consist of an indefinite number of effector and activator domains that can vary in function, activation, position, continuity, or sequence. Additional examples of protide compositions and designs are described in U.S. Patent Application Publication 2006-0074016, 2006-0135416 and U.S. Pat. No. 7,067,621, which are herein incorporated by reference.
- The protides described herein have two or more distinct biological functions and are designed to be activated within a defined or characteristic context. The protides described herein have at least one activator site and two or more effectors, wherein at least one of the effectors has and amino acid sequence of a peptide described herein. Protides have the advantage of designs that can be customized, engineered, chosen, or combined to allow for highly selective correspondence to or association with or unique to a specific pathological condition or etiology. The distinct biological functions can further be associated with distinct functional aims, for example, therapy, prevention, amplification and detoxification. As described herein, a multifunctional, context-activated protide can be designed to be activated in any context desired by the user, a feature which makes the protides useful to applications in many areas of medicine and biomedical research, including, for example, diagnosis, imaging, detection, speciation or other specification, prevention/prophylaxis, and therapy of a wide range of pathological conditions such as infectious diseases, neoplastic diseases, immune and autoimmune disorders, cardiovascular conditions, disorders in metabolism or physiology, diseases of inheritance or genetic abnormality, a variety of pathological conditions associated with gene expression, mitochondrial dysfunction or regulation, as well as cell death and/or cellular senescence.
- As described herein, in addition to their direct antimicrobial efficacies, the peptides, protides and conjugate described herein are useful based on their ability to circumvent or minimize conventional resistance mechanisms by pathogens or tumor cells. For example, this can be the result of activation by activators that are present outside of the target cell such that the peptides, protides or conjugate need not necessarily enter the target cell to be activated and to achieve subsequent efficacy, thus minimizing the likelihood for resistance due to reduced target access or increased efflux of the peptides, protides or conjugate. Furthermore, in many conventional resistance mechanisms, resistance can be induced by the presence of the anti-infective agent itself. In particular, protides can be designed to be activated by such microbial counter-responses or virulence factors. Thus, the more of the activator that is made by the organism, the more protide activation results, yielding an expected amplification of the anti-pathogenic efficacy of the protide. Conversely, decreased production of the activators can translate in turn to decreased presence or function of these same activators such as virulence factors or mediators of pathogenesis, in essence turning off the pathogenic potential of the target cell, or reducing its ability to protect itself from otherwise normal host defenses. Similarly, protides can be beneficial by reconstituting tumor cell or microbial pathogen susceptibility to conventional therapeutic agents, to which these pathogenic cells would otherwise be resistant. Thus, the protides can either be activated from upregulation of resistance- or virulence factor expression, or can impact efficacy by effecting the downregulation of virulence factor expression by pathogenic cells or organisms.
- In applications of the methods described herein, involving an established infection or a host response to infection, activators can be present or generated. An activator useful for activation of a protide of the invention can be advantageously selected based on a high concentration in the immediate proximity of the infection locus so as to allow for activation of the majority of protides in the desired context. One skilled in the art will be able to select an activator that represents the desired activation context. For applications of the invention methods in the arena of microbial infection, context-activation can be designed to specifically occur in the local context of infection so as to effect optimal relative protide effector concentrations in specific contexts of infection. In addition to context activation that maximizes efficacy, the protides and methods of the invention also minimize the potential for inadvertent host cytotoxicity in areas that do not represent the context. Therefore, in the absence of infection, the protide activators are either absent or are present at concentrations insufficient for effective protide activation, thereby minimizing inadvertent or indiscriminant acute toxicity.
- In addition to specific pathogen or host molecules that can serve as activators as described above, protides can also be designed to become activated to diagnose, prevent, or treat infection in unique and/or specific biochemical or physiological contexts associated with microbial pathogens. Examples of such biochemical or environmental contexts include ionic, osmotic, pH, oxidation/reduction, or other conditions that are unique to, characteristic of, or present in the context of infection or disease processes that occur upon infection, or host responses to these events. For example, a protide can be designed to require the influence of protonation, conformation change, or other modification that occurs uniquely or disproportionately in the context of acidic pH, to activate the protide or its ensuing effectors by altering their structure-activity relationship(s) from inactive to active. As one example, genitourinary tissues, such as renal-tissues or genitourinary mucosa, can exhibit pH values that are decreased normally, or in the setting of infection. A protide designed to be activated only under such acidic conditions could be designed to either be vulnerable to activation in these conditions, or directly activated by these conditions, and thus would be predicted to be active only in such contexts. Alternatively, protides can be designed to be inactive in particular contexts or conditions, such as conditions of relatively high osmotic strength or relatively high pH, so as to minimize or prevent untoward or toxic effects such as nephro- or hepatotoxicity. By way of a further example, activation as well as leukocyte accumulation are conditions associated with infection. Moreover, a fundamental strategy of host defense phagocytes is to phagocytize the microbial pathogen, subjecting it to the harsh environment of the acidic phagolysosome. The compartment so created can become acidified to pH values of 5.5 or lower as the leukocyte responds to the pathogen. Therefore, a protide can be designed that is activated or has amplified or antimicrobial activities, for example, by pH, phagolysosomal enzymes or reactants, or a combination of these conditions, or can amplify or potentiate the antimicrobial mechanisms of leukocytes or other host cells within such settings, so as to inhibit or kill pathogens that enter such cells.
- Protide activation also can include conformational, oxidation or reduction-mediated changes in disulfide array, assembly into multimers of two or more homomeric (identical) or heteromeric (non-identical) effectors, or other modifications of the protide and/or its subsequent effectors. In a particular embodiment, protide activation is triggered as a result of protide accumulation, or its resulting effector components, so as to achieve or surpass threshold concentrations required to optimize or catalyze activation or activity through multimerization or other modification in structure or function of the protide or its effectors.
- It is understood, that activation can involve combinations of the protide activation strategies described above. For example, a protide can be designed that is not responsive to an activator unless both the protide and the activator are present within a context associated with or resulting from infection or other disease.
- The term “context-activated,” as used herein in reference to a protide of the invention, refers to the initiation, activation or amplification of a biological or other desired, for example, diagnostic or prophylactic function of one or more protide effectors in a particular temporal, spatial, pathological and/or biochemical context. Context-activation can be initiated by direct or indirect interaction between a protide activator site and a corresponding activator that is selectively associated with the particular context. As used herein, context-activation encompasses activation in a wide variety of contexts that can include, for example, local, regional, systemic, and/or temporal proximity; as well as the presence or absence of an etiological agent, pathologic condition, or characteristic components thereof.
- Thus, context need not be limited to a place, time or quality, but also can be the presence or absence of an activator, for example, an enzyme elaborated by an organism such as, for example, a specific strain of bacteria. The context for activation can consequently be of any breadth desired by the user, for example, can target a class of organisms or cell types, for example, by using an activator that is ubiquitous to the targeted class, or can alternatively have a more narrow focus by using an activator that represents a more narrowly defined target, for example, a particular genus, organism, species, subspecies, strain, or cell or tissue type. The context can be associated with a pathological condition, but also can be selected to represent a non-pathological environment, for example, in prophylactic applications of the invention practiced to preserve a normal or homeostatic condition.
- As used herein, the term “effector” refers to the peptide or non-peptide functional domains of a protide provide herein that have specific individual functions, which are initiated or amplified upon activation and achieve specific functions relating to the diagnosis, prevention, or treatment of a disease. As described herein, a protide has at least two effector domains with distinct, complementary and/or synergistic biological functions. An effector is inactive or exhibits relatively reduced or attenuated biological activity unless an activator, by virtue of either its presence or absence, alters or facilitates or allows the altering of its corresponding activator site and, as a result, initiates or amplifies the diagnostic, prophylactic, therapeutic, or other biological function(s) of the effector(s). Multiple effectors can be induced by the same activator site. Peptide and non-peptide effectors can be present in the same protide, which can be referred to as a hybrid protide. Similarly, a protide can consist exclusively of peptide effectors, also referred to as a peptide protide. Similarly, a protide of the invention can consist exclusively of non-peptidic effectors. The biological function(s) of an effector that corresponds to a protide described herein can be, for example, antimicrobial, immunomodulatory, pro- or anti-inflammatory, tumoricidal, pro- or anti-apoptotic, pro- and anti-angiogenic and/or hemolytic.
- As described herein, a protide of the invention can be bifunctional or multifunctional, with two or more unique complementary effectors, and one or more activators as determined by specific effector and activator site domains engineered into the mosaic protide, which can be activated by specific molecules or conditions present in unique or strategic contexts of interest. Examples of such effectors can include one or more antimicrobial, anti-neoplastic, anti-inflammatory, immunomodulatory, or other peptide or non-peptide functional domains, or combinations thereof.
- As used herein, the term “activator site” when used in reference to a protide of the invention, refers to a domain of the protide that, in the presence of an activator, initiates, promotes, amplifies or modulates the specific biological function of one or more effectors. As described herein, an activator site can be modified, cleaved, processed or otherwise altered in the presence of an activator. In addition, an activator site can be sensitive either to the absolute presence or absence of an activator as well as can be sensitive to a threshold concentration of an activator rather than its mere presence.
- An activator site useful in the invention can include one or more sites for cleavage, modification, processing or other triggering by strategic activators, which can be, for example, proteases, esterases, lipases, or other endogenous enzymatic activators or cascades generated by or associated with a specific condition such as, for example, the presence of pathogenic microorganisms, damaged or inflamed tissues, or hematologic or solid neoplastic or pre-neoplastic cells or tumors. Such an activator site also can be selected to exploit contexts associated with biochemical or physical conditions such as requisite acidity or alkalinity, for example, acidic phagolysomes containing intracellular bacteria or fungi; or ionic or osmotic strength, for example, in a renal context, that represent a specific pathologic or non-pathologic context. Furthermore, an activator site can be selected to exploit normal rather than a pathologic context.
- An activator site can be subject to proteolytic as well as non-proteolytic activation. For example, the activator site can be located within the peptide moiety, and require a protease activator. In other embodiments, the non-proteolytic activator can target a non-proteinaceous substrate component of the protide. For example, a protide of the invention can include an esterase activator and can link peptide and/or non-peptide moieties (eg. a protide consisting of peptide and conventional antibiotic effectors) by means of an ester bond. Other biochemically relevant bonds or linkages that can serve as activation sites in an invention protide can include, for example, lipase- (lipid cleaving), nuclease- (nucleic acid cleaving), and kinase or phosphatase- (phosphate addition or removal) sensitive activators that target substrates other than peptides. For example, certain microbial pathogens or tumor cells can express, or abnormally express restriction enzymes that can provide a suitable basis for design of a protide that could be activated only-within the target cell, further reducing indiscriminant host cytotoxicity.
- As used herein, the term “activator” refers to a molecule or condition that, by altering the activator site, causes the liberation or onset of a specific diagnostic or biological function of effector(s). As described herein, an activator can be a normal or abnormal exogenous or endogenous cell, structure or molecule, a condition or milieu (normal or abnormal), or a combination thereof that is associated with a specific context in which activation of the protide is desired. Thus, an activator can be selected based on its presence in a temporal, spatial, or physiological context, which can be normal or abnormal, that is associated with the desired context for protide activation. An activator can consequently include physiological conditions including, for example, acidity, alkalinity, conditions of oxidation or reduction, and/or ionic and/or osmotic strength, that are associated with a particular context, and modulate protide activation. Alternatively, an activator can be a structure or molecule, for example, an enzyme, that is present in a particular spatial, temporal or pathological context. The activator molecule can modify the activator site upon association, for example, by cleavage or other modification that results in activation in the particular context, or can facilitate interaction between protide and activator(s). The activator molecule can be an enzyme including, for example, protease, esterase, lipase, nucleases or peptidase.
- In one embodiment of the invention, an activator site can encompass one or more domains for cleavage, modification, processing or any other type of liberation by an activator, for example, a protease, esterase, lipase or other endogenous or exogenous enzymatic activator or cascade. The choice of one or more activator sites that correspond to specific activators depends directly on the desired context for activation. Thus, an activator can be a particular pathologic setting or condition that is chosen based on its association with a particular etiological agent or host response. In the presence of the activator, one or more effectors are liberated so as to achieve a specific function relating to, for example, the treatment, prevention, or diagnosis of a targeted disease. An activator site can thus be strategically designed to become activated in temporal and spatial proximity to activator expression, thereby allowing the activation of a protide to be targeted to a particular context and over time so as to maximize the desired therapeutic or prophylactic effect, while minimizing untoward or undesirable toxicities or other side effects.
- As described herein, an activator site is selected based on its correspondence and/or association with the context in which the two or more protide effectors are to be liberated so as to initiate or potentiate their functions. Therefore, as long as an activator is associated with the context, the invention can be practiced with any context desired. Those skilled in the art will appreciate that, given the versatility of activators useful for practicing the invention as described herein, a protide can be designed based on virtually any context desired, including, for example, vascular injury, presence of a neoplasm or cancer, infection, and inflammation.
- In one embodiment, the protide is an antimicrobial protide, which also can be referred to as an antimicrotide. Cleavage sites for strategic proteases can be engineered into multifunctional antimicrobial protides so as to represent the activator site of the protide. Upon activation of the protease in the localized or generalized context of tissue injury or infection, as selected by the user, the inactive protide is cleaved, liberating independent and active molecules to effect their respective biological functions. Prior to and beyond the setting of activation of the strategic protease representing the activator, the mosaic protide construct is relatively inactive both with respect to antimicrobial function and host cell toxicity. A mosaic protide construct can consist of an indefinite number (1 through n) of effector and activator domains that can vary in function, activation, position, continuity, or sequence. Effectors corresponding to one or more protides activated by the same or distinct activators also can function synergistically, and/or can recombine in a manner facilitating their complementary functions. As an example, in the context of vascular injury, a protide activator can be selected that specifically represents this particular context, for example, a clotting cascade protease such as thrombin, or a complement fixing protease such as a C3 convertase, for example, C4B2A or C3bBb. Similarly, as another example, a protide activator can be selected that represents a broader constellation of symptoms or conditions, such as sepsis, in which corresponding activators can include serine proteases associated with systemic inflammation, sepsis, or injury, such as activated protein C.
- A further embodiment of the invention encompasses anti-neoplastic protides, which also are referred to as antineotides. Many tumor cells produce or overexpress characteristic activators, such as matrix metalloproteinases (MMP) or other enzymes that are not expressed by, or at levels much higher than normal cells. Consequently, the activator can be a tumor-specific protease, for example, a matrix metalloproteinase or thymidylate synthase (TS), which is overexpressed in the majority of cancers. A tumor-specific protease also can be associated with a more narrow neoplastic context, such as a serine protease that is specifically expressed in prostate cells, for example, PSA, human kallikrein-2 (hK2), human kallikrein-11 (hK11) and TMPRSS2.
- Embodiment of the invention provide a conjugate having one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 3, 4, 6, 8, 10, 11, 13, 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263 and a moiety, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the amino acid residue represented by (j) is a cysteine or a thiol residue, wherein in the amino acid residue represented by (o) is an anthrylalanine or other non-natural amino acid and wherein the conjugate induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity. Embodiments of the invention also provide a conjugate having one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 2, 5, 7, 9, 12, 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289 and a moiety, wherein said conjugate induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
- In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bax protein, referenced by the amino acid sequence of SEQ ID NOS: 1-13, 264, 270 and 271. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-W protein, referenced by the amino acid sequence of SEQ ID NOS: 14-25, 269 and 272. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-xβ protein, referenced by the amino acid sequence of SEQ ID NOS: 26-36 and 273. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bak protein, referenced by the amino acid sequence of SEQ ID NOS: 37-47. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 48-52. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bcl-2
isoform 1 protein, referenced by the amino acid sequence of SEQ ID NOS: 53-57. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Mth-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 58-64 and 274. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Mfn-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 65-75. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Dnm-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 76-93 and 275. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Dnm-2 protein, referenced by the amino acid sequence of SEQ ID NOS: 94-121, 267, 276 and 277. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Ncl protein, referenced by the amino acid sequence of SEQ ID NOS: 122-175. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Csp3 protein, referenced by the amino acid sequence of SEQ ID NOS: 176-187, 266 and 278. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Bad protein, referenced by the amino acid sequence of SEQ ID NOS: 188-199. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Prf-1 protein, referenced by the amino acid sequence of SEQ ID NOS: 200-223. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Granulysin protein, referenced by the amino acid sequence of SEQ ID NOS: 224-235. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the CidA protein, referenced by the amino acid sequence of SEQ ID NOS: 236-247, 265 and 279. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the LrgA protein, referenced by the amino acid sequence of SEQ ID NOS: 248-251. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Lambda S21 protein, referenced by the amino acid sequence of SEQ ID NOS: 252-256. In one aspect of the invention, the conjugate has at least one or more amino acid sequence, identified from the Holin protein, referenced by the amino acid sequence of SEQ ID NOS: 257-263 and 268. In one aspect, the conjugate has at least one or more amino acid sequence, identified from human Bcl-xL protein, which is represented by the amino acid sequence SEQ ID NO: 288 or human CTL Granulysin, which is represented by the amino acid sequence SEQ ID NO: 289. - In one aspect, the moiety comprises a therapeutic agent, a targeting peptide or a label. In one aspect, therapeutic agent is a cytotoxic agent, such as an antibiotic or a chemotherapeutic agent. In one aspect, the targeting peptide selectively homes a conjugate described herein to a microorganism, a tumor tissue, tumor cell or tumor vasculature. In one aspect, the targeting peptide selectively homes the conjugate to an immune regulatory cell or an immune effector cell. In one aspect, the conjugate described herein has a targeting peptide, such as, but not limited to, an antibody or a fragment thereof. In another aspect, the moiety of the conjugate described herein is a label, such as a radioisotope or a dye.
- As used herein, the term “conjugate” refers to a peptide having an amino acid sequence as described herein linked to a moiety. A “moiety” is used broadly to mean a physical, chemical, or biological material that is linked to a peptide for the purpose of targeting the peptide to a select organ, tissue or cell type or providing an additional functional group to the peptide. In particular, a moiety is a biologically useful moiety such as therapeutic moiety, a diagnostic moiety or a drug delivery vehicle. Thus, a moiety can be a therapeutic agent, for example, a cancer chemotherapeutic agent. Cancer chemotherapeutic agents are well known to one of skill in the art and include, without limitation, alkylating agents such as cyclophosphamide, mechlorethamine, chlorambucil and melphalan, anthracyclines such as daunorubicin, doxorubicin, epirubicin, idarubicin, mitoxantrone and valrubicin, cytoskeletal disruptors such as paclitaxel and docetaxel, epothilones such as epothilones A through F, inhibitors of topoisomerase II such as etoposide, teniposide and tafluposide, nucleotide analogs and precursor analogs such as azacitidine, azathioprine, capecitabine, cytarabine, doxifluridine, fluorouracil, gemcitabine, mercaptopurine, methotrexate, and tioguanine, peptide antibiotics, such as bleomycin, platinum-based agents such as carboplatin, cisplatin and oxaliplatin, retinoids such as tretinoin, and vinca alkaloids or their derivatives such as vinblastine, vincristine, vindesine and vinorelbine. Such a moiety when linked to a peptide, provides a conjugate useful for treating a cancer in a subject. In addition, a moiety can be a drug delivery vehicle such as a chambered microdevice, a cell, a liposome or a virus, which can contain an agent such as a drug or a nucleic acid.
- A moiety also can be a targeting peptide or nucleic acid, to which a peptide as described herein is grafted for the purpose of directing the peptide to a selected organ, tissue, tumor or cell (Smith et al., J. Biol. Chem. 269:32788-32795 (1994); Goldman et al., Cancer Res. 15:1447-1451 (1997) and U.S. Pat. No. 6,576,239, each of which is incorporated herein by reference). For example, a targeting peptide or nucleic acid can be expressed as a fusion protein with a desired peptide such that the peptide or nucleic acid targets the grafted peptide to a selected tumor tissue, tumor cell or tumor vasculature. Such a desired peptide, which is grafted to the tumor homing peptide, can be a polypeptide involved in initiating a programmed cell death pathway as described herein or inducing any other cellular response resulting in anti-cancer activity. Additionally, targeting peptides, which can be grafted to a peptide as described herein having antimicrobial activity, include peptides that selectively home to a microorganism. For example, peptide sequences have been identified that selectively bind to surface molecules of fugal pathogens such as invasive Aspergillus species as described in U.S. Patent Application 2005-0187161. Still further, the invention provides a conjugate wherein the targeting peptide selectively homes the desired peptide to a cell involved in the immune response, including immune regulatory cells such as lymphocytes or immune effector cells such as macrophages or granulocytes. Conjugates provided herein include these and other exemplary peptide or nucleic acid sequences grafted to a peptide described herein. tumor tissue, tumor cell, tumor vasculature, immune regulatory cell or immune effector cell.
- A “targeting peptide” is a peptide comprising a contiguous sequence of amino acids, which is characterized by selective localization to an organ, tissue, or cell type. Selective localization may be determined, for example, by methods disclosed below, wherein the putative targeting peptide sequence is incorporated into a protein that is displayed on the outer surface of a phage. Administration to a subject of a library of such phage that have been genetically engineered to express a multitude of such targeting peptides of different amino acid sequence is followed by collection of one or more organs, tissues, or cell types from the subject and identification of phage found in that organ, tissue, or cell type. A phage expressing a targeting peptide sequence is considered to be selectively localized to a tissue or organ if it exhibits greater binding in that tissue or organ compared to a control tissue or organ. Preferably, selective localization of a targeting peptide should result in a two-fold or higher enrichment of the phage in the target organ, tissue, or cell type, compared to a control organ, tissue, or cell type. Selective localization resulting in at least a three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, ten-fold or higher enrichment in the target organ compared to a control organ, tissue or cell type is more preferred. Alternatively, a phage expressing a targeting peptide sequence that exhibits selective localization preferably shows an increased enrichment in the target organ compared to a control organ when phage recovered from the target organ are reinjected into a second host for another round of screening. Further enrichment may be exhibited following a third round of screening. Another alternative means to determine selective localization is that phage expressing the putative target peptide preferably exhibit a two-fold, more preferably a three-fold or higher enrichment in the target organ or tissue compared to control phage that express a non-specific peptide or that have not been genetically engineered to express any putative target peptides. Another means to determine selective localization is that localization to the target organ or tissue of phage expressing the target peptide is at least partially blocked by the co-administration of a synthetic peptide containing the target peptide sequence. “Targeting peptide” and “homing peptide” are used synonymously herein.
- A targeting peptide is useful, for example, for targeting a desired peptide to the selected tumor as discussed above. In addition, a targeting peptide in conjunction with a detectable label can be used to identify the delivery of a desired peptide to a sample. As used herein, the term “sample” is used in its broadest sense to mean a cell, tissue, organ or portion thereof, including a tumor, that is isolated from the body. A sample can be, for example, a histologic section or a specimen obtained by biopsy or cells that are placed in or adapted to tissue culture.
- The term “antibody” is well-known in the art and refers to a protein functionally defined as a binding protein and structurally defined as comprising an amino acid sequence that is recognized by one of skill in the art as having variable and constant regions. A typical antibody structural unit is known to comprise a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” and one “heavy” chain. The N-terminal portion of each chain defines the variable region of about 100 to about 110 amino acids, which are primarily responsible for antigen recognition and binding. The terms variable heavy chain (VH) and variable light chain (VL) regions refer to these light and heavy chains, respectively. The variable region includes the segments of Framework 1 (FR1), CDR1, Framework 2 (FR2), CDR2,
Framework 3, CDR3 and Framework 4 (FR4). Antibodies are typically divided into five major classes, IgM, IgG, IgA, IgD, and IgE, based on their constant region structure and immune function. The constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotypes. Heavy chains γ, α and δ have a constant region composed of three tandem (in a line) Ig domains, and a hinge region for added flexibility; heavy chains μ and ε have a constant region composed of four immunoglobulin domains. Antibody classes can also be divided into subclasses, for example, there are four IgG subclasses IgG1, IgG2, IgG3 and IgG4. The structural characteristics that distinguish these subclasses from each other are known to those of skill in the art and can include the size of the hinge region and the number and position of the interchain disulfide bonds between the heavy chains. The constant region also determines the mechanism used to destroy the bound antigen. A light chain has two successive regions: one constant region, which are designated as κ and λ, and one variable region. - As used herein, the term “functional fragment” when used in reference to the antibodies described herein is intended to refer to a portion of the antibody including heavy or light chain polypeptides which still retains some or all or the binding activity of the antibody. Such functional fragments can include, for example, antibody functional fragments such as Fab, F(ab)2 Fv, and single chain Fv (scFv). Other functional fragments can include, for example, heavy or light chain polypeptides, variable region polypeptides or CDR polypeptides or portions thereof so long as such functional fragments retain binding activity, specificity, inhibitory and activation activity. The term is also intended to include polypeptides encompassing, for example, modified forms of naturally occurring amino acids such as D-stereoisomers, non-naturally occurring amino acids, amino acid analogues and mimetics so long as such polypeptides retain functional activity as defined above.
- A moiety can be a detectable label such a radiolabel or can be a cytotoxic agent, including a toxin such as ricin or a drug such as a chemotherapeutic agent or can be a physical, chemical or biological material such as a liposome, microcapsule, micropump or other chambered microdevice, which can be used, for example, as a drug delivery system. Generally, such microdevices, should be nontoxic and, if desired, biodegradable. Various moieties, including microcapsules, which can contain an agent, and methods for linking a moiety, including a chambered microdevice, to a molecule of the invention are well known in the art and commercially available (see, for example, “Remington's Pharmaceutical Sciences” 18th ed. (Mack Publishing Co. 1990), chapters 89-91; Harlow and Lane, Antibodies: A laboratory manual (Cold Spring Harbor Laboratory Press 1988), each of which is incorporated herein by reference; see, also, Hermanson, Bioconjugate Techniques (Academic Press 1996)).
- A “label” refers a compound has at least one element, isotope or chemical compound attached to enable the detection of the compound. In general, labels fall into three classes: a) isotopic labels, which may be radioactive or heavy isotopes; b) immune labels, which may be antibodies or antigens; and c) colored or fluorescent dyes. The labels may be incorporated into a HIPK1 nucleic acids, proteins and antibodies at any position. For example, the label should be capable of producing, either directly or indirectly, a detectable signal. The detectable moiety may be a radioisotope, such as 3H, 14C, 32P, 35S, or 125I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase. Any method known in the art for conjugating the antibody to the label may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem. and Cytochem., 30:407 (1982).
- Peptides, protides and conjugates, which are identified herein, can be synthesized in required quantities using routine methods of solid state peptide synthesis or can be purchased from commercial sources (for example, Anaspec; San Jose Calif.) and a desired moiety can be linked to the peptide. Several methods useful for linking a moiety to a peptide are known in the art, depending on the particular chemical characteristics of the molecule. For example, methods of linking haptens to carrier proteins as used routinely in the field of applied immunology (see, for example, Harlow and Lane, supra, 1988; Hermanson, supra, 1996).
- A moiety such as a therapeutic or diagnostic agent can be conjugated to a peptide using, for example, carbodiimide conjugation (Bauminger and Wilchek, Meth. Enzymol. 70:151-159 (1980), which is incorporated herein by reference). Carbodiimides comprise a group of compounds that have the general formula R—N═C═N—R′, where R and R′ can be aliphatic or aromatic, and are used for synthesis of peptide bonds. The preparative procedure is simple, relatively fast, and is carried out under mild conditions. Carbodiimide compounds attack carboxylic groups to change them into reactive sites for free amino groups. Carbodiimide conjugation has been used to conjugate a variety of compounds to carriers for the production of antibodies.
- The water soluble carbodiimide, 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) is particularly useful for conjugating a moiety to a peptide and was used to conjugate doxorubicin to tumor homing peptides (U.S. Patent Application Publication 2004-0131623). The conjugation of doxorubicin and a tumor homing peptide requires the presence of an amino group, which is provided by doxorubicin, and a carboxyl group, which is provided by the peptide.
- In addition to using carbodiimides for the direct formation of peptide bonds, EDC also can be used to prepare active esters such as N-hydroxysuccinimide (NHS) ester. The NHS ester, which binds only to amino groups, then can be used to induce the formation of an amide bond with the single amino group of a moiety. The use of EDC and NHS in combination is commonly used for conjugation in order to increase yield of conjugate formation (Bauminger and Wilchek, supra, 1980).
- Other methods for conjugating a moiety to a peptide can also be used. For example, sodium periodate oxidation followed by reductive alkylation of appropriate reactants can be used, as can glutaraldehyde crosslinking. However, it is recognized that, regardless of which method of producing a conjugate of the invention is selected, a determination may be needed to confirm that the peptide described herein maintains its antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity and that the moiety maintains its relevant function. Methods for determining the activity of the conjugates are well know to one of skill in the art.
- An agar radial diffusion assay has been used as described herein to determine antimicrobial activities of proteins against microbial pathogens in vitro. One million CFU will be mixed into 10 ml (i.e., 1×105 CFU/ml) of melted 1% agarose (in 10 mM NaHPO4 and cooled to 42° C.) containing minimal nutrient and adjusted to either pH 5.5 or pH 7.2. The agar is solidified in culture dishes, and sample wells are formed. Peptides at various concentrations are dissolved in 10 μl of 0.01% acetic acid buffer (pH 5.5 or 7.2), loaded into individual wells, and incubated at 37° C. for three hours. The plate is then overlayed with 1% agarose containing nutrients and incubated (37° C., for at least 24 hours). Peptides purified by RP-HPLC lacking antimicrobial activity are tested in parallel as controls. Zones of inhibition are measured to quantify antimicrobial activity. This assay will not distinguish between microbicidal and microbiostatic actions, but is highly sensitive to peptides with one or both functions.
- Minimum inhibitory (MIC) and microbiocidal concentration (MMC) assays can also be performed, and may include a microvolume assay which is used to quantitatively screen peptides for antimicrobial activities. In this assay, suspensions of bacteria or fungi in appropriate media are placed in 100-200 μl final volumes in microtiter plates. Poly-L-lysine coated or otherwise positively charged plates are used for these assays, since cationic peptides may bind to anionic surfaces. Purified peptides are then serially diluted, descending from 100 μg/ml. Organisms are inoculated into wells to a concentration of 1×105 CFU/ml, and plates incubated (37° C., for at least 24 hours). Well turbidities are then assessed visually and by spectrophotometry to quantify growth inhibition versus wells containing no peptide. MMCs are then determined by quantitative culture of MIC wells exhibiting no visible growth.
- Microbicidal kinetics of purified peptides are assessed by resuspending the peptides in 0.01% acetic acid buffer (pH 5.5 or 7.2), and organisms are resuspended to a concentration of 1×105 CFU/ml in 50-250 μl of sterile buffer containing peptide concentrations from 0 to 40 μg/ml. Controls contain buffer alone or non-antimicrobial proteins and organism as above. Mixtures are incubated at 37° C. for up to 48 hours, after which aliquots are quantitatively cultured and incubated for 24 to 48 hours. Killing is expressed as decrease in logarithm10 surviving CFU/ml. The limit of sensitivity in microbicidal assays is considered to be a 1 log reduction in viable cells.
- Flow cytometry can also be used to examine kinetics and mechanisms of the action of the peptides on bacterial membrane integrity and energetics. Peptides which differ in activity or specificity for their ability to depolarize and/or permeabilize microbial membranes can also be compared by analysis of membrane depolarization, and permeabilization. DiOC5 is a charged lipophilic dye which partitions into the cytoplasm, and is dependent on intact transmembrane potential (ΔΨ) for intracellular retention. Organisms prepared as above are labeled in darkness for 30 minutes at about 20° C. in PBS containing 0.05 μM DiOC5 Organisms are resuspended to a concentration of 5×108 CFU/ml in K+ MEM containing an individual peptide, and incubated at 37° C. For flow cytometry, organisms are washed, sonicated, counted, and resuspended in K+ MEM buffer. Reductions in mean DiOC5 fluorescence relative to controls are interpreted to represent loss of DiOC5, indicating membrane depolarization. Positive control cells exposed to valinomycin, as well as control cells not exposed to any peptides, are analyzed for DiOC5 fluorescence in parallel.
- Propidium iodide is excluded from cells with normal membrane integrity, but enters cells permealized to molecules ≧2 nm in diameter, and can be stimulated to emit fluorescence at >620 nm. Organisms prepared as above are resuspended to a concentration of 5×108 CFU/ml in K+ MEM containing a selected peptide, and incubated for pre-selected times (ranging from zero up to about 120 minutes) at 37° C. Cells are washed in fresh K+ MEM, sonicated, counted, and resuspended in K+ MEM buffer containing 20 μM propidium iodide. Control cells exposed to ethanol (positive control for permeabilization) are assessed for propidium iodide uptake in parallel. Increases in mean propidium iodide fluorescence relative to control cells are interpreted to indicate increases in permeability.
- Erythrocyte permeabilizing and hemolytic activities of peptides exhibiting potent microbicidal activity are also studied as indicators of potential in vivo toxicity. Four-percent (vol/vol) of washed human erythrocytes (in PBS alone, or in PBS plus 10% heat-inactivated PNHS are incubated with selected peptides ranging in concentration up to 100 times greater than geometric mean MICs. After 24 hours of incubation at 37° C., erythrocyte permeabilization and hemolysis are determined spectrophotometrically. Permeabilization and hemolysis will be compared to buffers alone, and with a triton X-100 control (100% hemolysis).
- Endothelial cell injury due to peptides can also be measured using a standard 51Cr release assay, described in Filler et al., J Infect Dis., 164:928-935 (1991); Filler, et al., Infect Immun. 62:1064-1069 (1994); Filler et al., Infect Immun. 63:976-983 (1995). Briefly, endothelial cells in 96 well tissue culture plates are incubated with
Na 51 CrO4 overnight. The following day, the unincorporated isotope tracer is removed by rinsing, and peptides in 0.01% acetic acid buffer are added to the endothelial cells. Control wells are exposed to buffer alone. After a predetermined incubation period, the medium is aspirated and the amount of 51Cr released into the medium is measured by scintillation. This approach facilitates toxicity screening of multiple peptides simultaneously, and minimizes the amount of peptide necessary for assessment. - Each antimicrobial and toxicity assay described above is performed independently a minimum of two times, and means±standard error is calculated for each peptide under varying exposure conditions (concentration or pH) as compared with control samples. Statistical analyses of microbicidal data are performed using Student t test or Kruskall-Wallis rank sum analysis for non-parametric data, and corrected for multiple comparisons as appropriate.
- The yield of moiety/peptide conjugate formed is determined using routine methods. For example, HPLC or capillary electrophoresis or other qualitative or quantitative method can be used (see, for example, Liu et al., J. Chromatogr. 735:357-366 (1996); Rose et al., J. Chromatogr. 425:419-412 (1988), each of which is incorporated herein by reference). In particular, the skilled artisan will recognize that the choice of a method for determining yield of a conjugation reaction depends, in part, on the physical and chemical characteristics of the specific moiety and peptide. Following conjugation, the reaction products can be desalted to remove any free peptide and free drug.
- Embodiments of the invention provide a method of inducing programmed cell death in a cell, including contacting the cell with an isolated peptide, protide or conjugate described herein. In one aspect, the cell is a microorganism, or in some aspects a pathogenic microorganism. In some aspects, the pathogenic microorganism is Staphylococcus aureus, Escherichia coli, Salmonella typhimurium, Pseudomonas aeruginosa, Bacillus subtilis, Acinotobacter baumannii, Acinotobacter calcoaceticus, Acinotobacter haemolyticus, Pseudomonas aeruginosa, Candida albicans. or any of the pathogenic microorganisms described herein. In another aspect, the cell is a tumor cell, including both a malignant and non-malignant tumor cell, or in a preferred aspect a malignant cell. In yet another aspect, the cell is an immune regulatory cell or an immune effector cell.
- A peptide, protide or conjugate of the invention useful for practicing the methods of the invention can be formulated and administered by those skilled in the art in a manner and in an amount appropriate for the pathological condition to be treated, for example, an infection, neoplastic disorder, inflammation; the rate or amount of inflammation; the weight, gender, age and health of the individual; the biochemical nature, bioactivity, bioavailability and side effects of the particular compound; and in a manner compatible with concurrent treatment regimens. An appropriate amount and formulation for decreasing the severity of a pathological condition in humans can be extrapolated from credible animal models known in the art of the particular disorder. It is understood, that the dosage of a therapeutic substance has to be adjusted based on the binding affinity of the substance, such that a lower dose of a substance exhibiting significantly higher binding affinity can be administered compared to the dosage necessary for a substance with lower binding affinity. For a peptide, protide or conjugate described herein several factors can be taken into account when determining the proper dosage. For example, for a protide, the nature of the protide effectors and their bioactivity upon activation, the anticipated concentration of activator and the responsiveness of the activator site to presence of the activator, may be taken into account.
- The total amount of peptide, protide or conjugate can be administered as a single dose or by infusion over a relatively short period of time, or can be administered in multiple doses administered over a more prolonged period of time. Such considerations will depend on a variety of case-specific factors such as, for example, whether the disease category is characterized by acute episodes or gradual or chronic deterioration. For an individual affected with an acute infection or inflammatory response, for example, as associated with a bacterial infection, the substance can be administered as a single dose or by infusion of several large doses in a relatively short period of time. For an individual affected with chronic deterioration, for example, as associated with a neuroinflammatory disorder, the substance can be administered in a slow-release matrice, which can be implanted for systemic delivery or at the site of the target tissue, which means an area proximal to the desired context. Contemplated matrices useful for controlled release of therapeutic compounds are well known in the art, and include materials such as DepoFoam™, biopolymers, micropumps, and the like.
- The peptides, protides and conjugates administered in the methods of the invention can be administered to the individual by any number of routes known in the art including, for example, systemically, such as intravenously or intraarterially. A therapeutic peptide, protide or conjugate can be provided in the form of isolated and substantially purified polypeptides in pharmaceutically acceptable formulations using formulation methods known to those of ordinary skill in the art. These formulations can be administered by standard routes, including for example, topical, transdermal, intraperitoneal, intracranial, intracerebroventricular, intracerebral, intravaginal, intrauterine, oral, rectal or parenteral such as intravenous, intraspinal, intrathecal, subcutaneous or intramuscular routes. Intrathecal administration of a therapeutic peptide, protide or conjugate into the intradural or subarachnoid space can be an appropriate route for decreasing the severity of a neuroinflammatory condition. Intravenous administration of a therapeutic substance containing a peptide, protide or conjugate also is a preferred route for practicing the invention. In addition, a therapeutic substance administered in the methods of the invention can be incorporated into biodegradable polymers allowing for sustained release of the substance useful for prophylactic and reconstitutive applications described above. Biodegradable polymers and their use are described, for example, in Brem et al., J. Neurosurg. 74:441 446 (1991), which is incorporated herein by reference.
- The methods for treating a particular pathological condition additionally can be practiced in conjunction with other therapies. For example, for treating cancer, the methods of the invention can be practiced prior to, during, or subsequent to conventional cancer treatments such as surgery, chemotherapy, including administration of cytokines and growth factors, radiation or other methods known in the art. Similarly, for treating pathological conditions which include infectious disease, the methods of the invention can be practiced prior to, during, or subsequent to conventional treatments, such as antibiotic administration, against infectious agents or other methods known in the art. Treatment of pathological conditions of autoimmune disorders also can be accomplished by combining the methods of the invention for inducing an immune response with conventional treatments for the particular autoimmune diseases. Conventional treatments include, for example, chemotherapy, steroid therapy, insulin and other growth factor and cytokine therapy, passive immunity and inhibitors of T cell receptor binding. The peptides, protides and conjugates of the invention can be administered in conjunction with these or other methods known in the art and at various times prior, during or subsequent to initiation of conventional treatments. For a description of treatments for pathological conditions characterized by aberrant cell growth see, for example, The Merck Manual, Sixteenth Ed, (Berkow, R., Editor) Rahway, N.J., 1992.
- As described above, administration of a peptide, protide or conjugate can be, for example, simultaneous with or delivered in alternative administrations with the conventional therapy, including multiple administrations. Simultaneous administration can be, for example, together in the same formulation or in different formulations delivered at about the same time or immediately in sequence. Alternating administrations can be, for example, delivering a peptide, protide or conjugate formulation and a conventional therapeutic treatment in temporally separate administrations. Temporally separate administrations of a peptide, protide or conjugate and conventional therapy can use different modes of delivery and routes.
- A therapeutic peptide, protide or conjugate containing substance administered in the methods of the invention also can be administered as a solution or suspension together with a pharmaceutically acceptable medium. Such a pharmaceutically acceptable medium can include, for example, sterile aqueous solvents such as sodium phosphate buffer, phosphate buffered saline, normal saline or Ringer's solution or other physiologically buffered saline, or other solvent or vehicle such as a glycol, glycerol, an oil such as olive oil or an injectable organic ester. A pharmaceutically acceptable medium can additionally contain physiologically acceptable compounds that act, for example, stabilize the neutralizing agent, increase its solubility, or increase its absorption. Such physiologically acceptable compounds include, for example, carbohydrates such as glucose, sucrose or dextrans; antioxidants such as ascorbic acid or glutathione; receptor mediated permeabilizers, which can be used to increase permeability of the blood-brain barrier; chelating agents such as EDTA, which disrupts microbial membranes; divalent metal ions such as calcium or magnesium; low molecular weight proteins; lipids or liposomes; or other stabilizers or excipients. Those skilled in the art understand that the choice of a pharmaceutically acceptable carrier depends on the route of administration of the compound containing the protides and on its particular physical and chemical characteristics.
- Formulations suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions such as the pharmaceutically acceptable mediums described above. The solutions can additionally contain, for example, buffers, bacteriostats and solutes which render the formulation isotonic with the blood of the intended recipient. Other formulations include, for example, aqueous and non-aqueous sterile suspensions which can include suspending agents and thickening agents. The formulations can be presented in unit-dose or multi-dose containers, for example, sealed ampules and vials, and can be stored in a lyophilized condition requiring, for example, the addition of the sterile liquid carrier, immediately prior to use. Extemporaneous injection solutions and suspensions can be prepared from sterile powders, granules and tablets of the kind previously described.
- For applications that require the peptide, protide, or conjugate containing compounds to cross the blood-brain barrier, formulations that increase the lipophilicity of the compound are particularly desirable. For example, the neutralizing agent can be incorporated into liposomes (Gregoriadis, Liposome Technology, Vols. I to III, 2nd ed. (CRC Press, Boca Raton Fla. (1993)). Liposomes, which consist of phospholipids or other lipids, are nontoxic, physiologically acceptable and metabolizable carriers that are relatively simple to make and administer.
- A therapeutic peptide, protide or conjugate containing substance administered in the methods of the invention can also be prepared as nanoparticles. Adsorbing peptide compounds onto the surface of nanoparticles has proven effective in delivering peptide drugs to the brain (see Kreuter et al., Brain Research 674:171 174 (1995)). Exemplary nanoparticles are colloidal polymer particles of poly-butylcyanoacrylate with a therapeutic protide-containing substance to be administered in the methods of the invention adsorbed onto the surface and then coated with polysorbate 80.
- Image-guided ultrasound delivery of a therapeutic peptide, protide or conjugate containing substance administered in the methods of the invention through the blood-brain barrier to selected locations in the brain can be utilized as described in U.S. Pat. No. 5,752,515. Briefly, to deliver a therapeutic substance past the blood-brain barrier a selected location in the brain is targeted and ultrasound used to induce a change detectable by imaging in the central nervous system (CNS) tissues and/or fluids at that location. At least a portion of the brain in the vicinity of the selected location is imaged, for example, via magnetic resonance imaging (MRI), to confirm the location of the change. An therapeutic substance administered in the methods of the invention into the patient's bloodstream can be delivered to the confirmed location by applying ultrasound to effect opening of the blood-brain barrier at that location and, thereby, to induce uptake of the substance.
- In addition, polypeptides called receptor mediated permeabilizers (RMP) can be used to increase the permeability of the blood-brain barrier to molecules such as therapeutic, prophylactic or diagnostic substances as described in U.S. Pat. Nos. 5,268,164; 5,506,206; and 5,686,416. These receptor mediated permeabilizers can be intravenously co-administered to a host with molecules whose desired destination is the cerebrospinal fluid compartment of the brain, for example, in the treatment of a neuroinflammatory condition. The permeabilizer polypeptides or conformational analogues thereof allow therapeutic substances to penetrate the blood-brain barrier and arrive at their target destination which can be selected based on its proximity to the desired activation context. Such polypeptides can be designed as part of strategic invention protides.
- In current treatment regimes for most diseases, more than one compound is often administered to an individual for management of the same or different aspects of the disease. Similarly, in the methods of the invention for treating neoplastic condition, microbial infection, a condition associated with decreased cell death or inflammatory condition, a therapeutic peptide, protide or conjugate containing substance can advantageously be formulated with a second therapeutic compound such as an anti-inflammatory compound, antimicrobial compound, chemotherapeutic compound, immunosuppressive compound or any other compound that manages the same or different aspects of the particular disease. As an example, for treatment of an infectious disease a therapeutic substance can advantageously be formulated with a second therapeutic compound such as an antibiotic. Contemplated methods of treating a pathological condition by administering to a subject a therapeutically effective amount of a peptide, protide or conjugate therefore include administering a therapeutic substance useful in the methods of the invention alone, in combination with, or in sequence with, such other compounds. Alternatively, combination therapies can consist of fusion proteins, where a therapeutic substance useful for treating a particular pathological condition is linked to a heterologous protein, such as an invention protide.
- It is understood that modifications which do not substantially affect the activity of the various embodiments of this invention are also provided within the definition of the invention provided herein. Accordingly, the following examples are intended to illustrate but not limit the present invention.
- Candidate proteins representing a variety of nuclear- or mitochondrial-encoded programmed cell death effector and/or modulatory molecules from eukaryotic sources were identified for comparison. When candidate proteins were compared, similarities in sequences and helical domains that have amphipathic and cationic characteristics were identified. Analogues were also identified where possible from prokaryotic sources.
- Template proteins were initially chosen based on the following: 1) mammalian or other eukaryotic cell nuclear-encoded peptides with structure-activity relationships to antimicrobial peptide sequences that afford interaction/control/inhibition of mitochondria or chloroplast symbionts, or host cell apoptosis (examples include Bax, Bcl-W, dynamin, mitofusin, nucleolin, and other programmed cell death effector proteins); and 2) structural and/or functional homologues of such proteins in prokaryotes (examples include CidA/B, LrgA/B, and other holin-like or programmed cell death effector proteins). The identification of candidate peptide sequences was achieved through an iterative process, which included a search of protein databases for additional candidate proteins, multiseqeunce alignments of the identified candidates, followed by an integration and analysis of candidate sequences.
- Upon identification of an initial group of template proteins having the above-identified characteristics, additional candidate proteins were identified using primary sequence similarity searches of protein databases using the basic local alignment search tool (BLAST) available from the National Center for Biotechnology Information. The searches utilized the amino acid sequences of candidate template proteins having the desired characteristics as query sequences.
FIG. 3 shows exemplary amino acid sequence used as the query sequences. - Once all additional candidate template proteins were identified, a compiled set of query sequences were submitted for analysis to the modeling server ClustalW (Larkin et al., Bioinformatics 23(21): 2947-2948 (2007)) available online from EMBL-EBI. Utilizing the modeling server, multisequence alignments were performed to identify regions of sequence homology within the candidate sequences or with known host defense or antimicrobial peptide sequences. For example, candidate proteins were ranked based on their alignment score (
FIG. 4 ) and/or analyzed for conserved residues through multisequence alignments (FIG. 5 ). Additionally, phylogenetic and cladogenetic analyses were conducted between the candidate proteins, followed by multiseqeunce alignments of identified putative helical domains (FIGS. 6-14 ). - The results from the above processes were integrated to analyze and prioritize candidate sequences. The criteria for their prioritization included: 1) conservation of sequence homology or motif(s); 2) homology to known antimicrobial or anti-cancer peptides; 3) similarity to known or recognized antimicrobial peptide structure-activity relationships (SAR; including presence, periodicity, and distribution of cationic, hydrophobic, and aromatic residues); and 4) visual inspection. Candidate sequences that were identified included mitochondria-targeting proteins, such as Bcl-2, Bcl-W, Bax, and Mitofusin; NK/Tcyto cell effectors, such as Granulysin, Granzyme H, Perforin-1 and Azurocidin (CAP37); apoptosis/cell signaling proteins, such as Fas ligand,
Caspase 7 andDynamin 1; and other related proteins, such as Serpin B9 (CytoPro3), Fractalkine (CX3CL1), CXCL3 andAtrophin 1. - Following the above interactive primary structure analysis, a secondary (2°) structure analysis was conducted. This analysis included visualization, qualitative, and/or quantitative analyses of candidate sequences identified above. This analysis, including 3D visualization of target sequences, conformation 3D homology, qualitative 3D analysis of target sequences, quantitative 3D analysis of target sequences and comparative 3D refinement of target sequences.
- 3D visualization of target sequences was achieved using Cn3D software available through PubMed. Exemplary 3D visualization of identified candidate peptides within the native total protein are shown in
FIG. 15-21 . These results identified specific sequences as novel targets for further analysis/design. The conformational 3D homology of target sequences to known antimicrobial or anti-cancer template polypeptides was assessed using the threading and 3D homology fold recognition server Protein Homology/analogy Recognition Engine (PHYRE) “Protein structure prediction on the web: a case study using the Phyre server” (Kelley and Sternberg Nature Protocols 4:363-371 (2009). Statistical e values were used to guide prioritization of molecules for further analysis. - Priority target sequences identified above were visualized for qualitative analysis of distribution of 3D physicochemical attributes using the public domain UCSF software package Chimera. Next, priority target sequences were quantitatively evaluated for structural homology and/or structure-activity relationships to known antimicrobial and/or anti-cancer peptides/proteins using a combinatorial extension method of Shindyalov and Bourne, Protein Engineering 11:739-747 (1998). The results from these analyses provided quantitative alignment of compositional elements, including charged and hydrophobic residues (
FIGS. 22-29 ). The results included root mean square deviation (RMSD) scores as quantitative data that allowed further prioritization of target sequences. The priority target sequences emanating from the process described above were then used as novel templates for 3D analyses using VAST and/or 3Dpssm software to identify homologous sequences and discover other novel target sequences. - As a final step, a computation simulation of the antimicrobial activity of the selected sequences was conducted. Selected target sequences emerging from the above process were subjected to a computational assessment tool which integrates multiple physical and biochemical attributes of polypeptide sequences to generate a predicted minimal inhibitory concentration (MIC) based on the inverse of the target sequence calculated hydrophobic moment (1/MH; see U.S. Pat. No. 6,743,769).
- Based on the above process, specific peptide sequences were identified, which have the desired primary and secondary structure within the candidate proteins (Tables 1-20). These identified peptides are predicted to have antimicrobial and anti-cancer activity. Exemplifying predictive accuracy, candidate peptides have been synthesized and antimicrobial efficacy has been demonstrated in vitro against a panel of Gram-positive and Gram-negative bacteria and fungi (see Example II). Furthermore, specific amino acid substitutions were identified for several peptide sequences (Tables 1-19). The identified peptide residues were prioritized/ranked utilizing to above process (Table 21).
-
TABLE 1 Engineered peptides based on Bax protein (pro-apoptotic protein/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 1. 104 nfnwgrvvalfyfasklvlkalctkv 1292. 168twqtvtifvagvltasltiwkk190 Synthetic Peptides 1. H2N-nfnwgrvvalfyfasklvlkalctkv- COOH 1. H2N-nfnwgrvvalfyfasklvlkalctkv- CONH 23. H2N-nfnwgrvvalfyfasklvlkalxtkv- COOH 3. H2N-nfnwgrvvalfyfasklvlkalxtkv- CONH 24. H2N-nfnwgrvvalfyfasklvlkalbtjv- COOH 4. H2N-nfnwgrvvalfyfasklvlkalbtjv- CONH 25. H2N-wgrvvalfyfasklvlkalctkv- COOH 5. H2N-wgrvvalfyfasklvlkalctkv- CONH 26. H2N-wgrvvalfyfasklvlkalxtkv- COOH 6. H2N-wgrvvalfyfasklvlkalxtkv- CONH 27. H2N-rvvalfyfasklvlkalctkv- COOH 7. H2N-rvvalfyfasklvlkalctkv- CONH 28. H2N-rvvalfyfasklvlkalxtkv- COOH 8. H2N-rvvalfyfasklvlkalxtkv- CONH 29. H2N-alfyfasklvlkalctkv- COOH 9. H2N-alfyfasklvlkalctkv- CONH 210. H2N-alfyfasklvlkalxtkv- COOH 10. H2N-alfyfasklvlkalxtkv- CONH 22. H2N-twqtvtifvagvltasltiwkk- COOH 2. H2N-twqtvtifvagvltasltiwkk- CONH 211. H2N-twqtvtifvabvltasltiwkk- COOH 11. H2N-twqtvtifvabvltasltiwkk- CONH 212. H2N-tvtifvagvltasltiwkk- COOH 12. H2N-tvtifvagvltasltiwkk-CONH2 13. H2N-tvtifvabvltasltiwkk-COOH 13. H2N-tvtifvabvltasltiwkk-CONH2 Underlined residues indicate substitutions; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue; b = k, r, n, q, other natural/non-natural basic residue; j = cysteine or other natural/non-natural thiol residue. -
TABLE 2 Engineered peptides based on Bcl-W protein (pro-apoptotic protein/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 14. 10tralvadfvgyklrqkgyv28 15. 55 trfrrtfsdlaaqlhvt 7116. 159arrlregnwasvrtvltgavalgalvtvgaffask193 Synthetic Peptides 14. H2N-tralvadfvgyklrqkgyv- COOH 14. H2N-tralvadfvgyklrqkgyv- CONH 217. H2N-tralvabfvgyklrqkgyv- COOH 17. H2N-tralvabfvgyklrqkgyv-CONH2 15. H2N-trfrrtfsdlaaqlhvt-COOH 15. H2N-trfrrtfsdlaaqlhvt-CONH2 18. H2N-trfrbtfsdlaaqlhvt-COOH 18. H2N-trfrbtfsdlaaqlhvt-CONH2 19. H2N-trfrrtfsblaaqlhvt-COOH 19. H2N-trfrrtfsblaaqlhvt- CONH 220. H2N-rrlregnwasvrtvltgavalgalvtvgaffask- COOH 20. H2N-rrlregnwasvrtvltgavalgalvtvgaffask-CONH2 21. H2N-rrlrbgnwasvrtvltgavalgalvtvgaffask-COOH 21. H2N-rrlrbgnwasvrtvltgavalgalvtvgaffask- CONH 222. H2N-rrlregnwasvrtvltbavalgalvtvgaffask- COOH 22. H2N-rrlregnwasvrtvltbavalgalvtvgaffask-CONH2 23. H2N-rrlregnwasvrtvltgavalbalvtvgaffask-COOH 23. H2N-rrlregnwasvrtvltgavalbalvtvgaffask- CONH 224. H2N-rrlregnwasvrtvltgavalgalvtvbaffask- COOH 24. H2N-rrlregnwasvrtvltgavalgalvtvbaffask-CONH2 25. H2N-rrlrbgnwasvrtvltbavalbalvtvbaffask-COOH 25. H2N-rrlrbgnwasvrtvltbavalbalvtvbaffask-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue. -
TABLE 3 Engineered peptides based on Bcl-xβ protein (apoptotic protein/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 26. 12flsyklsqkgyswsqfs28 27. 99lryrrafsdltsqlhitpgtayqsf122 28. 187 gwvrtkplvcpfslasgqrs 19629. 203gqrsptalllylfllcwvivg223 Synthetic Peptides 26. H2N-flsyklsqkgyswsqfs-COOH 26. H2N-flsyklsqkgyswsqfs-CONH2 27. H2N-lryrrafsdltsqlhitpgtayqsf-COOH 27. H2N-lryrrafsdltsqlhitpgtayqsf-CONH2 30. H2N-lryrrafsbltsqlhitpgtayqsf-COOH 30. H2N-lryrrafsbltsqlhitpgtayqsf-CONH2 28. H2N-gwvrtkplvcpfslasgqrs-COOH 28. H2N-gwvrtkplvcpfslasgqrs-CONH2 31. H2N-gwvrtkplvxpfslasgqrs-COOH 31. H2N-gwvrtkplvxpfslasgqrs-CONH2 32. H2N-gwvrtkplvxpfslasbqrs-COOH 32. H2N-gwvrtkplvxpfslasbqrs- CONH 229. H2N-gqrsptalllylfllcwvivg- COOH 29. H2N-gqrsptalllylfllcwvivg-CONH2 33. H2N-gqrsptalxlylfllcwvivg-COOH 33. H2N-gqrsptalxlylfllcwvivg-CONH2 34. H2N-gqrsptalllylfllxwvivg-COOH 34. H2N-gqrsptalllylfllxwvivg- CONH 235. H2N-gqrsptalllylfllcwvivb- COOH 35. H2N-gqrsptalllylfllcwvivb-CONH2 36. H2N-gqrsptalxlylfllxwvivb-COOH 36. H2N-gqrsptalxlylfllxwvivb-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 4 Engineered peptides based on Bak protein (apoptotic protein/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 37. 127rvvallgfgyrlalhvyq144 38. 187ilnvlvvlgvvllgqfvvrrffks211 Synthetic Peptides 37. H2N-rvvallgfgyrlalhvyq-COOH 37. H2N-rvvallgfgyrlalhvyq-CONH2 39. H2N-rvvallbfgyrlalhvyq-COOH 39 H2N-rvvallbfgyrlalhvyq-CONH2 40. H2N-rvvallgfbyrlalhvyq-COOH 40. H2N-rvvallgfbyrlalhvyq-CONH2 41. H2N-rvvallbfbyrlalhvyq-COOH 41. H2N-rvvallbfbyrlalhvyq-CONH2 42. H2N-rvvalygfgyrlalhvyq-COOH 42. H2N-rvvalygfgyrlalhvyq- CONH 243. H2N-rvvalwgfgyrlalhvyq- COOH 43. H2N-rvvalwgfgyrlalhvyq-CONH2 44. H2N-rvvalybfbyrlalhvyq-COOH 44. H2N-rvvalybfbyrlalhvyq-CONH2 45. H2N-rvvalwbfbyrlalhvyq-COOH 45. H2N-rvvalwbfbyrlalhvyq-CONH2 38. H2N-ilnvlvvlgvvllgqfvvrrffks-COOH 38. H2N-ilnvlvvlgvvllgqfvvrrffks-CONH2 46. H2N-ilnvlvxlgvvllgqfvvrrffks-COOH 46. H2N-ilnvlvxlgvvllgqfvvrrffks-CONH2 47. H2N-ilnvlvblvlgqfvrfks-COOH 47. H2N-ilnvlvblvlgqfvrfks-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 5 Engineered peptides based on Bcl-2 protein (apoptotic regulator/human). SEQ ID NO: Amino Acid Sequence Native Sequence Domain 48. 11nreivmkyihyklsqrgy28 Synthetic Peptides 48. H2N-nreivmkyihyklsqrgy-COOH 48. H2N-nreivmkyihyklsqrgy-CONH2 49. H2N-nrbivmkyihyklsqrgy-COOH 49. H2N-nrbivmkyihyklsqrgy-CONH2 50. H2N-nreivxkyihyklsqrgy-COOH 50. H2N-nreivxkyihyklsqrgy- CONH 251. H2N-nreivmkyibyklsqrgy- COOH 51. H2N-nreivmkyibyklsqrgy-CONH2 52. H2N-nrbivxkyibyklsqrgy-COOH 52. H2N-nrbivxkyibyklsqrgy-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor residue. -
TABLE 6 Engineered peptides based on Bcl-2 isoform 1protein (apoptotic regulator/human). SEQ ID NO: Amino Acid Sequence Native Sequence Domain 53. 54lalrqagddfsrryrg69 Synthetic Peptides 53. H2N-lalrqagddfsrryrg-COOH 53. H2N-lalrqagddfsrryrg-CONH2 54. H2N-lalrqagbdfsrryrg-COOH 54. H2N-lalrqagbdfsrryrg- CONH 255. H2N-lalrqagdbfsrryrg- COOH 55. H2N-lalrqagdbfsrryrg- CONH 256. H2N-lalrqagbxfsrryrg- COOH 56. H2N-lalrqagbxfsrryrg-CONH2 57. H2N-lalrqaobxfsrryrg-COOH 57. H2N-lalrqaobxfsrryrg-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue; o = anthrylalanine or other non-natural amino acid. -
TABLE 7 Engineered peptides based on Mfn-1 protein (mitofusin-1; human mitochondrial regulator). SEQ ID NO: Amino Acid Sequence Native Sequence Domain 58. 699keidqlekiqnnskllrnkavqlenelenftkqfl734 Synthetic Peptides 58. H2N-keidqlekiqnnskllrnkavqlenelenftkqfl-COOH 58. H2N-keidqlekiqnnskllrnkavqlenelenftkqfl-CONH2 59. H2N-keibqlekiqnnskllrnkavqlenelenftkqfl-COOH 59 H2N-keibqlekiqnnskllrnkavqlenelenftkqfl-CONH2 60. H2N-keibqlbkiqnnskllrnkavqlbnelenftkqfl-COOH 60. H2N-keibqlbkiqnnskllrnkavqlbnelenftkqfl- CONH 261. H2N-keibqlbkiqnnskllrnkavqlbnelenftkqfl- COOH 61. H2N-keibqlbkiqnnskllrnkavqlbnelenftkqfl-CONH2 62. H2N-keibqlbkiqnnskllrnkavqlbnblenftkqfl-COOH 62. H2N-keibqlbkiqnnskllrnkavqlbnblenftkqfl-CONH2 63. H2N-keibqlbkiqnnskllrnkavqlbnblbnftkqfl-COOH 63. H2N-keibqlbkiqnnskllrnkavqlbnblbnftkqfl-CONH2 64. H2N-kiqnnskllrnkavql-COOH 64. H2N-kiqnnskllrnkavql-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue. -
TABLE 8 Engineered peptides based on Mfn-2 protein (mitofusin-1; human mitochondrial regulator). SEQ ID NO: Amino Acid Sequence Native Sequence Domain 65. 718nkkievldslqskakllrnkagwldselnmfthqylqpsr757 Synthetic Peptides 65. H2N-nkkievldslqskakllrnkagwldselnmfthqylqpsr-COOH 65. H2N-nkkievldslqskakllrnkagwldselnmfthqylqpsr-CONH2 66. H2N-nkkibvldslqskakllrnkagwldselnmfthqylqpsr-COOH 66. H2N-nkkibvldslqskakllrnkagwldselnmfthqylqpsr-CONH2 67. H2N-nkkievlbslqskakllrnkagwldselnmfthqylqpsr-COOH 67. H2N-nkkievlbslqskakllrnkagwldselnmfthqylqpsr-CONH2 68. H2N-nkkievldslqskakllrnkagwlbselnmfthqylqpsr-COOH 68. H2N-nkkievldslqskakllrnkagwlbselnmfthqylqpsr-CONH2 69. H2N-nkkievldslqskakllrnkagwldsblnmfthqylqpsr-COOH 69. H2N-nkkievldslqskakllrnkagwldsblnmfthqylqpsr-CONH2 70. H2N-nkkievldslqskakllrnkagwldselnxfthqylqpsr-COOH 70. H2N-nkkievldslqskakllrnkagwldselnxfthqylqpsr-CONH2 71. H2N-nkkibvlbslqskakllrnkagwlbsblnxfthqylqpsr-COOH 71. H2N-nkkibvlbslqskakllrnkagwlbsblnxfthqylqpsr- CONH 272. H2N-kkievldslqskakllrnkagwl- COOH 72. H2N-kkievldslqskakllrnkagwl-CONH2 73. H2N-kkibvldslqskakllrnkagwl-COOH 73. H2N-kkibvldslqskakllrnkagwl-CONH2 74. H2N-kkievlbslqskakllrnkagwl-COOH 74. H2N-kkievlbslqskakllrnkagwl-CONH2 75. H2N-kkibvlbslqskakllrnkagwl-COOH 75. H2N-kkibvlbslqskakllrnkagwl-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 9 Engineered peptides based on Dnm-1 protein (dynamin-1; human mitochondrial regulator). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 76. 223kllplrrgyigvvnrsqk240 77. 256rkfflshpsyrhla269 78. 294 glrnklqsqllsiek 30979. 323arktkallqmvqqfavdf340 80. 411atvkkqvqklk501 81. 519virkgwltinnigimkggsk539 82. 569nlklrdvekgfmsskhifalfnteqrnvyk598 83. 617kasflragvypervgdk633 Synthetic Peptides 76. H2N-kllplrrgyigvvnrsqk-COOH 76. H2N-kllplrrgyigvvnrsqk-CONH2 77. H2N-rkfflshpsyrhla-COOH 77. H2N-rkfflshpsyrhla-CONH2 78. H2N-glrnklqsqllsiek-COOH 78. H2N-glrnklqsqllsiek-CONH2 84. H2N-glrnklqsqllsibk-COOH 84. H2N-glrnklqsqllsibk- CONH 279. H2N-arktkallqmvqqfavdf- COOH 79. H2N-arktkallqmvqqfavdf-CONH2 85. H2N-arktkallqmvqqfavbf-COOH 85. H2N-arktkallqmvqqfavbf-CONH2 80. H2N-atvkkqvqklk-COOH 80. H2N-atvkkqvqklk-CONH2 81. H2N-virkgwltinnigimkggsk-COOH 81. H2N-virkgwltinnigimkggsk-CONH2 82. H2N-nlklrdvekgfmsskhifalfnteqrnvyk-COOH 82. H2N-nlklrdvekgfmsskhifalfnteqrnvyk-CONH2 86. H2N-nlklrbvekgfmsskhifalfnteqrnvyk-COOH 86. H2N-nlklrbvekgfmsskhifalfnteqrnvyk-CONH2 87. H2N-nlklrdvbkgfmsskhifalfnteqrnvyk-COOH 87. H2N-nlklrdvbkgfmsskhifalfnteqrnvyk-CONH2 88. H2N-nlklrdvekgfmsskhifalfntbqrnvyk-COOH 88. H2N-nlklrdvekgfmsskhifalfntbqrnvyk-CONH2 89. H2N-nlklrbvbkgfmsskhifalfnteqrnvyk-COOH 89. H2N-nlklrbvbkgfmsskhifalfnteqrnvyk- CONH 290. H2N-nlklrbvbkgfmsskhifalfntbqrnvyk- COOH 90. H2N-nlklrbvbkgfmsskhifalfntbqrnvyk-CONH2 83. H2N-kasflragvypervgdk-COOH 83. H2N-kasflragvypervgdk-CONH2 91. H2N-kasflragvypbrvgdk-COOH 91. H2N-kasflragvypbrvgdk-CONH2 92. H2N-kasflragvypervgbk-COOH 92. H2N-kasflragvypervgbk-CONH2 93. H2N-kasflragvypbrvgbk-COOH 93. H2N-kasflragvypbrvgbk-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue. -
TABLE 10 Engineered peptides based on Dnm-2 protein (dynamin-2; human mitochondrial regulator). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 94. 187klakevdpqglrtigvitkl206 95. 295alrsklqsqllslek309 96. 323trktkallqmvqqfgv338 97. 420aivkkqvvklk421 98. 499 aqqrstqlnkkraipnqg 51699. 559kekkymlpldnlkirdvekgfmsnkhvfaifnteqrnvyk598 100. 569nlkirdvekgfmsnkhvfaifnteqrnvyk598 101. 615swkasflragvypekdqa632 Synthetic Peptides 94. H2N-klakevdpqglrtigvitkl- COOH 94. H2N-klakevdpqglrtigvitkl-CONH2 102. H2N-klakbvdpqglrtigvitkl-COOH 102. H2N-klakbvdpqglrtigvitkl-CONH2 103. H2N-klakevbpqglrtigvitkl-COOH 103. H2N-klakevbpqglrtigvitkl- CONH 2104. H2N-klakbvbpqglrtigvitkl- COOH 104. H2N-klakbvbpqglrtigvitkl-CONH2 95. H2N-alrsklqsqllslek-COOH 95. H2N-alrsklqsqllslek-CONH2 105. H2N-alrsklqsqllslbk-COOH 105 H2N-alrsklqsqllslbk-CONH2 96. H2N-trktkallqmvqqfgv-COOH 96. H2N-trktkallqmvqqfgv-CONH2 97. H2N-aivkkqvvklk-COOH 97. H2N-aivkkqvvklk-CONH2 106. H2N-oivkkqvvklk-COOH 106. H2N-oivkkqvvklk-CONH2 98. H2N-aqqrstqlnkkraipnqg-COOH 98. H2N-aqqrstqlnkkraipnqg- CONH 299. H2N-kekkymlpldnlkirdvekgfmsnkhvfaifnteqrnvyk- COOH 99. H2N-kekkymlpldnlkirdvekgfmsnkhvfaifnteqrnvyk-CONH2 107. H2N-kekkymlpldnlkir-COOH 107. H2N-kekkymlpldnlkir-CONH2 108. H2N-kxkkymlpldnlkir-COOH 108. H2N-kxkkymlpldnlkir-CONH2 109. H2N-kekkyxlpldnlkir-COOH 109. H2N-kekkyxlpldnlkir-CONH2 110. H2N-kekkymlplbnlkir-COOH 110. H2N-kekkymlplbnlkir-CONH2 111. H2N-kekkymlplxnlkir-COOH 111. H2N-kekkymlplxnlkir-CONH2 112. H2N-kxkkymlplbnlkir-COOH 112. H2N-kxkkymlplbnlkir-CONH2 113. H2N-kxkkyxlplbnlkir-COOH 113. H2N-kxkkyxlplbnlkir-CONH2 114. H2N-kgfmsnkhvfaifnteqrnvyk-COOH 114. H2N-kgfmsnkhvfaifnteqrnvyk-CONH2 115. H2N-kxkkymlpldnlkirdvekgfmsnkhvfaifnteqrnvyk-COOH 115. H2N-kxkkymlpldnlkirdvekgfmsnkhvfaifnteqrnvyk-CONH2 116. H2N-kekkyxlpldnlkirdvekgfmsnkhvfaifnteqrnvyk-COOH 116. H2N-kekkyxlpldnlkirdvekgfmsnkhvfaifnteqrnvyk-CONH2 117. H2N-kekkymlpldnlkirdvekgfxsnkhvfaifnteqrnvyk-COOH 117. H2N-kekkymlpldnlkirdvekgfxsnkhvfaifnteqrnvyk-CONH2 100. H2N-nlkirdvekgfmsnkhvfaifnteqrnvyk-COOH 100. H2N-nlkirdvekgfmsnkhvfaifnteqrnvyk- CONH 2118. H2N-nlkirbvekgfmsnkhvfaifnteqrnvyk- COOH 118. H2N-nlkirbvekgfmsnkhvfaifnteqrnvyk-CONH2 119. H2N-nlkirdvbkgfmsnkhvfaifnteqrnvyk-COOH 119. H2N-nlkirdvbkgfmsnkhvfaifnteqrnvyk-CONH2 120. H2N-nlkirbvbkgfmsnkhvfaifntbqrnvyk-COOH 120. H2N-nlkirbvbkgfmsnkhvfaifntbqrnvyk-CONH2 101. H2N-swkasflragvypekdqa-COOH 101. H2N-swkasflragvypekdqa- CONH 2121. H2N-swkasflragvypbkdqa- COOH 121. H2N-swkasflragvypbkdqa-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; o = anthrylalanine or other non-natural amino acid; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 11 Engineered peptides based on Ncl protein (nucleolin; human mitochondrial regulator). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 122. 50qkkgkkaaatsakkvvvs67 123. 69tkkvavatpakkaavt84 124. 124kkgaaipakgakngknakk142 125. 216akgkkaakvvpvkaknva233 126. 273vkeapgkrkkemakqkaa290 127. 362kaleltglkvfgneiklek380 128. 382 kgkdskkerdartllaknlpykvtq 406129. 419irlvskdgkskgiayi434 130. 467kgqnqdyrggknstwsgesktlvlsnlsysat498 131. 508katfikvpqnqngkskgyafi528 Synthetic Peptides 122. H2N-qkkgkkaaatsakkvvvs-COOH 122. H2N-qkkgkkaaatsakkvvvs- CONH 2132. H2N-qkkgkkaxatsakkvyvs- COOH 132. H2N-qkkgkkaxatsakkvyvs- CONH 2133. H2N-qkkgkkaaatsakkvyvs- COOH 133. H2N-qkkgkkaaatsakkvyvs-CONH2 134. H2N-qkkgkkaaatsakkvwvs-COOH 134. H2N-qkkgkkaaatsakkvwvs-CONH2 135. H2N-qkkgkkaxatsakkvyvs-COOH 135. H2N-qkkgkkaxatsakkvyvs-CONH2 136. H2N-qkkgkkaxatsakkvwvs-COOH 136. H2N-qkkgkkaxatsakkvwvs-CONH2 123. H2N-tkkvavatpakkaavt-COOH 123. H2N-tkkvavatpakkaavt-CONH2 124. H2N-kkgaaipakgakngknakk-COOH 124. H2N-kkgaaipakgakngknakk-CONH2 137. H2N-kkgaxipakgakngknakk-COOH 137. H2N-kkgaxipakgakngknakk-CONH2 125. H2N-akgkkaakvvpvkaknva-COOH 125. H2N-akgkkaakvvpvkaknva-CONH2 138. H2N-akgkkaakvvxvkaknva-COOH 138. H2N-akgkkaakvvxvkaknva-CONH2 126. H2N-vkeapgkrkkemakqkaa-COOH 126. H2N-vkeapgkrkkemakqkaa-CONH2 139. H2N-vkbapgkrkkemakqkaa-COOH 139 H2N-vkbapgkrkkemakqkaa-CONH2 140. H2N-vkeapgkrkkbmakqkaa-COOH 140. H2N-vkeapgkrkkbmakqkaa- CONH 2141. H2N-vkeapgkrkkexakqkaa- COOH 141. H2N-vkeapgkrkkexakqkaa-CONH2 142. H2N-vkbapgkrkkbxakqkaa-COOH 142. H2N-vkbapgkrkkbxakqkaa-CONH2 127. H2N-kaleltglkvfgneiklek-COOH 127. H2N-kaleltglkvfgneiklek-CONH2 143. H2N-kalbltglkvfgneiklek-COOH 143. H2N-kalbltglkvfgneiklek-CONH2 144. H2N-kaleltglkvfgnbiklek-COOH 144. H2N-kaleltglkvfgnbiklek-CONH2 145. H2N-kaleltglkvfgneiklbk-COOH 145. H2N-kaleltglkvfgneiklbk-CONH2 146. H2N-kalbltglkvfgnbiklbk-COOH 146. H2N-kalbltglkvfgnbiklbk-CONH2 128. H2N-kgkdskkerdartllaknlpykvtq-COOH 128. H2N-kgkdskkerdartllaknlpykvtq- CONH 2147. H2N-kgkxskkerdartllaknlpykvtq- COOH 147. H2N-kgkxskkerdartllaknlpykvtq-CONH2 148. H2N-kgkdskkxrdartllaknlpykvtq-COOH 148. H2N-kgkdskkxrdartllaknlpykvtq-CONH2 149. H2N-kgkdskkerbartllaknlpykvtq-COOH 149. H2N-kgkdskkerbartllaknlpykvtq- CONH 2150. H2N-kgkxskkbrbartllaknlpykvtq- COOH 150. H2N-kgkxskkbrbartllaknlpykvtq- CONH 2129. H2N-irlvskdgkskgiayi- COOH 129. H2N-irlvskdgkskgiayi-CONH2 151. H2N-irlvskfgkskgiayi-COOH 151. H2N-irlvskfgkskgiayi-CONH2 152. H2N-irlvskygkskgiayi-COOH 152. H2N-irlvskygkskgiayi-CONH2 153. H2N-irlvskwgkskgiayi-COOH 153 H2N-irlvskwgkskgiayi- CONH 2154. H2N-irlvsklwgkskgiayi-COOH 154 H2N-irlvsklwgkskgiayi-CONH2 155. H2N-irlvskdgkskg-COOH 155. H2N-irlvskdgkskg-CONH2 156. H2N-irlvskfgkskgi-COOH 156. H2N-irlvskfgkskg- CONH 2157. H2N-irlvskygkskg- COOH 157. H2N-irlvskygkskg-CONH2 158. H2N-irlvskwgkskg-COOH 158. H2N-irlvskwgkskg-CONH2 159. H2N-irlvsklwgkskg-COOH 159. H2N-irlvsklwgkskgi-CONH2 130. H2N-kgqnqdyrggknstwsgesktlvlsnlsysat-COOH 130. H2N-kgqnqdyrggknstwsgesktlvlsnlsysat-CONH2 160. H2N-kgqnqbyrggknstwsgesktlvlsnlsysat-COOH 160. H2N-kgqnqbyrggknstwsgesktlvlsnlsysat-CONH2 161. H2N-kgqnqdyrggknstwsgbsktlvlsnlsysat-COOH 161. H2N-kgqnqdyrggknstwsgbsktlvlsnlsysat-CONH2 162. H2N-kgqnqbyrggknstwsgbsktlvlsnlsysat-COOH 162 H2N-kgqnqbyrggknstwsgbsktlvlsnlsysat-CONH2 163. H2N-kgbnqdyrlgknstwsgbsktlvlsnlsysat-COOH 163. H2N-kgbnqdyrlgknstwsgbsktlvlsnlsysat-CONH2 164. H2N-kgbnqdyrlgknstwsgbskt-COOH 164. H2N-kgbnqdyrlgknstwsgbskt-CONH2 131. H2N-katfikvpqnqngkskgyafi-COOH 131. H2N-katfikvpqnqngkskgyafi-CONH2 165. H2N-katfikvpqnqnxkskgyafi-COOH 165. H2N-katfikvpqnqnxkskgyafi-CONH2 166. H2N-katfikvpqnqnlkskgyafi-COOH 166. H2N-katfikvpqnqnlkskgyafi-CONH2 167. H2N-katfikvpqnqnykskgyafi-COOH 167. H2N-katfikvpqnqnykskgyafi- CONH 2168. H2N-katfikvpqnqnfkskgyafi- COOH 168. H2N-katfikvpqnqnfkskgyafi- CONH 2169. H2N-katfikvpqnqnwkskgyafi- COOH 169. H2N-katfikvpqnqnwkskgyafi-CONH2 170. H2N-katfikvpqnqngkskgy-COOH 170. H2N-katfikvpqnqngkskgy-CONH2 171. H2N-katfikvpqnqnxkskgy-COOH 171. H2N-katfikvpqnqnxkskgy-CONH2 172. H2N-katfikvpqnqnlkskgy-COOH 172. H2N-katfikvpqnqnlkskgy- CONH 2173. H2N-katfikvpqnqnykskgy- COOH 173. H2N-katfikvpqnqnykskgy-CONH2 174. H2N-katfikvpqnqnfkskgy-COOH 174. H2N-katfikvpqnqnfkskgy- CONH 2175. H2N-katfikvpqnqnwkskgy- COOH 175. H2N-katfikvpqnqnwkskgy-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 12 Engineered peptides based on Csp3 protein ( caspase 3; apoptosis effector/nuclearencoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 176. 10sksiknlepkiihgs24 177. 136lkkitnffrgdrcrsltgkpklfiiqacrgt166 178. 215fiqslcamlkqyadklefmhiltrvnrkvat245 Synthetic Peptides 176. H2N-sksiknlepkiihgs-COOH 176. H2N-sksiknlepkiihgs-CONH2 179. H2N-sksiknlbpkiihgs-COOH 179. H2N-sksiknlbpkiihgs- CONH 2180. H2N-sksiknlepkiiygs- COOH 180. H2N-sksiknlepkiiygs- CONH 2181. H2N-sksiknlepkiiybs- COOH 181. H2N-sksiknlepkiiybs-CONH2 182. H2N-sksiknlbpkiiybs-COOH 182. H2N-sksiknlbpkiiybs-CONH2 177. H2N-lkkitnffrgdrcrsltgkpklfiiqacrgt-COOH 177. H2N-lkkitnffrgdrcrsltgkpklfiiqacrgt-CONH2 183. H2N-lkkitnffrgbrcrsltgkpklfiiqacrgt-COOH 183. H2N-lkkitnffrgbrcrsltgkpklfiiqacrgt- CONH 2184. H2N-lkkitnffrgdrxrsltgkpklfiiqacrgt- COOH 184. H2N-lkkitnffrgdrxrsltgkpklfiiqacrgt- CONH 2185. H2N-lkkitnffrgdrcrsltgkpklfiiqaxrgt- COOH 185. H2N-lkkitnffrgdrcrsltgkpklfiiqaxrgt-CONH2 186. H2N-lkkitnfrgbrxrsltgkpklfiiqaxrgt-COOH 186. H2N-lkkitnfrgbrxrsltgkpklfiiqaxrgt-CONH2 187. H2N-lkkitnfrgbrxrsltgk-COOH 187. H2N-lkkitnfrgbrxrsltgk-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 13 Engineered peptides based on Bad protein (apoptotic protein/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 188. 93frgrsrsappnlwaaqrygrelrr116 189. 115 rrmsdefvdsfkkglprpksagtatq 140190. 121fvdsfkkglprpksagtatq140 Synthetic Peptides 188. H2N-frgrsrsappnlwaaqrygrelrr-COOH 188. H2N-frgrsrsappnlwaaqrygrelrr-CONH2 191. H2N-frgrsrsappnlwaaqrygrblrr-COOH 191. H2N-frgrsrsappnlwaaqrygrblrr-CONH2 189. H2N-rrmsdefvdsfkkglprpksagtatq-COOH 189. H2N-rrmsdefvdsfkkglprpksagtatq-CONH2 192. H2N-rrmsbefvdsfkkglprpksagtatq-COOH 192. H2N-rrmsbefvdsfkkglprpksagtatq- CONH 2193. H2N-rrmsdbfvdsfkkglprpksagtatq- COOH 193. H2N-rrmsdbfvdsfkkglprpksagtatq-CONH2 194. H2N-rrmsdefvbsfkkglprpksagtatq-COOH 194. H2N-rrmsdefvbsfkkglprpksagtatq-CONH2 195. H2N-rrmsbbfvbsfkkglprpksagtatq-COOH 195. H2N-rrmsbbfvbsfkkglprpksagtatq-CONH2 196. H2N-rrxsbbfvbsfkkglprpksagtatq-COOH 196. H2N-rrxsbbfvbsfkkglprpksagtatq- CONH 2190. H2N-fvdsfkkglprpksagtatq- COOH 190. H2N-fvdsfkkglprpksagtatq-CONH2 197. H2N-fvbsfkkglprpksagtatq-COOH 197. H2N-fvbsfkkglprpksagtatq-CONH2 198. H2N-fvbsfkkglxrpksag-COOH 198. H2N-fvbsfkkglxrpksag- CONH 2199. H2N-fvbsfkkglyrpksag- COOH 199. H2N-fvbsfkkglyrpksag-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 14 Engineered peptides based on Prf-1 protein (perforin-1/apoptotic/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 200. 32krshkfvpgawlag45 201. 49 vtslrrsgsfpvdtqrflr 68202. 123rsirndwkvgldvtpk138 203. 356 rrealrralsqyltdrarwr 375204. 520nlnhghlkfryhar534 Synthetic Peptides 200. H2N-krshkfvpgawlag- COOH 200. H2N-krshkfvpgawlag-CONH2 205. H2N-krshkfvxgawlag-COOH 205. H2N-krshkfvxgawlag-CONH2 201. H2N-vtslrrsgsfpvdtqrflr-COOH 201. H2N-vtslrrsgsfpvdtqrflr- CONH 2206. H2N-vtslrrsgsfxvdtqrflr- COOH 206. H2N-vtslrrsgsfxvdtqrflr-CONH2 207. H2N-vtslrrsgsfpvbtqrflr-COOH 207. H2N-vtslrrsgsfpvbtqrflr-CONH2 208. H2N-vtslrrsgsfxvbtqrflr-COOH 208. H2N-vtslrrsgsfxvbtqrflr- CONH 2202. H2N-rsirndwkvgldvtpk- COOH 202. H2N-rsirndwkvgldvtpk-CONH2 209. H2N-rsirnbwkvgldvtpk-COOH 209. H2N-rsirnbwkvgldvtpk- CONH 2210. H2N-rsirndwkvgldvt- COOH 210. H2N-rsirndwkvgldvt-CONH2 211. H2N-rsirnbwkvgldvt-COOH 211. H2N-rsirnbwkvgldvt-CONH2 203. H2N-rrealrralsqyltdrarwr-COOH 203. H2N-rrealrralsqyltdrarwr-CONH2 212. H2N-rrbalrralsqyltdrarwr-COOH 212. H2N-rrbalrralsqyltdrarwr-CONH2 213. H2N-rrealrralsqyltbrarwr-COOH 213. H2N-rrealrralsqyltbrarwr-CONH2 214. H2N-rrbalrralsqyltbrarwr-COOH 214. H2N-rrbalrralsqyltbrarwr-CONH2 215. H2N-rxbalrralsqyltbrarwr-COOH 215. H2N-rxbalrralsqyltbrarwr-CONH2 204 H2N-nlnhghlkfryhar- COOH 204. H2N-nlnhghlkfryhar-CONH2 216. H2N-nlnbghlkfryhar-COOH 216. H2N-nlnbghlkfryhar-CONH2 217. H2N-nlnbgblkfryhar-COOH 217. H2N-nlnbgblkfryhar- CONH 2218. H2N-nlnbgblkfrybar- COOH 218. H2N-nlnbgblkfrybar- CONH 2219. H2N-nlnxghlkfryhar- COOH 219. H2N-nlnxghlkfryhar- CONH 2220. H2N-nlnbgxlkfryhar- COOH 220. H2N-nlnbgxlkfryhar-CONH2 221. H2N-nlnbgblkfryxar-COOH 221. H2N-nlnbgblkfryxar-CONH2 222. H2N-olnbgblkfrybar-COOH 222. H2N-olnbgblkfrybar-CONH2 223. H2N-olnbgblkfryxar-COOH 223. H2N-olnbgblkfryxar-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue; o = anthrylalanine or other non-natural amino acid. -
TABLE 15 Engineered peptides based on Granulysin protein (granulysin-1/apoptotic/human/nuclear-encoded). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 224. 62lgrdyrtcltivqklkk78 225. 82kptqrsvsnaatrvcrtgrsrwr104 226. 101srwrrryqsrvtqglvag125 Synthetic Peptides 224. H2N-lgrdyrtcltivqklkk- COOH 224. H2N-lgrdyrtcltivqklkk-CONH2 227. H2N-lgrbyrtcltivqklkk-COOH 227. H2N-lgrbyrtcltivqklkk- CONH 2228. H2N-lgrdyrtxltivqklkk- COOH 228. H2N-lgrdyrtxltivqklkk-CONH2 229. H2N-lgrbyrtxltivqklkk-COOH 229. H2N-lgrbyrtxltivqklkk-CONH2 225. H2N-kptqrsvsnaatrvcrtgrsrwr-COOH 225. H2N-kptqrsvsnaatrvcrtgrsrwr- CONH 2230. H2N-kptqrsvsnaatrvxrtgrsrwr- COOH 230. H2N-kptqrsvsnaatrvxrtgrsrwr-CONH2 231. H2N-kptqrsvsnaatrvxrtg-COOH 231. H2N-kptqrsvsnaatrvxrtg-CONH2 232. H2N-kptqrsvsnyatrvxrtg-COOH 232. H2N-kptqrsvsnyatrvxrtg-CONH2 233. H2N-kptqrsvsnfatrvxrtg-COOH 233. H2N-kptqrsvsnfatrvxrtg-CONH2 226. H2N-srwrrryqsrvtqglvag-COOH 226. H2N-srwrrryqsrvtqglvag-CONH2 234. H2N-srwrryqsrvtqylvag-COOH 234. H2N-srwrryqsrvtqylvag-CONH2 235. H2N-orwrryqsrvtqylvag-COOH 235. H2N-orwrryqsrvtqylvag-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 16 Engineered peptides based on CidA protein (pro-programmed cell death protein/S. aureus). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 236. 28qkifhlplagsivglflfylllqfkiv54 237. 88eitlnyilffaviiigtcivalssgyiaekmsvkhkqrkgi127 Synthetic Peptides 236. H2N-qkifhlplagsivglflfylllqfkiv- COOH 236. H2N-qkifhlplagsivglflfylllqfkiv-CONH2 238. H2N-qkifhlplabsivglflfylllqfkiv-COOH 238. H2N-qkifhlplabsivglflfylllqfkiv- CONH 2239. H2N-qkifhlplagsivglflfylglqfkiv- COOH 239. H2N-qkifhlplagsivglflfylglqfkiv-CONH2 240. H2N-qkifhlplabsivglflfylglqfkiv-COOH 240. H2N-qkifhlplabsivglflfylglqfkiv-CONH2 241. H2N-labsivglflfylglqfkiv-COOH 241. H2N-labsivglflfylglqfkiv-CONH2 242. H2N-labsivblflfylglqfkiv-COOH 242. H2N-labsivblflfylglqfkiv-CONH2 237. H2N-eitlnyilffaviiigtcivalssgyiaekmsvkhkqrkgi-COOH 237. H2N-eitlnyilffaviiigtcivalssgyiaekmsvkhkqrkgi-CONH2 243. H2N-eitlnyilffaviiigtxivalssgyiaekxsvkhkqrkgi-COOH 243. H2N-eitlnyilffaviiigtxivalssgyiaekxsvkhkqrkgi-CONH2 244. H2N-aekmsvkhkqrkgi-COOH 244. H2N-aekmsvkhkqrkgi-CONH2 245. H2N-abkmsvkhkqrkgi-COOH 245. H2N-abkmsvkhkqrkgi- CONH 2246. H2N-alkmsvkhkqrkgi- COOH 246. H2N-alkmsvkhkqrkgi- CONH 2247. H2N-alkxsvkhkqrkgi- COOH 247. H2N-alkxsvkhkqrkgi-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 17 Engineered peptides based on LrgA protein (anti-programmed cell death protein/S. aureus). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 248. 123kvtsrskgdkvtkkiki139 Synthetic Peptides 248. H2N-kvtsrskgdkvtkkiki-COOH 248. H2N-kvtsrskgdkvtkkiki-CONH2 249. H2N-kvtsrskgdkvtkwiki-COOH 249. H2N-kvtsrskgdkvtkwiki-CONH2 250. H2N-kvtsrskgdkvtkziki-COOH 250. H2N-kvtsrskgdkvtkziki- CONH 2251. H2N-kvtsrskgdkvtkxiki- COOH 251. H2N-kvtsrskgdkvtkxiki-CONH2 Underlined residues indicate substitutions; z = d, e, other anionic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 18 Engineered peptides based on Lambda S21 protein (lytic regulator protein/λ21 phage). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 252. 44slvlgfltyltnlyfkiredrrkaarge71 Synthetic Peptides 252. H2N-slvlgfltyltnlyfkiredrrkaarge-COOH 252. H2N-slvlgfltyltnlyfkiredrrkaarge-CONH2 253. H2N-slvlgfltyltnlyfkirbdrrkaarge-COOH 253. H2N-slvlgfltyltnlyfkirbdrrkaarge-CONH2 254. H2N-slvlgfltyltnlyfkirebrrkaarge-COOH 254. H2N-slvlgfltyltnlyfkirebrrkaarge-CONH2 255. H2N-slvlgfltyltnlyfkirxxrrkaarge-COOH 255. H2N-slvlgfltyltnlyfkirxxrrkaarge-CONH2 256. H2N-lyfkirxxrrkaarg-COOH 256. H2N-lyfkirxxrrkaarg-CONH2 Underlined residues indicate substitutions; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 19 Engineered peptides based on Holin protein (lytic regulatory protein/Enterobacteria λ phage). SEQ ID NO: Amino Acid Sequence Native Sequence Domains 257. 27aylrgrynggaftktvi44 258. 84sigslikrfaakkagvedgrnq105 259. 84sigslikrfaakkagv100 Synthetic Peptides 257. H2N-aylrgrynggaftktvi-COOH 257. H2N-aylrgrynggaftktvi- CONH 2260. H2N-oylrgrynggaftktvi- COOH 260. H2N-oylrgrynggaftktvi-CONH2 258. H2N-sigslikrfaakkagvedgrnq-COOH 258. H2N-sigslikrfaakkagvedgrnq-CONH2 261. H2N-sigslikrfaakkagvbdgrnq-COOH 261. H2N-sigslikrfaakkagvbdgrnq-CONH2 262. H2N-sigslikrfaakkagvebgrnq-COOH 262. H2N-sigslikrfaakkagvebgrnq-CONH2 259 H2N-sigslikrfaakkagv-COOH 259. H2N-sigslikrfaakkagv-CONH2 263. H2N-sigslikrfaxkkagv-COOH 263. H2N-sigslikrfaxkkagv-CONH2 Underlined residues indicate substitutions; o = anthrylalanine or other non-natural amino acid; b = k, r, n, q, other natural/non-natural basic residue; x = s, t, y, other natural/non-natural H-bond donor/acceptor residue. -
TABLE 20 Additional engineered peptides based on programmed cell death effector proteins. Native SEQ ID Protein NO: Amino Acid Sequence Human 288 H2N-SQSNRELVVDFLSYKLSQK-COOH Bcl-xL Human 288 H2N-SQSNRELVVDFLSYKLSQK-CONH2 Bcl-xL Human 289 H2N-QKLKKMVDKPTQRSVSN-COOH CTL Granulysin Human 289 H2N-QKLKKMVDKPTQRSVSN-CONH2 CTL Granulysin -
TABLE 21 Novel Therapeutic Peptide Designs Based on Programmed Cell Death Effector Domains. ID Name Sequence SEQ ID NO: Length Priority BaxP-I-18 H2N-alfyfasklvlkalytkv-CONH2 264. 18 1 CidA-II-12 H2N-alkysvkhkqrkgi-CONH2 265. 14 2 Ncl-VIII-6 H2N-irlvskygkskgiayi-CONH2 152. 16 3 Csp3-II-12 H2N-lkkitnfrgkryrsltgk-CONH2 266. 18 4 Dnm2-II-4 H2N-alrsklqsqllslrk- CONH 2267. 15 5 Dnm1-IV-2 H2N-atvkkqvqklk-CONH2 80. 11 6 BclXb-I-2 H2N-flsyklsqkgyswsqfs-CONH2 26. 17 7 Hol-III-4 H2N-sigslikrfaykkagv-CONH2 268. 16 8 Mfn1-II-2 H2N-kiqnnskllrnkavql-CONH2 64. 16 9 BclWP-I-4 H2N-tralvakfvgyklrqkgyv-CONH2 269. 19 10 LrgA-I-4 H2N-kvtsrskgdkvtkwiki-CONH2 249. 17 11 BaxP-I-1 H2N-nfnwgrvvalfyfasklvlkalytkv- CONH 2270. 26 BaxP-II-8 H2N-tvtifvakvltasltiwkk-CONH2 271. 19 BclWP-II-6 H2N-trfrrtfsklaaqlhvt- CONH 2272. 17 BclXb-IV-10 H2N-gqrsptalslylfllywvivk-CONH2 273. 21 Mfn1-II-20 H2N-kkievlkslqskakllrnkagwl-CONH2 274. 23 Dnm1-III-4 H2N-glrnklqsqllsikk-CONH2 275. 15 Dnm2-I-4 H2N-klakkvdpqglrtigvitkl-CONH2 276. 21 Dnm2-VI-16 H2N-kskkytlplknlkir-CONH2 277. 15 Csp3-I-10 H2N-sksiknlkpkiiyks-CONH2 278. 15 CidA-I-12 H2N-laksivrlflfylglqfkiv-CONH2 279. 20 - The following assay is designed to measure the relative antimicrobial activity of peptides by determining zones of growth inhibition.
- The top eleven prioritized target sequences identified in Example I (see Table 21) were synthesized by solid-phase chain extension synthesis using conventional techniques. Each synthetic peptide was purified by RP-HPLC, and authenticated for purity and correct sequence by mass spectroscopy. Stock concentrations of the synthetic peptides were prepared at 1 mg/mL in 0.01% acetic acid and adjusted to pH 7.2. Synthetic peptides were assessed for antimicrobial efficacy, spectra, and conditional optima (pH 5.5 or 7.5) using the following modified radial diffusion assay, as detailed in Yount and Yeaman, PNAS 1010:7363-7368 (2004).
- Media Preparation
- Molecular grade agarose (1.0%) in 10 mM NaH2PO4H2O was prepared, pH adjusted to 7.5 or 5.5, and autoclaved for 15 minutes at 121° C., then held in a waterbath set at 48° C. until used. Mueller Hinton II overlay agarose was prepared by adding molecular grade agarose to Mueller Hinton II Broth at a final concentration of 1.0%, pH adjusted to 7.5 or 5.5, autoclaved for 10 minutes at 121° C., and then held at 48° C. until used.
- Inoculum Preparation
- Trypticase Soy Broth (TSB) (10 mL) we inoculated with an overnight growth of the test organism and incubated three to six hours until the organism reached log phase. The cells were collected by centrifugation, washed in PBS, then 0.01% acetic acid adjusted to pH 7.2. The pellet was resuspended in TSB and standardized to a 0.5 McFarland turbidity standard. A 10 μl aliquot of the inoculum is added to 10 mL of the pH-adjusted 1.0% molecular grade agarose cooled to 48° C. resulting in a final inoculum concentration of 5×105 CFU/mL. The suspension is poured into a 15×100 mm Petri dish and allowed to solidify.
- After solidification had occurred, five 4 mm diameter wells were bored into the agarose. The central well was used as the acetic acid control while 10 μl of peptide stock solution was added to each of the other wells resulting in a final concentration of 10 μg peptide/well. The plates were incubated upright for three hours at 37° C., then overlaid with 10 mL of Mueller Hinton II agarose. After the overlay solidified, the plates were inverted and incubated overnight at 37° C.
- Activity Determination
- The synthetic peptides identified in Table 22 were assayed for antimicrobial activity against known pathogenic microorganisms. These pathogenic microorganisms included five species of bacteria (Staphylococcus aureus, Escherichia coli, Salmonella typhimurium, Pseudomonas aeruginosa and Bacillus subtilis) and one species of fungi (Candida albicans) (see Table 23). Zones of growth inhibition were measured and were grouped as complete and/or partial growth zones for the assayed microorganism. Zones were considered complete clearance when there was no visible growth (i.e. completely clear or free of growth). Zones were considered partial clearance when growth was impeded or partially cleared (i.e. reduction in microbial density as compared to adjacent confluent growth). The larger the zone size, the greater the antimicrobial activity of the test peptide. The lack of a zone is an indication of no antimicrobial activity of the test peptide against the target organism under the conditions tested.
-
TABLE 22 Peptide key for antimicrobial assay (FIGS. 30-35). Template Identifier* Design Sequence SEQ ID NO: Length Holin protein Hol-III-4 H2N-sigslikrfaykkagv-CONH2 268. 16 Dynamin-2 Dnm2-II-4 H2N-alrsklqsqllslrk- CONH 2267. 15 BclW protein BclWP-I-4 H2N-tralvakfvgyklrqkgyv-CONH2 269. 19 Caspase-3 Csp3-II-12 H2N-lkkitnfrgkryrsltgk-CONH2 266 18 LrgA protein LrgA-I-4 H2N-kvtsrskgdkvtkwiki-CONH2 249. 17 Dynamin-1 Dnm1-IV-2 H2N-atvkkqvqklk-CONH2 80. 11 BclXb protein BclXb-I-2 H2N-flsyklsqkgyswsqfs-CONH2 26. 17 Nucleolin Ncl-VIII-6 H2N-irlvskygkskgiayi-CONH2 152. 16 Mitofusin-1 Mfn1-II-2 H2N-kiqnnskllrnkavql-CONH2 64. 16 Bax protein BaxP-I-18 H2N-alfyfasklvlkalytkv-CONH2 264. 18 CidA protein CidA-II-12 H2N-alkysvkhkqrkgi-CONH2 265. 14 *Note: identifier formula = [Template]-[Model Domain]-[Design No.] -
TABLE 23 Microorganism key for antimicrobial assay (FIGS. 30-35). Genus/Species Identifier Strain Bacteria Staphylococcus aureus SAISP479C ISP479C Escherichia coli ECML-35 ML-35 Salmonella typhimurium ST14028 14028 Pseudomonas aeruginosa PA01 01 Bacillus subtilis BS6633 ATCC 6633 Fungi Candida albicans CA36082S 36082S - 85% (46/54) of all peptide and microorganism combinations tested at neutral pH showed antimicrobial activity (
FIGS. 30 , 32 and 34). The majority of peptides also maintained antimicrobial activity under acidic conditions, i.e. pH 5.5 (FIGS. 31 , 33 and 35), albeit at a reduced level. The acidic pH reduced the antimicrobial activity of all peptides when tested against Staphylococcus aureus. Additionally, 64% (7/11), 73% (8/11) and 73% (8/11) of the peptides showed lesser antimicrobial activity when tested against Escherichia coli, Pseudomonas aeruginosa and Salmonella typhimurium, respectively (FIGS. 31 , 33 and 35) at pH 5.5 versus pH 7.5. However, the acidic conditions did not appear to affect the activity of peptides Hol-III-4 (SEQ ID NO:268), Ncl-VIII-6 (SEQ ID NO:152) or BaxP-I-18 (SEQ ID NO:264) against Bacillus subtilis, Escherichia coli, Salmonella typhimurium, and Pseudomonas aeruginosa. Alternatively, the antimicrobial activity was increased for 82% (9/11) of the peptides when tested against the fungal pathogen Candida albicans under acidic conditions. Notably, all peptides assayed showed significant and consistently high antimicrobial activity against Bacillus subtilis regardless of the acidity of the agarose media (FIGS. 30-35 , lane designation BS6633). - The above results show that the designed peptides exerted consistent in vitro efficacy against Bacillus. These results supports the concept that these molecules exploit a targetable evolutionary relationship between prokaryotic organisms and eukaryotic mitochondria. Evidence underscoring the bacterium-to-mitochondrial evolution is consistent with this concept (see Herrmann, TRENDS Micro 11(2):74-79 (2003)). For example, proteins that are believed to mediate ion-permeability transition in mitochondria are likely to have evolved from membrane targeting motifs such as helical pre-sequences present in ancestral Gram-positive organisms such as Bacillus, or other prokaryotes (see von Heijne, EMBO Journal 5:1335-1342 (1986)). Such molecules can target mitochondria, are often comprised of 20-60 amino acids, have the potential to form amphipathic α-helices that segregate hydrophobic and hydrophilic facets, and have one facet that is positively charged. The peptides described herein are highly consistent with such molecules. Therefore, the peptides described herein which have antimicrobial activity will also have anti-cancer, anti-inflammatory, anti-rheumatologic and other efficacy by virtue of their likelihood to target mitochondria and induce or cause dysfunctions in programmed cell death circuits.
- Further to the methods disclosed in Example II, utilizing the same antimicrobial assay above, the antimicrobial activity of peptides Hol-III-4 (SEQ ID NO: 268) and Ncl-VIII-6 (SEQ ID NO: 152 was determined by identifying zones of growth inhibition.
- Hol-III-4 and Ncl-VIII-6 peptides were assayed for antimicrobial activity against a panel of drug-resistant Gram-negative bacterial pathogens, specifically Pseudomonas aeruginosa, and various Acinetobacter spp. strains. The efficacies of these peptides were tested in the context of pH 5.5 (
FIGS. 36-46 ) and pH 7.5 (FIGS. 47-57 ) conditions, and compared with other peptides known to have antimicrobial activity (e.g. RP-1, 6W-RP-1 (a 6-Trp variant of RP-1), IK, and PMP-2), in the radial diffusion assay. The RP-1 peptide is well known in the art to have antimicrobial activity, as illustrated in Yeaman et al., Antimicrobial Agents and Chemotherapy, 46(12):3883-3891 (2002). The 6W-RP-1 peptide is a 6-Trp variant of RP-1, which also has antimicrobial activity, as illustrated in Kilelee et al, Antimicrobial Agents and Chemotherapy 54(10):4476-4479 (2010). PMP is the C-terminal helix of the consensus molecule cPMP, as shown in Table 1 (bottom row; N-AALYKKKIIKKLLES-C; as shown in Yeaman et al., Bichimica et Biophysica Acta, 1768:609-619 (2007). The IK peptide is designed to have a nearly maximal polar angle (maximum angle is approximately 180°). The results of the antimicrobial assay show that both Hol-III-4 and Ncl-VIII-6 consistently showed significant antimicrobial activity against all Pseudomonas aeruginosa, and all Acinetobacter spp. strains tested. Additionally, the antimicrobial activity of both Hol-III-4 and Ncl-VIII-6 against the various Acinetobacter baumannii isolates tested appeared to be pH dependent (seeFIGS. 39 , 40, 43-46 vs.FIGS. 50 , 51, 54-57) - These results expand on and further substantiate the results shown in Example II regarding the antimicrobial efficacy of the peptides disclosed here. Additionally, the current data supports the conclusion that the PCD peptides may have a unique mechanism of action, but achieve generally equivalent efficacy as RP-1-like peptides against most organisms tested. The is evident by the following observations. The RP-1 and related antimicrobial peptides appear to target microbial cells enriched with electronegative constituents (e.g. phosphatidylglycerol, cardiolipin, etc.), and/or those having electronegative transmembrane potential. These features, in addition to conformational plasticity, inhibition of intracellular functions (e.g. macromolecular synthesis) and possibly superstructural assembly, are believed to participate in the preferential microbial targeting and antimicrobial effects of such peptides. By comparison, the current peptides are designed from programmed cell death effector or modulating proteins. Without being bound by theory, one hypothesis is that such peptides induce microbial and other target cell death by inducing or dysregulating programmed cell death. Thus, it is possible that these peptides function via a mechanism that is not identical to the RP-1-like peptides. In balance, it is also possible that PCD peptides evolved (e.g. diverged) from antimicrobial peptide sequences, based on the view that mitochondria are modern day “bacteria”; this is one hypothesis we posed in the patent. If so, then the mechanisms may be conserved among antimicrobial helices, even if the helices come from proteins believed to have vastly divergent functions (e.g. helices from PMPs, PCD proteins, chemokines, etc).
- Throughout this application various publications have been referenced. The disclosures of these publications in their entireties are hereby incorporated by reference in this application in order to more fully describe the state of the art to which this invention pertains. Although the invention has been described with reference to the examples provided above, it should be understood that various modifications can be made without departing from the spirit of the invention.
Claims (23)
1. An isolated peptide comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 17, 18, 19, 21-25, 30, 31-36, 39-47, 49-52, 54-57, 59-63, 66-75, 84-93, 102-106, 108-121, 132-175, 179-187, 191-199, 205-209, 211-223, 227-235, 238-243, 245-247, 249-251, 253-256 and 260-263, wherein the amino acid residue represented by (x) is a serine, a threonine, a tryptophan, a H-bond donor residue or a H-bond acceptor residue, wherein the amino acid residue represented by (b) is a lysine, an arginine, an asparagine, a glutamine or a basic residue, wherein the amino acid residue represented by (j) is a cysteine or a thiol residue, wherein in the amino acid residue represented by (o) is an anthrylalanine or other non-natural amino acid and wherein said peptide induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
2-170. (canceled)
171. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 17, 18, 19, 21-25, 269 and 272.
172. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 30, 31-36 and 273.
173. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 39-47.
174. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 49-52.
175. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 54-57.
176. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 59-63 and 274.
177. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 66-75.
178. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 84-93 and 275.
179. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 102-106, 108-121, 267, 276 and 277.
180. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 132-175.
181. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 179-187, 266 and 278.
182. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NO: 191-199.
183. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 205-209 and 211-223.
184. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 227-235.
185. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 238-243, 245-247, 265 and 279.
186. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 249-251.
187. The isolated protein of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 253-256.
188. The isolated peptide of claim 1 comprising one or more amino acid sequence selected from the group consisting of SEQ ID NOS: 260-263 and 268.
189. An isolated peptide consisting of an amino acid sequence selected from the group consisting of SEQ ID NOS: 14-16, 20, 26-29, 37, 38, 48, 53, 58, 64, 65, 72, 76-83, 94-101, 107, 114, 122-131, 170, 176-178, 188-190, 200-204, 210, 224-226, 236, 237, 244, 248, 252, 257-259 and 288-289, wherein said peptide induces antimicrobial, anti-cancer, anti-inflammatory, anti-proliferative or programmed cell death activity.
190. A method of inducing programmed cell death in a cell, comprising contacting said cell with the isolated peptide of claim 1 .
191. A method of inducing programmed cell death in a cell, comprising contacting said cell with the isolated peptide of claim 189 .
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US13/875,066 US20140227767A2 (en) | 2010-02-22 | 2013-05-01 | Peptides and methods for inducing cell death |
US14/609,128 US9562083B2 (en) | 2010-02-22 | 2015-01-29 | Peptides and methods for inducing cell death |
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US33874710P | 2010-02-22 | 2010-02-22 | |
US12/932,298 US8492333B2 (en) | 2010-02-22 | 2011-02-22 | Peptides and methods for inducing cell death |
US13/875,066 US20140227767A2 (en) | 2010-02-22 | 2013-05-01 | Peptides and methods for inducing cell death |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/932,298 Continuation US8492333B2 (en) | 2010-02-22 | 2011-02-22 | Peptides and methods for inducing cell death |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/609,128 Continuation US9562083B2 (en) | 2010-02-22 | 2015-01-29 | Peptides and methods for inducing cell death |
Publications (2)
Publication Number | Publication Date |
---|---|
US20140065695A1 true US20140065695A1 (en) | 2014-03-06 |
US20140227767A2 US20140227767A2 (en) | 2014-08-14 |
Family
ID=44483620
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/932,298 Active US8492333B2 (en) | 2010-02-22 | 2011-02-22 | Peptides and methods for inducing cell death |
US13/875,066 Abandoned US20140227767A2 (en) | 2010-02-22 | 2013-05-01 | Peptides and methods for inducing cell death |
US14/609,128 Active US9562083B2 (en) | 2010-02-22 | 2015-01-29 | Peptides and methods for inducing cell death |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US12/932,298 Active US8492333B2 (en) | 2010-02-22 | 2011-02-22 | Peptides and methods for inducing cell death |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/609,128 Active US9562083B2 (en) | 2010-02-22 | 2015-01-29 | Peptides and methods for inducing cell death |
Country Status (2)
Country | Link |
---|---|
US (3) | US8492333B2 (en) |
WO (1) | WO2011103567A2 (en) |
Families Citing this family (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9096679B2 (en) | 2012-12-03 | 2015-08-04 | The Board Of Regents Of The University Of Oklahoma | Peptide compounds and methods of production and use thereof |
EP2925341B1 (en) * | 2012-12-03 | 2018-01-31 | The Board of Regents of the University of Oklahoma | Peptide compounds and methods of production and use thereof |
CA2908693C (en) | 2013-04-16 | 2021-04-06 | The Board Of Regents Of The University Of Oklahoma | Peptide compounds and methods of production and use thereof |
US20200157159A1 (en) | 2013-04-16 | 2020-05-21 | The Board Of Regents Of The University Of Oklahoma | Peptide compounds and compositions thereof |
AU2015266959A1 (en) * | 2014-05-30 | 2017-01-19 | Albert Einstein College Of Medicine, Inc. | Targeting dimerization of BAX to modulate BAX activity |
RU2017114801A (en) | 2014-10-01 | 2018-11-06 | Плант Хелс Кэар, Инк. | ELISITIVE PEPTIDES HAVING A DESTROYED BOX OF A HYPERSENSITIVE RESPONSE, AND THEIR APPLICATION |
US10856546B2 (en) | 2014-10-01 | 2020-12-08 | Plant Health Care, Inc. | Hypersensitive response elicitor peptides and use thereof |
US10793608B2 (en) | 2016-04-06 | 2020-10-06 | Plant Health Care, Inc. | Hypersensitive response elicitor-derived peptides and use thereof |
BR112018069945A2 (en) | 2016-04-06 | 2019-02-05 | Plant Health Care Inc | beneficial microbes for the distribution of peptides or effector proteins and their use |
CA3062852A1 (en) * | 2017-05-11 | 2018-11-15 | Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center | Antimicrobial peptides with alpha-core helices |
WO2019199790A2 (en) * | 2018-04-10 | 2019-10-17 | The Board Of Regents Of The University Of Oklahoma | Anti-angiogenin peptides, compositions, and methods of use |
US20220002363A1 (en) * | 2020-07-03 | 2022-01-06 | United States Government As Represented By The Department Of Veterans Affairs | Compositions and methods for treating pulmonary disease |
Family Cites Families (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6576239B1 (en) | 1996-09-10 | 2003-06-10 | The Burnham Institute | Angiogenic homing molecules and conjugates derived therefrom |
EP1056465A4 (en) | 1998-02-18 | 2004-05-26 | Harbor Ucla Res & Education | Antimicrobial peptides and derived metapeptides |
CA2311201A1 (en) * | 1999-08-05 | 2001-02-05 | Genset S.A. | Ests and encoded human proteins |
WO2003046205A2 (en) | 2001-11-28 | 2003-06-05 | The Burnham Institute | Methods for identifying modulators of apoptosis |
US7067621B2 (en) * | 2002-08-20 | 2006-06-27 | Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center | Multifunctional context-activated protides and methods of use |
AU2003299643A1 (en) * | 2002-12-04 | 2004-06-23 | Diadexus, Inc. | Compositions, splice variants and methods relating to colon specific genes and proteins |
WO2005108415A2 (en) * | 2004-04-30 | 2005-11-17 | Biogen Idec Ma Inc. | Membrane associated molecules |
EP1618886A1 (en) * | 2004-07-20 | 2006-01-25 | Fonds zur Förderung der Forschung auf dem Gebiet der molekularen Virologie und Gentherapie | Bacteriophage and prophage proteins in cancer gene therapy |
CA2700925C (en) * | 2007-09-26 | 2016-08-23 | Dana Farber Cancer Institute | Methods and compositions for modulating bcl-2 family polypeptides |
-
2011
- 2011-02-22 WO PCT/US2011/025707 patent/WO2011103567A2/en active Application Filing
- 2011-02-22 US US12/932,298 patent/US8492333B2/en active Active
-
2013
- 2013-05-01 US US13/875,066 patent/US20140227767A2/en not_active Abandoned
-
2015
- 2015-01-29 US US14/609,128 patent/US9562083B2/en active Active
Also Published As
Publication number | Publication date |
---|---|
US9562083B2 (en) | 2017-02-07 |
WO2011103567A2 (en) | 2011-08-25 |
US20150232521A1 (en) | 2015-08-20 |
WO2011103567A3 (en) | 2011-10-27 |
US20110288006A1 (en) | 2011-11-24 |
US8492333B2 (en) | 2013-07-23 |
US20140227767A2 (en) | 2014-08-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US9562083B2 (en) | Peptides and methods for inducing cell death | |
JP7041187B2 (en) | Cell-permeable peptides, conjugates containing them, and compositions containing them. | |
JP7007423B2 (en) | Cell-permeable peptides, conjugates containing them, and compositions containing them. | |
Stevens et al. | Structure, function and regulation of the vacuolar (H+)-ATPase | |
Lord et al. | Ricin: mechanisms of cytotoxicity | |
US8067357B2 (en) | Annexin derivatives suitable for pretargeting in therapy and diagnosis | |
Smith | Targeting anticomplement agents | |
US20210260205A1 (en) | Cartilage-homing peptide conjugates and methods of use thereof | |
US20200222549A1 (en) | Renal-homing peptide conjugates and methods of use thereof | |
Hebecker et al. | Molecular basis of C-reactive protein binding and modulation of complement activation by factor H-related protein 4 | |
EP1856145B1 (en) | Voltage dependent anion channel (vdac1) compositions and methods of use thereof for regulating apoptosis | |
IL168260A (en) | Mutated ricin a chain toxins with reduced toxic effects and methods of production thereof | |
Mui et al. | Therapeutic potential of annexins in sepsis and COVID-19 | |
US20220220174A1 (en) | Bnip3 peptides for treatment of reperfusion injury | |
Li et al. | Improving selectivity, proteolytic stability, and antitumor activity of Hymenochirin-1B: A novel glycosylated staple strategy | |
Marcet-Palacios et al. | Vesicle-associated membrane protein 7 (VAMP-7) is essential for target cell killing in a natural killer cell line | |
Shafer et al. | Tailoring an antibacterial peptide of human lysosomal cathepsin G to enhance its broad-spectrum action against antibiotic-resistant bacterial pathogens | |
Motto | Endothelial cells and thrombotic microangiopathy | |
US7666391B2 (en) | Breast homing peptides and methods of identifying same using aminopeptidase P | |
Orzáez et al. | Peptides and peptide mimics as modulators of apoptotic pathways | |
US10543250B2 (en) | Antimicrobial fusion peptides | |
US8592375B2 (en) | Multifunctional context-activated protides and methods of use | |
US20210171589A1 (en) | Truncated cartilage-homing peptides and peptide complexes and methods of use thereof | |
US20060198832A1 (en) | Peptide drugs for chronic lymphocytic leukemia (CLL) and other cancers | |
O'Leary | Alternative Antimicrobial Agents Against Multidrug-Resistant Gram-Negative Bacteria |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |