US20130109845A1 - Fully human influenza m2 specific antibodies - Google Patents
Fully human influenza m2 specific antibodies Download PDFInfo
- Publication number
- US20130109845A1 US20130109845A1 US13/728,056 US201213728056A US2013109845A1 US 20130109845 A1 US20130109845 A1 US 20130109845A1 US 201213728056 A US201213728056 A US 201213728056A US 2013109845 A1 US2013109845 A1 US 2013109845A1
- Authority
- US
- United States
- Prior art keywords
- seq
- peptide
- influenza
- antigen
- monoclonal antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 206010022000 influenza Diseases 0.000 title claims abstract description 129
- 239000000427 antigen Substances 0.000 claims abstract description 186
- 102000036639 antigens Human genes 0.000 claims abstract description 186
- 108091007433 antigens Proteins 0.000 claims abstract description 186
- 238000009739 binding Methods 0.000 claims abstract description 111
- 230000027455 binding Effects 0.000 claims abstract description 109
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 28
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 23
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 23
- 239000013604 expression vector Substances 0.000 claims abstract description 20
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 413
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 50
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 48
- 238000000034 method Methods 0.000 claims description 47
- 208000037797 influenza A Diseases 0.000 claims description 42
- 101001039853 Sonchus yellow net virus Matrix protein Proteins 0.000 claims description 22
- 150000001413 amino acids Chemical class 0.000 claims description 22
- 238000010494 dissociation reaction Methods 0.000 claims description 18
- 230000005593 dissociations Effects 0.000 claims description 18
- 102000040430 polynucleotide Human genes 0.000 claims 1
- 108091033319 polynucleotide Proteins 0.000 claims 1
- 239000002157 polynucleotide Substances 0.000 claims 1
- 238000011282 treatment Methods 0.000 abstract description 10
- 241000282412 Homo Species 0.000 abstract description 6
- 230000002265 prevention Effects 0.000 abstract description 3
- 210000004027 cell Anatomy 0.000 description 71
- 238000002965 ELISA Methods 0.000 description 47
- 102000004196 processed proteins & peptides Human genes 0.000 description 36
- 241000699670 Mus sp. Species 0.000 description 34
- 108020001507 fusion proteins Proteins 0.000 description 31
- 102000037865 fusion proteins Human genes 0.000 description 29
- 241000712431 Influenza A virus Species 0.000 description 28
- 101900330356 Influenza A virus Matrix protein 2 Proteins 0.000 description 26
- 239000000243 solution Substances 0.000 description 25
- 239000011534 wash buffer Substances 0.000 description 23
- 229920001184 polypeptide Polymers 0.000 description 22
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 21
- 239000002953 phosphate buffered saline Substances 0.000 description 21
- 241000699666 Mus <mouse, genus> Species 0.000 description 20
- 239000002245 particle Substances 0.000 description 20
- 108090000623 proteins and genes Proteins 0.000 description 19
- 108060003951 Immunoglobulin Proteins 0.000 description 18
- 102000018358 immunoglobulin Human genes 0.000 description 18
- 239000008194 pharmaceutical composition Substances 0.000 description 17
- 102000004169 proteins and genes Human genes 0.000 description 17
- 239000000872 buffer Substances 0.000 description 15
- 208000015181 infectious disease Diseases 0.000 description 15
- 239000002773 nucleotide Substances 0.000 description 14
- 125000003729 nucleotide group Chemical group 0.000 description 14
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 13
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 13
- 238000011534 incubation Methods 0.000 description 13
- 241000700605 Viruses Species 0.000 description 12
- 230000000694 effects Effects 0.000 description 12
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 12
- 230000000069 prophylactic effect Effects 0.000 description 12
- 238000004458 analytical method Methods 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 230000003053 immunization Effects 0.000 description 11
- 238000002649 immunization Methods 0.000 description 11
- 229940072221 immunoglobulins Drugs 0.000 description 11
- 230000003993 interaction Effects 0.000 description 10
- 241000283707 Capra Species 0.000 description 9
- 108700026244 Open Reading Frames Proteins 0.000 description 8
- 210000003719 b-lymphocyte Anatomy 0.000 description 8
- 230000001225 therapeutic effect Effects 0.000 description 8
- 101710154606 Hemagglutinin Proteins 0.000 description 7
- 108091028043 Nucleic acid sequence Proteins 0.000 description 7
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 7
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 7
- 101710176177 Protein A56 Proteins 0.000 description 7
- 230000000890 antigenic effect Effects 0.000 description 7
- 230000004927 fusion Effects 0.000 description 7
- 238000010172 mouse model Methods 0.000 description 7
- 238000013207 serial dilution Methods 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- 108091035707 Consensus sequence Proteins 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 238000010367 cloning Methods 0.000 description 6
- 239000000185 hemagglutinin Substances 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 238000012216 screening Methods 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 229920000136 polysorbate Polymers 0.000 description 5
- 238000011321 prophylaxis Methods 0.000 description 5
- 238000005406 washing Methods 0.000 description 5
- 238000011740 C57BL/6 mouse Methods 0.000 description 4
- 108091026890 Coding region Proteins 0.000 description 4
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 4
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 4
- 206010037660 Pyrexia Diseases 0.000 description 4
- 101150117115 V gene Proteins 0.000 description 4
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 4
- 210000004899 c-terminal region Anatomy 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- 238000000684 flow cytometry Methods 0.000 description 4
- 231100000636 lethal dose Toxicity 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 238000013507 mapping Methods 0.000 description 4
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 4
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 4
- 230000009257 reactivity Effects 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 208000016261 weight loss Diseases 0.000 description 4
- 230000004580 weight loss Effects 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 3
- 241000283074 Equus asinus Species 0.000 description 3
- 102000009109 Fc receptors Human genes 0.000 description 3
- 108010087819 Fc receptors Proteins 0.000 description 3
- 241000287828 Gallus gallus Species 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000000502 dialysis Methods 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000002998 immunogenetic effect Effects 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 241000712461 unidentified influenza virus Species 0.000 description 3
- 241001515965 unidentified phage Species 0.000 description 3
- 229960005486 vaccine Drugs 0.000 description 3
- YQNRVGJCPCNMKT-LFVJCYFKSA-N 2-[(e)-[[2-(4-benzylpiperazin-1-ium-1-yl)acetyl]hydrazinylidene]methyl]-6-prop-2-enylphenolate Chemical compound [O-]C1=C(CC=C)C=CC=C1\C=N\NC(=O)C[NH+]1CCN(CC=2C=CC=CC=2)CC1 YQNRVGJCPCNMKT-LFVJCYFKSA-N 0.000 description 2
- 102100024630 Asc-type amino acid transporter 1 Human genes 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 101100462537 Caenorhabditis elegans pac-1 gene Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 241001534160 Escherichia virus Qbeta Species 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101150008942 J gene Proteins 0.000 description 2
- 101100117764 Mus musculus Dusp2 gene Proteins 0.000 description 2
- 108010006232 Neuraminidase Proteins 0.000 description 2
- 102000005348 Neuraminidase Human genes 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 101150096292 Ppme1 gene Proteins 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 229920002684 Sepharose Polymers 0.000 description 2
- 101150081875 Slc7a10 gene Proteins 0.000 description 2
- 101150052859 Slc9a1 gene Proteins 0.000 description 2
- 241000282898 Sus scrofa Species 0.000 description 2
- 125000000539 amino acid group Chemical group 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 206010064097 avian influenza Diseases 0.000 description 2
- 230000036760 body temperature Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000010276 construction Methods 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 239000012228 culture supernatant Substances 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 229940033324 influenza A vaccine Drugs 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 231100000518 lethal Toxicity 0.000 description 2
- 230000001665 lethal effect Effects 0.000 description 2
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- 229950010131 puromycin Drugs 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000012448 transchromosomic mouse model Methods 0.000 description 2
- 238000001890 transfection Methods 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 238000002255 vaccination Methods 0.000 description 2
- 101150028074 2 gene Proteins 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 241000894006 Bacteria Species 0.000 description 1
- 101150097493 D gene Proteins 0.000 description 1
- 108010061309 E021 Proteins 0.000 description 1
- 208000032163 Emerging Communicable disease Diseases 0.000 description 1
- 108010020195 FLAG peptide Proteins 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000898072 Homo sapiens Calretinin Proteins 0.000 description 1
- 101000806138 Homo sapiens Dehydrogenase/reductase SDR family member 4 Proteins 0.000 description 1
- 101000956778 Homo sapiens LETM1 domain-containing protein 1 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 101900156543 Influenza A virus Neuraminidase Proteins 0.000 description 1
- 102000004310 Ion Channels Human genes 0.000 description 1
- 102100038448 LETM1 domain-containing protein 1 Human genes 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- 101710199771 Matrix protein 1 Proteins 0.000 description 1
- 101710199769 Matrix protein 2 Proteins 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- 230000010799 Receptor Interactions Effects 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000001010 compromised effect Effects 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 108010074605 gamma-Globulins Proteins 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000002163 immunogen Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 206010025482 malaise Diseases 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- CWWARWOPSKGELM-SARDKLJWSA-N methyl (2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s)-5-amino-2-[[(2s)-5-amino-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-1-[(2s)-2-amino-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-5 Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)OC)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CCCN=C(N)N)C1=CC=CC=C1 CWWARWOPSKGELM-SARDKLJWSA-N 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 229940126619 mouse monoclonal antibody Drugs 0.000 description 1
- AEMBWNDIEFEPTH-UHFFFAOYSA-N n-tert-butyl-n-ethylnitrous amide Chemical compound CCN(N=O)C(C)(C)C AEMBWNDIEFEPTH-UHFFFAOYSA-N 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 230000010807 negative regulation of binding Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 108010018381 streptavidin-binding peptide Proteins 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 210000003412 trans-golgi network Anatomy 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000029302 virus maturation Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1018—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to human antibodies, preferably to fully human antibodies, which are specifically binding to influenza M2e antigen.
- the invention further relates to individual light- and/or heavy chains of such antibodies, to nucleic acids encoding said antibodies or their light- and/or heavy chain, and to expression vectors for the expression of said antibodies.
- the invention relates to the use of said antibodies in the treatment and/or prevention of influenza A virus infection, preferably in humans.
- Influenza A virus still is a major cause of disease in humans, accounting for three to five million cases of severe illness and 250,000-500,000 deaths each year. Efficient influenza A vaccines are available, which act by inducing neutralizing antibodies against hemagglutinin (HA). Since HA undergoes continuous change due to mutations (antigenic drift), new antigenic variants of influenza A arise every year requiring constant update of the vaccines. Effective vaccination is further complicated by the occasional re-assortment of the segmented viral genome leading to the replacement of HA or neuraminidase (NA) from one subtype by another subtype, a process called antigenic shift. Passive immunization with monoclonal antibodies (mAbs) targeting HA is very efficient, however, suffers the same disadvantages as the current vaccines due to antigenic shift and drift.
- mAbs monoclonal antibodies
- M2 matrix protein 2
- M2 fits the bill and has received considerable attention as a potential target against influenza infection over the past decades (Zebedee S L, Lamb R A: Influenza A virus M2 protein: monoclonal antibody restriction of virus growth and detection of M2 in virions. J Virol 1988, 62:2762-2772).
- M2 is a tetrameric ion channel which is involved in virus uncoating in the endosome and in virus maturation in the trans-Golgi network.
- M2 protein is co-transcribed with the matrix protein 1 (M1).
- M2 matrix protein 1
- M2 specific antibodies were shown to protect by the elimination of infected cells by ADCC rather than by preventing infection through neutralization of the virus (Jegerlehner A, Schmitz N, Storni T, Bachmann M F: Influenza A vaccine based on the extracellular domain of M2: weak protection mediated via antibody-dependent NK cell activity. J. Immunol. 2004, 172:5598-5605).
- Passive immunization with monoclonal antibodies has several advantages over vaccination. In particular, it allows treating people which poorly respond to vaccines, such as the elderly, young children or immune compromised individuals. In addition, passive immunization is the treatment option of choice in situations where rapid protection is crucial, such as for post-exposure treatment or prophylaxis for the acutely exposed.
- M2ectodomain (M2e)-specific mAbs have been reported to protect mice from a lethal challenge in a prophylactic setting. While these mAbs include fully human antibodies derived from transchromosomic mice (Wang R et al., Antiviral Res.
- LCVRs and HCVRs Based on the particular combination of CDRs, different types of LCVRs and HCVRs can be distinguished (cf. Tables 1 and 2). However, the LCVRs and HCVRs of all clones are highly similar as can be deduced from the sequence information which is provided in Tables 1 and 2. It was therefore concluded that the antibodies of the invention are clonally related. Table 3 provides an overview of the different combinations of LCVR and HCVR types as defined by their CDRs which were found in the selected clones. The table also indicates the abundance of each of these combinations among the 53 clones. Further surprisingly it has been found that the antibodies of the invention show a very high affinity towards influenza M2e antigen, and in particular towards the extracellular domain of the influenza A M2 protein.
- the dissociation constants (Kd) between the antibodies and RNAse—influenza A M2e antigen conjugate was found to be in the low picomolar range.
- An epitope mapping revealed that the minimal epitope which is recognized by antibody clone D005 is comprised in the amino acid sequence LLTEVETP (SEQ ID NO:93). This epitope is comprised by the M2 protein of most known influenza A strains. Consequently, it has been found, that the antibodies of the invention show a similarly high affinity to different variants of the extracellular domain of influenza A M2 protein which are derived from different strains of influenza A virus. It has also been demonstrated that the antibodies of the invention are specifically binding to cells which are expressing recombinant influenza A M2 protein on their surface.
- antibodies of the invention were found to exhibit a preferential binding to cell-associated influenza A M2 protein. Furthermore it was found that antibodies of the invention are capable of specifically binding influenza A M2 protein in the context of influenza A virus particles. Most importantly, it has been demonstrated in a mouse model for influenza A virus infection that the antibodies of the invention are highly effective in the treatment and/or prevention of influenza A virus infection. Contrary to other influenza A M2 specific human antibodies which are known in the art, the antibodies of the invention have therapeutic activity when administered as a single dose on day one or day two after infection. The antibodies disclosed herein are therefore useful as a medicament against influenza A virus infection in a therapeutic as well as in a prophylactic setting.
- the invention relates to a monoclonal antibody, preferably to an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody, wherein preferably the EC50 value and/or the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 1000 nM, preferably at most 100 nM, more preferably at most 10 nM, still more preferably at most 1 nM, still more preferably at most 100 pM, still more preferably at most 10 pM, and most preferably at most 1 pM.
- Kd dissociation constant
- said monoclonal antibody comprises at least one LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11; and/or (ii) said monoclonal antibody comprises at least one HCVR, wherein said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3, wherein said
- the invention relates to an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein preferably said monoclonal antibody is a human monoclonal antibody, most preferably a fully human monoclonal antibody, and wherein said antibody comprises at least one antigen binding site, wherein said antigen binding site comprises: (a) one LCVR, wherein said LCVR comprises: (i) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (ii) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; and (iii) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11; and (b) one HCVR, wherein said HCVR comprises: (i) one HC CDR1, wherein said HC CDR1,
- a further aspect of the invention is a LCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, most preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11.
- a further aspect of the invention is a HCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said HCVR comprises: one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
- the invention relates a nucleic acid molecule encoding a HCVR or a LCVR of the invention, a monoclonal antibody of the invention or an individual chain thereof.
- the invention relates to an expression vector for the recombinant expression of an antibody of the invention.
- the invention relates to a host cell comprising at least one nucleic acid molecule or at least one expression vector of the invention.
- the invention relates to a pharmaceutical composition comprising at least one monoclonal antibody of the invention.
- the invention relates to a method of passive immunization, preferably against influenza A virus, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said monoclonal antibody is an IgG1.
- the invention relates to a method of treating and/or preventing influenza A virus infection, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said subject is a human, and wherein further preferably said monoclonal antibody is an IgG1.
- the invention relates to a monoclonal antibody of the invention or to the pharmaceutical composition of the invention, for use in passive immunization, preferably against influenza A virus, preferably in a human, and wherein further preferably said monoclonal antibody is an IgG1.
- the invention relates to the use of the monoclonal antibody of the invention in the manufacture of a medicament for the treatment and/or prophylaxis of influenza A virus infection, preferably in a human, and wherein further preferably said monoclonal antibody is an IgG1.
- FIG. 1 Alignment of LCVR sequences (amino acids 5 to 113) of M2-specific human antibodies. Identical amino acids are shown as dots. LC CDRs 1-3 are boxed.
- FIG. 2 Alignment of HCVR sequences (amino acids 7 to 121) of M2-specific human antibodies (the same antibodies as in FIG. 1 ). Identical amino acids are shown as dots. HC CDRs 1-3 are boxed.
- FIG. 3 Effect of M2-specific antibodies on Influenza-induced morbidity and mortality. Mice were treated with 500 ⁇ g of the indicated scFv-msFc ⁇ 2c antibody on day ⁇ 2, infected with Influenza A virus PR8 on day 0, and weight (A), body temperature (B) and survival (C) were monitored on the indicated days.
- FIG. 4 Effect of scFv-D005-msFc ⁇ 2c on survival of Influenza-infected mice.
- A Dose titration. Mice were treated with the indicated amounts of antibody on day ⁇ 2, infected with Influenza A virus PR8 on day 0, and survival was monitored for 21 days.
- B Therapeutic application of antibody. Mice were infected with Influenza A virus PR8 on day 0, treated with 200 ⁇ g of the antibody on the indicated days, and survival was monitored for 21 days. Control, mouse IgG on day ⁇ 2.
- FIG. 5 Effect of M2-specific antibodies on Influenza-induced morbidity and mortality. Mice were treated with the antibody D005 in the indicated format on day ⁇ 2, infected with Influenza A virus PR8 on day 0, and weight (A), body temperature (B) and survival (C) were monitored on the indicated days.
- FIG. 6 Binding to cell surface M2 in the presence of soluble M2e peptide.
- L929/M2#E9 cells were stained with antibody 14C2 (A) or D005 (B) in the presence (solid line) or absence (heavy line) of soluble M2e peptide and analyzed by FACS. Dotted line, staining with fluorescently labelled secondary antibody alone.
- FIG. 7 Direct binding of antibody D005 to Influenza A PR8 virus particles. The indicated amount of virus was captured on wells of an ELISA plate previously coated with anti-HA antibody. Virus was detected with hIgG1k-D005 or an irrelevant isotype control.
- FIG. 8 Characterization of binding specificity of antibody D005.
- A Reactivity of IgG1k-D005 with M2e-derived peptides from different strains of Influenza A.
- B Epitope mapping.
- antibody refers to a molecule, preferably a protein, which is capable of specifically binding an antigen, typically and preferably by binding an epitope or antigenic determinant of said antigen, or a hapten.
- the term antibody refers to an antigen or hapten binding molecule comprising at least one variable region, wherein preferably said molecule comprises least one HCVR and/or at least one LCVR.
- the term antibody refers to an antigen or hapten binding molecule comprising at least one, preferably exactly two antigen binding sites, wherein each of said antigen binding site(s) is formed by one HCVR and one LCVR.
- antibody refers to whole antibodies, preferably of the IgG, IgA, IgE, IgM, or IgD class, more preferably of the IgG class, most preferably IgG1, IgG2, IgG3, and IgG4, and to antigen binding fragments thereof.
- said whole antibodies comprise either a kappa or a lambda light chain.
- antibody also refers to antigen or hapten binding antibody fragments, preferably to proteolytic fragments and their recombinant analogues. most preferably to Fab, Fab′ and F(ab′)2, and Fv.
- antibody further encompasses a protein comprising at least one, preferably two variable regions, wherein further preferably said protein comprises exactly one HCVR and exactly one LCVR.
- the term antibody refers to a single chain antibody, preferably to scFv.
- preferred antibodies are single chain antibodies, preferably scFvs, disulfide-linked Fvs (sdFv) and fragments comprising either a light chain variable region (LCVR) or a heavy chain variable region (HCVR).
- antibody preferably refers to recombinant antibodies, including recombinant proteins consisting of a single polypeptide, wherein said polypeptide comprises at least one, preferably exactly one, variable region.
- recombinant antibodies may further comprise functional elements, such as, for example, a linker region, a signal peptide or hydrophobic leader sequence, a detection tag and/or a purification tag (e.g. Fc).
- an antibody is said to be “recognizing” an epitope when said antibody is specifically binding an antigen comprising said epitope in a position which is available for interaction with said antibody, and when said antibody does not specifically bind an otherwise identical antigen which does not comprise said epitope, or wherein said epitope is located in a position which is not available for interaction with said antibody.
- an antigen binding site is said to be recognizing an epitope, when an antibody comprising said antigen binding site is recognizing said epitope, wherein typically and preferably said antibody does not comprise a second antigen binding site having a different structure.
- Fv refers to the smallest proteolytic fragment of an antibody capable of binding an antigen or hapten and to recombinant analogues of said fragment.
- single chain antibody is an antibody consisting of a single polypeptide.
- Preferred single chain antibodies consist of a polypeptide comprising at least one, preferably exactly one VR, wherein preferably said VR is a HCVR.
- More preferred single chain antibodies consist of a polypeptide comprising a at least one, preferably exactly one, HCVR and at least one, preferably exactly one, LCVR.
- Still more preferred single chain antibodies comprise exactly one HCVR and exactly one LCVR. Typically and preferably said HCVR and said LCVR are forming an antigen binding site.
- Most preferred single chain antibodies are scFv, wherein said scFv consist of a single polypeptide comprising exactly one HCVR and exactly one LCVR, wherein said HCVR and said LCVR are linked to each other by a linker region, wherein preferably said linker region consists of at least 15, preferably of 15 to 20 amino acids (Bird et al. (1988) Science, 242(4877):423-426).
- scFv single chain antibodies
- said scFv are encoded by a coding region, wherein said coding region, in 5′ to 3′ direction, comprises in the following order: (1) a light chain variable region (LCVR) consisting of light chain framework (LC FR) 1, complementary determining region (LC CDR) 1, LC FR2, LC CDR 2, LC FR3, LC CDR3 and LC FR4 from a ⁇ or ⁇ light chain; (2) a flexible linker (L), and (3) a heavy chain variable region (HCVR) consisting of framework (HC FR) 1, complementary determining region (HC CDR) 1, HC FR2, HC CDR2, HC FR3, HC CDR3 and HC FR4.
- LCVR light chain variable region
- single chain antibodies are scFv, wherein said scFv are encoded by a coding region, wherein said coding region, in 5′ to 3′ direction, comprises in the following order: (1) a heavy chain variable region (HCVR) consisting of framework (HC FR) 1, complementary determining region (HC CDR) 1, HC FR2, HC CDR2, HC FR3, HC CDR3 and HC FR4; (2) a flexible linker (L), and (3) a light chain variable region (LCVR) consisting of light chain framework (LC FR) 1, complementary determining region (LC CDR) 1, LC FR2, LC CDR2, LC FR3, LC DR3 and LC FR4 from a ⁇ or ⁇ light chain.
- HCVR heavy chain variable region
- LC CDR complementary determining region
- LC CDR complementary determining region
- LC FR3 complementary determining region
- diabody refers to an antibody comprising two polypeptide chains, preferably two identical polypeptide chains, wherein each polypeptide chain comprises a HCVR and a LCVR, wherein said HCVR and said LCVR are linked to each other by a linker region, wherein preferably said linker region comprises at most 10 amino acids (Huston et al. (1988), PNAS 85(16):587958-83; Holliger et al. (1993), PNAS 90(14):6444-6448, Hollinger & Hudson, 2005, Nature Biotechnology 23(9):1126-1136; Arndt et al. (2004) FEBS Letters 578(3):257-261).
- Preferred linker regions of diabodies comprise 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids.
- human antibody refers to an antibody, preferably a recombinant antibody, essentially having the amino acid sequence of a human immunoglobulin, or a fragment thereof, and includes antibodies isolated from human immunoglobulin libraries.
- human antibodies may comprise a limited number of amino acid exchanges as compared to the sequence of a native human antibody. Such amino acid exchanges can, for example, be caused by cloning procedures.
- the amino acid sequence of human antibodies is at least 85%, preferably 90%, more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to that of native human antibodies. More preferably, the amino acid sequence of human antibodies is at least 85%, preferably 90%, more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to that of native human antibodies which are specifically binding to the antigen or hapten of interest.
- the amino acid sequence of human antibodies is at least 85%, preferably 90%, more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to that of native human antibodies which are specifically binding influenza M2e antigen, wherein preferably said influenza M2e antigen is selected from any one of SEQ ID NOs 48 to 52, and wherein most preferably said influenza M2e antigen is SEQ ID NO:48.
- Preferred recombinant human antibodies differ from native human antibodies in at most 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid. Very preferably, differences in the amino acid sequence of recombinant human antibodies and native human antibodies are eliminated my means of molecular cloning, and thus, most preferably, the amino acid sequence of a recombinant human antibodies and native human antibodies are identical. Such antibodies are also referred to as “fully human antibodies”.
- An illustrative example how a fully human antibody may be obtained from a human antibody selected from a human antibody library is provided in Example 8. Typically and preferably, fully human antibodies are not immunogenic in humans.
- Preferred human antibodies comprise (a) least one, preferably one, HCVR, (b) at least one, preferably one, HCCR, (c) at least one, preferably one, LCVR, and (d) at least one, preferably one, LCCR, wherein said at least one HCVR, and/or said at least one HCCR, and/or said at least one LCVR, and/or said at least one LCCR are at least 85%, preferably 90%, more preferably 95%, still more preferably at least 96%, again still more preferably 97%, again still more preferably 98%, again still more preferably 99%, and most preferably 100% identical to the respective native human regions.
- the constant regions of immunoglobulins exist in various allotypes, i.e. that the amino acid sequence of said constant regions may differ to a certain extend between individuals of a population. Allotypes of the constant regions of human immunoglobulins are very well studied and the sequence information is readily available to the artisan from various sources, including the Immuno Genetics Information System. It is to be understood that different allotypes of the constant regions of one immunoglobulin are interchangeable for the purpose of the invention.
- the human gamma 1 heavy chain of a monoclonal antibody of the invention may comprise any existing allotype of a human gamma 1 HCCR.
- “monoclonal antibody” refers to an antibody population comprising only one single antibody species, i.e. antibodies having an identical amino acid sequence.
- CR constant region
- LCCR light chain constant region
- HCCR heavy chain constant region
- said CR comprises one to four immunoglobulin domains characterized by disulfide stabilized loop structures.
- Preferred CRs are CRs of immunoglobulins, preferably of human immunoglobulins, wherein further preferably said immunoglobulins, preferably said human immunoglobulins are selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM, and IgD.
- Very preferred CRs are human CRs comprising or consisting of an amino acid sequence available from public databases, including, for example the Immunogenetic Information System.
- LCCR light chain constant region
- the LCCR more specifically the kappa LCCR or the lambda LCCR, typically represents the C-terminal half of a native kappa or lambda light chain of an native antibody.
- a LCCR typically comprises about 110 amino acids representing one immunoglobulin domain.
- HCCR heavy chain constant region
- the constant region of a heavy chain comprises about three quarters or more of the heavy chain of an antibody and is situated at its C-terminus Typically, the HCCR comprises either three or four immunoglobulin domains.
- Preferred HCCRs are selected from gamma HCCR, alpha HCCR, epsilon HCCR, my HCCR, and delta HCCR.
- Very preferred are gamma HCCR, wherein preferably said gamma HCCR is selected from gamma 1 HCCR, gamma 2 HCCR, gamma 3 HCCR, and gamma 4 HCCR, wherein most preferably said gamma HCCR is a gamma 1 HCCR.
- variable region refers to the variable region or variable domain of an antibody, more specifically to the heavy chain variable region (HCVR) or to the light chain variable region (LCVR).
- a VR comprises a single immunoglobulin domain.
- Preferred VRs are VRs of immunoglobulins, preferably of human immunoglobulins, wherein further preferably said immunoglobulins, preferably said human immunoglobulins, are selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM, and IgD. VRs of various species are known in the art.
- Preferred VRs are human VRs, wherein the framework of said human VRs exhibit at least 80%, preferably at least 85%, more preferably 90%, again more preferably at least 95%, most preferably at least 99% sequence identity with the framework of any known human VR sequence.
- Preferred VRs are human VRs, wherein the framework of said human VRs exhibit at least 80%, preferably at least 85%, more preferably 90%, again more preferably at least 95%, most preferably at least 99% sequence identity with the framework of any human VR sequence available from public databases, most preferably with any human VR sequence available from the Immunogenetics Information System.
- Each VR comprises so called complementarity determining regions (CDRs) which are determining the binding characteristics of the antibody and which are embedded in the so called framework.
- CDRs complementarity determining regions
- a VR comprises the following elements in the following order from the N— to the C-terminus: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
- VRs comprise or preferably consist of a polypeptide, wherein said polypeptide is a product of a member of a family of V-gene segments in combination with further gene segments as, for example, D and J gene segments (HCVR) or J gene segments (LCDR).
- HCVR D and J gene segments
- LCDR J gene segments
- Light chain variable region (LCVR): Light chain variable regions are encoded by rearranged nucleic acid molecules and are either a kappa LCVR or a lambda LCVR. Human kappa LCVRs comprise a polypeptide, wherein said polypeptide is a product of a member of family 1 to 7 of human kappa V-gene segments.
- preferred kappa LCVRs are human kappa LCVRs, preferably human kappa LCVRs which are encoded by a DNA which can be amplified from human B cells using a primer combination of any one of the oligonucleotides disclosed as SEQ ID NO:49 to 52 of WO2008/055795A1 with any one oligonucleotide disclosed as SEQ ID NO:53 to 56 of WO2008/055795A1, and further preferably, PCR conditions described in Example 3 or of WO2008/055795A1.
- Human lambda LCVRs comprise a polypeptide, wherein said polypeptide is a product of a member of family 1 to 11 of human lambda V-gene segments.
- preferred lambda LCVRs are human lambda LCVRs, preferably human lambda LCVRs which are encoded by a DNA which can be amplified from human B cells using a primer combination of any one of SEQ ID NO:57 to 65 of WO2008/055795A1 with any one of SEQ ID NO:66 to 68 of WO2008/055795A1, and further preferably, PCR conditions described in Example 3 of WO2008/055795A1.
- LCVRs comprise three LC CDRs, preferably LC CDR1, LC CDR2, and LC CDR3, which are embedded into the light chain framework (LC FR 1-4).
- a LCVR comprises the following elements in the following order from the N- to the C-terminus: LC FR1-LC CDR1-LC FR2-LC CDR2-LC FR3-LC CDR3-LC FR4.
- “heavy chain variable region (HCVR)” Heavy chain variable regions are encoded by rearranged nucleic acid molecules.
- Human HCVRs comprise a polypeptide, wherein said polypeptide is a product of a member of family 1 to 7 of human lambda V-gene segments.
- preferred HCVRs are human HCVRs, preferably human HCVRs which are encoded by a DNA which can be amplified from human B cells using a primer combination of any one of SEQ ID NO:42 to 47 of WO2008/055795A1 with SEQ ID NO:48 of WO2008/055795A1 and, further preferably, PCR conditions described in Example 3 of WO2008/055795A1.
- HCVRs comprise three HC CDRs, preferably HC CDR1, HC CDR2, and HC CDR3, which are embedded into the heavy chain framework (HC FR 1-4).
- a HCVR comprises the following elements in the following order from the N- to the C-terminus: HC FR1-HC CDR1-HC FR2-HC CDR2-HC FR3-HC CDR3-HC FR4.
- CDR The complementarity determining region (CDR) 1, 2 and 3 of the HCVR and of the LCVR, respectively, of an antibody can be identified by methods generally known in the art. For the purpose of this application, CDR and FR boundaries are defined as set forth by Scavinger et al. 1999 (Exp Clin Immunogenet., Vol. 16 pp. 234-240), or by Lefranc et al. 2003 (Developmental and Comparative Immunology Vol. 27 pp. 55-77).
- antigen refers to a molecule which is bound by an antibody.
- An antigen is recognized by the immune system and/or by a humoral immune response and can have one or more epitopes, preferably B-cell epitopes, or antigenic determinants.
- extracellular domain of the influenza A virus M2 protein refers to the N-terminal extracellular domain of the M2 protein of influenza A virus, or to any consecutive stretch of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23, amino acids thereof.
- extracellular domain of the influenza A virus M2 protein refers to amino acid residues 2 to 24 of the influenza A virus M2 protein, or to any consecutive stretch of at least of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids thereof.
- the extracellular domain of the influenza A virus M2 protein comprises or consists of a peptide selected from any one of SEQ ID NOs 48 to 83 and 90 to 92, or to any consecutive stretch of at least of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids thereof.
- the extracellular domain of the influenza A virus M2 protein comprises or consists of a peptide selected from any one of SEQ ID NOs 48 to 50.
- the extracellular domain of the influenza A virus M2 protein is the M2e consensus sequence (SEQ ID NO:48).
- influenza M2e antigen refers to an antigen comprising at least one epitope of the extracellular domain of the influenza A virus M2 protein.
- influenza M2e antigen refers to an antigen comprising at least one epitope of any one of the peptides of SEQ ID NOs 48 to 83 and 90 to 92. More preferably, the term influenza M2e antigen refers to an antigen comprising or consisting of the extracellular domain of the influenza A M2 protein.
- influenza M2e antigen refers to an antigen comprising or consisting of the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, or to any consecutive stretch of at least of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids thereof.
- influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 50.
- said influenza M2e antigen comprises or preferably consists of the M2e consensus sequence (SEQ ID NO:48).
- influenza M2e antigen also includes conjugates, fusion or coupling products comprising at least one epitope of the extracellular domain of the influenza A virus M2 protein. This includes conjugates of the extracellular domain of the influenza A virus M2 protein with a carrier, wherein preferably said carrier is RNAse A.
- influenza M2e antigen also includes virus-like particles, preferably virus like particles of RNA bacteriophages, wherein an extracellular domain of the influenza A virus M2 protein is coupled to said virus like particle, preferably to said virus-like particle of a RNA bacteriophage.
- Preferred virus-like particles are virus-like particles of RNA bacteriophages Q ⁇ or AP205, most preferably of RNA bacteriophage Q ⁇ .
- a very preferred influenza M2e antigen is a virus-like particle of RNA bacteriophage Q ⁇ , wherein the peptide of SEQ ID NO:48 is coupled to said virus-like particle, wherein preferably said peptide is coupled to said virus-like particle by means of a covalent non-peptide bond.
- influenza M2e antigen also includes fusion proteins comprising the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof.
- influenza M2e antigen includes fusion proteins comprising a peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92.
- Preferred fusion proteins are chimeric proteins, wherein said chimeric proteins comprise an extracellular domain of a first influenza A virus M2 protein and the transmembrane- and intercellular domain of a second influenza A virus M2 protein.
- a very preferred chimeric protein is the protein of SEQ ID NO:85.
- influenza M2e antigen includes virus particles or virus-like particles comprising the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof.
- influenza M2e antigen also refers to influenza virus particles or influenza virus-like particles, preferably to influenza A virus particles or influenza A virus-like particles.
- influenza M2e antigen refers to cells, preferably to eukaryotic cells, comprising the extracellular domain of the influenza A virus M2 protein on their cell surface.
- Preferred recombinant proteins in this context are influenza A M2 proteins or chimeric proteins, wherein said chimeric proteins comprise an extracellular domain of a first influenza A virus M2 protein and the transmembrane- and intercellular domain of a second influenza A virus M2 protein.
- said recombinant protein is the protein of any one of SEQ ID NOs 84 or 85, preferably SEQ ID NO:84, wherein further preferably the N-terminal methionine residue of said recombinant proteins is cleaved off.
- influenza M2e antigen refers to a eukaryotic cell, preferably to a L929 cell or to a 293T cell, wherein said cell is expressing a recombinant protein, wherein said protein comprises the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof, and wherein preferably said recombinant protein comprises a domain which allows the integration of said recombinant protein into the cell membrane.
- Preferred recombinant proteins in this context are influenza A M2 proteins or chimeric proteins, wherein said chimeric proteins comprise an extracellular domain of a first influenza A virus M2 protein and the transmembrane- and intercellular domain of a second influenza A virus M2 protein.
- said recombinant protein is the protein of any one of SEQ ID NOs 84 or 85, wherein further preferably the N-terminal methionine residue of said recombinant proteins is cleaved off.
- affinity The specificity of an antibody relates to the antibody's capability of specifically binding an antigen.
- affinity The specificity of this interaction between the antibody and the antigen (affinity) is characterized by a binding constant or, inversely, by a dissociation constant (Kd).
- Kd dissociation constant
- Kd of a given combination of antibody and antigen is determined by Friguet ELISA essentially as described (Friguet B. et al., 1985, J. Immunol. Meth. 77, 305-319), wherein a constant amount of purified antibody, for example scFv or Fab fragment, is contacted with a serial dilution of a known concentration of antigen.
- Kd of an antibody and an antigen in solution is determined by Friguet ELISA, wherein preferably said antibody is an scFv antibody, most preferably a scFv-msFc ⁇ 2c fusion, and wherein further preferably said antigen is an influenza M2e antigen, and wherein still more preferably said influenza M2e antigen comprises or consists of the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, most preferably of the peptide of SEQ ID NO:48.
- said influenza M2e antigen is a conjugate of RNAse-A and of the peptide of SEQ ID NO:48.
- Friguet-ELISA is performed under conditions essentially as described in Example 11 herein. In a very preferred embodiment said Friguet-ELISA is performed under conditions essentially as described in Example 11, wherein said influenza M2e antigen is in solution, and wherein said influenza M2e antigen is SEQ ID NO:48.
- the affinity of a given combination of antibody and antigen may also be determined by ELISA, wherein a constant amount of immobilized antigen is contacted with a serial dilution of a known concentration of a purified antibody, preferably a scFv or Fab fragment. The affinity is then determined as the concentration of the antibody where half-maximal binding is observed (EC50).
- EC50 of an antibody and an immobilized antigen is determined by ELISA, wherein preferably said antibody is an scFv antibody, most preferably a scFv-msFc ⁇ 2c fusion, and wherein further preferably said antigen is an influenza M2e antigen, wherein preferably said influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 83, most preferably of the peptide of SEQ ID NO:48. Most preferably, said influenza M2e antigen is a conjugate of RNAse-A and of the peptide of SEQ ID NO:48.
- said ELISA is performed as described in the first paragraph of Example 4 herein.
- Kd of an interaction of an antibody and an antigen is determined by Biacore analysis as the ratio of on rate (k on ) and off rate (k off ). Kd may also be determined by equilibrium dialysis.
- Very preferred are antibodies capable of binding an antigen with a Kd of less than 20 pM, wherein further preferably said Kd is determined in solution.
- antibodies capable of binding an antigen with a EC50 of less than 100 pM, wherein further preferably said EC50 is determined with immobilized antigen.
- Kd and/or EC50 values are referred to as being in the “low picomolar range” when these values are below 100 pM.
- the affinity of an antibody to influenza M2e antigen may also be determined in an experimental set-up, wherein said influenza M2e antigen is a cell, typically and preferably a living cell, and wherein said cell comprises the extracellular domain of the influenza A virus M2 protein or an epitope thereof on the cell surface.
- the affinity of an antibody to a cell is preferably determined by FACS technology, preferably in an experimental set-up essentially as disclosed in Examples 5 and 9 herein. It is to be understood that the EC50 values for a specific combination of antibody and cells are comparable only within the same experimental set-up relative to a control antibody.
- An antibody is regarded as specifically binding an influenza M2e antigen, wherein said influenza M2e antigen is a cell, when the EC50 value for the interaction between a control antibody and said influenza M2e antigen is at least 10 3 -fold, preferably at least 10 4 -fold, more preferably at least 10 5 -fold, and most preferably at least 10 6 -fold higher than the EC50 value for the interaction between said antibody and said influenza M2e antigen.
- an “effective amount” A therapeutically effective amount of a monoclonal antibody of the invention or of a pharmaceutical composition of the invention generally refers to an amount necessary to achieve, at dosages and periods of time necessary, the desired therapeutic result, wherein preferably said result is preventing, reducing or ameliorating infection with influenza virus, preferably with influenza A virus.
- an “effective amount” typically refers to an amount of 1 mg to 1000 mg, preferably 10 mg to 500 mg, more preferably 10 mg to 300 mg, still more preferably 50 mg to 200 mg, and most preferably about 100 mg of said monoclonal antibody.
- Tag The term tag, preferably a purification or detection tag, refers to a polypeptide segment that can be attached to a second polypeptide to provide for purification or detection of the second polypeptide or provides sites for attachment of the second polypeptide to a substrate.
- any peptide or protein for which an antibody or other specific binding agent is available can be used as an affinity tag.
- Tags include haemagglutinin tag, myc tag, poly-histidine tag, protein A, glutathione S transferase, Glu-Glu affinity tag, substance P, FLAG peptide, streptavidin binding peptide, or other antigenic epitope or binding domain (mostly taken from U.S. Pat. No. 6,686,168).
- a library-based screening method for the identification, isolation and cloning of scFv specifically binding an antigen of interest is disclosed in WO2008/055795A1.
- said method allows for the identification, isolation and cloning of human scFv and for the subsequent generation of fully human antibodies, including Fab fragments and whole IgG.
- human monoclonal antibodies specifically binding influenza M2e antigen have been identified and cloned.
- the invention provides a monoclonal antibody, preferably an isolated monoclonal antibody, specifically binding influenza M2e antigen, wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody.
- said monoclonal antibody is a recombinant monoclonal antibody.
- said human monoclonal antibody preferably said fully human monoclonal antibody, is not recognized by the human immune system.
- the specificity of an antibody is mainly determined by the amino acid sequence of the complementarity determining regions (CDRs) in the heavy chain variable regions (HCVR) of said antibody and/or by the CDRs in the light chain variable regions said antibody (LCVR).
- CDRs complementarity determining regions
- HCVRs complementarity determining regions
- LC CDRs LC CDRs of monoclonal antibodies, wherein said monoclonal antibodies are capable of specifically binding influenza A M2, and wherein typically and preferably said HCVRs and said LCVRs are forming an antigen binding site.
- the monoclonal antibodies of the invention which are capable of specifically binding influenza M2e antigen share identical or closely related HC CDRs and/or LC CDRs in different combinations, wherein the closely related HC CDRs and/or LC CDRs differ in at most a few amino acid residues (cf. Tables 1-3). It is therefore concluded that all antibodies of Tables 1-3 are clonally related.
- said monoclonal antibody comprises (i) at least one, preferably exactly one, LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6, and wherein preferably said LC CDR1 is located at CDR1 position within the framework of said LCVR; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7, and wherein preferably said LC CDR2 is located at CDR2 position within the framework of said LCVR; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11, and wherein preferably said LC CDR3 is located at CDR3 position within the framework of said LCVR; and/or said monoclonal comprises (ii) at least one, preferably exactly one HCVR, wherein said
- said monoclonal antibody comprises (i) at least one, preferably exactly one, LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11; and wherein said monoclonal comprises (ii) at least one, preferably exactly one HCVR, wherein said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one
- said monoclonal antibody comprises exactly one LCVR and exactly one HCVR, which are preferably forming an antigen binding site.
- said monoclonal antibody comprises exactly two LCVR and exactly two HCVR.
- the antibody of the invention may also comprise or alternatively consist of only one LCVR or of only one HCVR.
- said monoclonal antibody comprises or alternatively consists of at least one, preferably exactly one, LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11.
- said monoclonal antibody comprises or alternatively consists of at least one, preferably exactly one HCVR, wherein said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
- the antibodies of the invention comprise at least on antigen binding site comprising one LCVR and one HCVR, wherein said antigen binding site recognizes an epitope of influenza A M2e antigen.
- One aspect of the invention therefore is an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein preferably said monoclonal antibody is a human monoclonal antibody, more preferably a fully human monoclonal antibody, and wherein said antibody comprises at least one antigen binding site, wherein said antigen binding site comprises: (a) one LCVR, wherein said LCVR comprises: (i) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (ii) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; and (iii) one LC CDR3, wherein said LC CDR3 consists of
- said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, and 3; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9 and 10; and wherein preferably said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3, wherein said HC CDR
- LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 4 and 5; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of SEQ ID NO:8; and wherein preferably said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
- said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1 and 6; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of SEQ ID NO:8 and 11; and wherein preferably said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
- said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (b) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:2, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (c) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:
- said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (b) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:4, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; and (c) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:
- said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8.
- Antibodies obtained from library screening may differ from fully human antibodies in certain amino acid positions of the VRs due to cloning artifacts, wherein typically these positions are located near the N- and/or C-terminus of the variable region.
- these artifacts are removed from the antibody in order to obtain fully human antibodies.
- position 1 to 4 of the LCVRs is replaced by SEQ ID NO:24.
- position 1 to 4 of said LCVR consists of SEQ ID NO:24.
- said LCVR comprises or preferably consists of any one of the amino acid sequences depicted in FIG. 1 .
- position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24.
- position 5 to 113 of said LCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of any one of SEQ ID NOs 86, 87, and 88, wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24.
- said HCVR is selected from: (a) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:15; (b) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:16; (c) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ
- said HCVR is selected from: (a) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:15;
- position 1 to 6 of the HCVRs is replaced by SEQ ID NO:25.
- position 1 to 6 of said HCVR consists of SEQ ID NO:25.
- said HCVR comprises or preferably consists of any one of the amino acid sequences depicted in FIG. 2 .
- position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, wherein preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- position 7 to 121 of said HCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of SEQ ID NO:89, wherein preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- said monoclonal antibody comprises at least one, preferably exactly one antigen binding site, wherein the combination of LC CDRs and HC CDRs is selected from any one of the combinations of Table 3.
- Preferably said combination is chosen from one of the most abundant combinations 1A-1A, 1A-1B, 2A-1A, and 3A-1A.
- said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 4 and 6
- said LC CDR2 consists of the peptide of SEQ ID NO:7
- said LC CDR3 consists of the peptide of SEQ ID NO:8
- said HC CDR1 consists of the peptide of SEQ ID NO:12
- said HC CDR2 consists of the peptide of SEQ ID NO:13
- said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15 and 16.
- said LC CDR1 consists of the peptide of SEQ ID NO:1
- said LC CDR2 consists of the peptide of SEQ ID NO:7
- said LC CDR3 consists of the peptide of SEQ ID NO:8
- said HC CDR1 consists of the peptide of SEQ ID NO:12
- said HC CDR2 consists of the peptide of SEQ ID NO:13
- said HC CDR3 consists of the peptide of SEQ ID NO:15.
- said LC CDR1 consists of the peptide of SEQ ID NO:1
- said LC CDR2 consists of the peptide of SEQ ID NO:7
- said LC CDR3 consists of the peptide of SEQ ID NO:8
- said HC CDR1 consists of the peptide of SEQ ID NO:12
- said HC CDR2 consists of the peptide of SEQ ID NO:13
- said HC CDR3 consists of the peptide of SEQ ID NO:16.
- said LC CDR1 consists of the peptide of SEQ ID NO:4, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- said LC CDR1 consists of the peptide of SEQ ID NO:6, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- said LCVR comprises a peptide, wherein said peptide consists of any one of the amino acid sequences depicted in FIG. 1 ; and said HCVR comprises a peptide, wherein said peptide consists of any one of the amino acid sequences depicted in FIG. 2 .
- LCVR comprises a peptide, wherein said peptide consists of any one of the amino acid sequences depicted in FIG. 1 ; and said HCVR comprises a peptide, wherein said peptide consists the amino acid sequence depicted in FIG. 2 , wherein said amino acid sequence depicted in FIG. 2 has the same designator as the amino acid sequence depicted in FIG. 1 .
- the designator is a character followed by three digits (e.g. D005).
- said antigen binding site comprises one LCVR and one HCVR, (a) wherein position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- said antigen binding site comprises one LCVR and one HCVR, (a) wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:20, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- said antigen binding site comprises one LCVR and one HCVR, (a) wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:21, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- said antigen binding site comprises one LCVR and one HCVR, (a) wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:22, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- said antigen binding site comprises one LCVR and one HCVR, (a) wherein position 5 to 113 of said LCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of any one of SEQ ID NOs 86, 87 and 88, and (b) wherein position 7 to 121 of said HCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of SEQ ID NO:89, and wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- position 5 to 113 of said LCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to the peptide of any one of SEQ ID NOs 20, 21, and 22, preferably to the peptide of SEQ ID NO:24; and position 7 to 121 of said HCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to the peptide of SEQ ID NO:23.
- said LCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to any one of the amino acid sequences depicted in FIG. 1 ; and said HCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to any one of the amino acid sequences depicted in FIG. 2 .
- said LCVR is at least 95%, preferably at least 96%, more preferably 97%, still more preferably 98%, still more preferably 99%, and most preferably 100% identical to any one of the amino acid sequences depicted in FIG. 1 ; and wherein said HCVR is at least 95%, preferably at least 96%, more preferably 97%, still more preferably 98%, still more preferably 99%, and most preferably 100% identical to any one of the amino acid sequences depicted in FIG. 2 .
- the differences in the amino acid sequences referred to above are located outside of the CDR positions of said LCVR and/or of said HCVR. Whether the amino acid sequence of a peptide or polypeptide has an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to another, can be determined conventionally using known computer programs such the Bestfit program.
- a monoclonal antibody of the invention can be recombinantly produced in any naturally occurring or synthetic format. The following embodiments thus explicitly refer to all aspects and embodiments of the invention.
- said monoclonal antibody is a recombinant antibody.
- the monoclonal antibody of the invention is an antibody selected from the group consisting of: (a) single chain antibody, preferably scFv; (b) Fab fragment; (c) F(ab′)2 fragment; (d) scFv-Fc fusion; (e) IgG1; (f) IgG2; (g) IgG3; (h) IgG4; (i) IgA; (j) IgE; (k) IgM; (l) IgD; and (m) diabody.
- said monoclonal antibody comprises or preferably consists of exactly one LCVR and/or of exactly one HCVR.
- said monoclonal antibody is a single chain antibody, wherein preferably said single chain antibody is an scFv.
- said single chain antibody comprises or preferably consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of any one of SEQ ID NOs 38 to 40.
- said single chain antibody is an Fc-fusion, preferably a Fc ⁇ 2c fusion, wherein further preferably said Fc ⁇ 2c fusion comprises or preferably consists of the a peptide, wherein said peptide is encoded by any one of SEQ ID NOs 42, 44, and 46.
- said single chain antibody comprises the peptide of any one of SEQ ID NOs 43, 45, and 47.
- said monoclonal antibody is an IgG, preferably a human IgG. In a further preferred embodiment said monoclonal antibody is a IgG1, preferably a human IgG1. In a further preferred embodiment said monoclonal antibody comprises at least one, preferably exactly two, kappa LC(s), wherein preferably said kappa LC(s) comprise(s) or more preferably consist(s) of a peptide, wherein said peptide is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to any one of SEQ ID NOs 26 to 28.
- said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or preferably consist(s) of the peptide of any one of SEQ ID NOs 26 to 28.
- said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein preferably said gamma 1 HC(s) comprise(s) or more preferably consist(s) of a peptide, wherein said peptide is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to SEQ ID NO:29.
- said gamma 1 HC(s) comprise(s) or preferably consist(s) of the peptide of SEQ ID NO:29.
- said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of a peptide of any one of SEQ ID NOs 26 to 28, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:26, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:27, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:28, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- the monoclonal antibody of the invention is an IgG1, preferably a human IgG1, most preferably a fully human IgG1.
- said monoclonal antibody comprises two, preferably exactly two, of said gamma 1 HCs, wherein further preferably said two, preferably said exactly two of said gamma 1 HCs are identical.
- said monoclonal antibody comprises two, preferably exactly two LCs, wherein preferably said LCs are selected from (a) lambda LC; and (b) kappa LC, most preferably kappa LC; wherein still further preferably said two, preferably said exactly two of said LCs are identical.
- said monoclonal antibody preferably said isolated monoclonal antibody, is specifically binding influenza M2e antigen, wherein said influenza M2e antigen comprises or consists of at least one epitope of the extracellular domain of the influenza A M2 protein.
- said influenza M2e antigen comprises or consists of the extracellular domain of the influenza A M2 protein, preferably of amino acids 2 to 24 of the influenza A M2 protein.
- said influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, wherein preferably said influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 50, and wherein most preferably said influenza M2e antigen comprises or preferably consists of the peptide of SEQ ID NO:48.
- said influenza M2e antigen comprises or consists of at least one epitope of SEQ ID NO:48, preferably said influenza M2e antigen comprises or consists of an epitope comprised by the amino acid sequence of SEQ ID NO:93.
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 100 nM, preferably at most 10 nM, more preferably at most 6 nM and most preferably at most 5 nM, wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11.
- Kd dissociation constant
- said monoclonal antibody is specifically binding influenza M2e antigen
- the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM
- further preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution
- still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11.
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 0.01 pM to 1000 nM, preferably 0.1 pM to 100 nM, more preferably 0.1 pM to 10 nM, still more preferably 0.1 pM to 1 nM, still more preferably 0.1 pM to 100 pM, still more preferably 0.1 pM to 50 pM, still more preferably 0.1 pM to 20 pM, still more preferably 0.1 pM to 15 pM, still more preferably 1 pM to 15 pM, and most preferably 1 pM to 10 pM, wherein preferably said influenza M2e antigen is an RNAse conjugate of the extracellular domain of influenza A M2 protein, most preferably in solution, wherein further preferably said influenza M2e antigen comprises the peptide of any one of SEQ ID NOs 48 to
- the said monoclonal antibody is specifically binding influenza M2e antigen, wherein said influenza M2e antigen is a cell comprising at least one epitope of the extracellular domain of influenza A M2 protein on its cell surface.
- the said monoclonal antibody is specifically binding influenza M2e antigen, wherein said influenza M2e antigen is a cell comprising the extracellular domain of influenza A M2 protein on its cell surface.
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein further preferably said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 4 and 6, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:1, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptid
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22.
- Kd dissociation constant
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- Kd dissociation constant
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- Kd dissociation constant
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- Kd dissociation constant
- said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of a peptide of any one of SEQ ID NOs 26 to 28, preferably SEQ ID NO:
- An epitope mapping revealed that the minimal epitope which is recognized by an antibody of the invention is comprised in the amino acid sequence LLTEVETP (SEQ ID NO:93) of the M2e consensus sequence (SEQ ID NO:48). It has been shown that an antibody of the invention is capable of recognizing variants of this epitope occurring in M2e of other influenza A genotypes (see FIG. 8A ).
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:1, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- said LC CDR1 consists of the peptide of SEQ ID NO:1
- said LC CDR2 consists of the peptide of SEQ ID NO:7
- said LC CDR3 consists of the peptide of SEQ ID NO:8
- said HC CDR1 consists of the peptide of SEQ ID NO:12
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:26, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:4, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- said LC CDR1 consists of the peptide of SEQ ID NO:4
- said LC CDR2 consists of the peptide of SEQ ID NO:7
- said LC CDR3 consists of the peptide of SEQ ID NO:8
- said HC CDR1 consists of the peptide of SEQ ID NO:12
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:21, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:27, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:6, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- said LC CDR1 consists of the peptide of SEQ ID NO:6
- said LC CDR2 consists of the peptide of SEQ ID NO:7
- said LC CDR3 consists of the peptide of SEQ ID NO:8
- said HC CDR1 consists of the peptide of SEQ ID NO:12
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:22, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:28, and wherein said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- said monoclonal antibody comprises at least one, preferably exactly two, gamma 1 HC(s), wherein said gamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29.
- a HCVR of a first antibody specifically binding influenza M2e antigen to select a corresponding LCVR from a suitable source, and to create a second antibody, wherein said second antibody comprises said HCVR of said first antibody and the selected LCVR, and wherein said second antibody is capable of binding influenza A Me2 antigen with about the same specificity as said first antibody (“chain shuffling”).
- chain shuffling it is furthermore apparent for the artisan that in an analogous manner the LCVR of a first antibody can be used to select a corresponding HCVR from a suitable source.
- Suitable sources for the amplification of LCVRs and/or HCVRs are, for example, cDNA from naive human B cells, cDNA from B cells of a human subject immunized with an influenza M2e antigen, and fully synthetic libraries, such as Morphosys' HuCAL library. These methods are described in detail in Kang A S et al. (Proc Natl Acad Sci USA 88, 11120-11123, 1991), Marks J D et al. (Biotechnology (N Y) 10, 779-783, 1992), and Jespers et al. (Biotechnology (NY) 12, 899-903, 1994).
- a further aspect of the invention is a LCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, most preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11.
- said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (b) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:2, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (c) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:3, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR
- position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, most preferably SEQ ID NO:20, wherein preferably position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24.
- a further aspect of the invention is a HCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said HCVR comprises: one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
- said HCVR comprises: one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NO:13; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of SEQ ID NO:15.
- position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, wherein preferably position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25.
- said monoclonal antibody comprises at least one antigen binding site, wherein said antigen binding site comprises: (a) one LCVR, wherein said LCVR comprises: (i) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 4, and 6, preferably SEQ ID NO:1; (ii) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; and (iii) one LC CDR3, wherein said LC CDR3 consists of the peptide of SEQ ID NO:8; and (b) one HCVR, wherein said HCVR comprises: (i) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (ii) one HC CDR2, wherein said HC CDR2 consists of the peptide of SEQ ID NO:13; and (iii) one HC
- position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, preferably of SEQ ID NO:20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- said monoclonal antibody is an IgG1
- said monoclonal antibody comprises at least one light chain
- said monoclonal antibody further comprises at least one heavy chain
- said light chain comprises or preferably consists of the amino acid sequence of any one of SEQ ID NOs 26, 27, and 28, preferably of SEQ ID NO:26
- said heavy chain comprises or preferably consists of the amino acid of SEQ ID NO:29.
- the invention relates a nucleic acid molecule encoding a HCVR or a LCVR of the invention, a monoclonal antibody of the invention or an individual chain thereof.
- said nucleic acid molecule is encoding a peptide selected from (a) a LCVR of the invention, wherein preferably said LCVR comprises or preferably consists of any one of the peptides depicted in FIG.
- LCVR comprises or preferably consists of the peptide of any one of SEQ ID NOs 20, 21, and 22;
- a HCVR of the invention wherein preferably said HCVR comprises or preferably consists of any one of the peptides depicted in FIG.
- a HCVR wherein said HCVR comprises or preferably consists of the peptide of SEQ ID NO:23;
- a single chain antibody of the invention wherein preferably said single chain antibody comprises or preferably consists of the peptide of any one of SEQ ID NOs 43, 45 and 47;
- a kappa LC of the invention wherein preferably said kappa LC comprises or preferably consists of the peptide of any one of SEQ ID NOs 26, 27, and 28;
- a gamma 1 HC of the invention wherein preferably said gamma 1 HC comprises or preferably consists of the peptide of SEQ ID NO:29; and
- a monoclonal antibody of the invention a monoclonal antibody of the invention.
- nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 86 to 89. In a further preferred embodiment said nucleic acid molecule comprises the nucleotide sequence of any one of SEQ ID NOs 86 to 88, and wherein said nucleic acid molecule further comprises the nucleotide sequence of SEQ ID NO:89.
- nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 30, 32, 34, and 36. In a further preferred embodiment said nucleic acid molecule comprises the nucleotide sequence of any one of SEQ ID NOs 32, 34, and 36, and wherein said nucleic acid molecule further comprises the nucleotide sequence of SEQ ID NO:30.
- said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 38, 39, and 40.
- said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of SEQ ID NO:41.
- nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 42, 44, and 46. In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 42, 44, and 46.
- the invention relates to an expression vector for the recombinant expression of an antibody of the invention.
- said expression vector comprises at least one nucleic acid molecule of the invention.
- Expression vectors suitable for the expression of the monoclonal antibodies of the invention are disclosed, for example, in WO2008/055795A1.
- said expression vector comprises the nucleotide sequence of any one of SEQ ID NOs 86 to 89.
- said expression vector comprises the nucleotide sequence of any one of SEQ ID NOs 86 to 88, wherein preferably said expression vector further comprises the nucleotide sequence of SEQ ID NO:89.
- said expression vector comprises the nucleotide sequence of SEQ ID NO:41.
- the invention relates to a host cell comprising at least one nucleic acid molecule or at least one expression vector of the invention, wherein preferably said host cell is a bacteria cell or an eukaryotic cell.
- said host cell is a eukaryotic cell selected from (a) yeast cell, (b) insect cell; and (c) mammalian cell, wherein preferably said mammalian cell is selected from HEK-293T cell, CHO cell, and COS cell.
- said mammalian cells is a HEK-293T cell.
- the invention relates to the monoclonal antibody of the invention for use as a pharmaceutical.
- the monoclonal antibody of the invention can be incorporated into compositions suitable for administration to a subject.
- the invention relates to a pharmaceutical composition comprising at least one monoclonal antibody of the invention, wherein preferably said pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent or excipient.
- a pharmaceutically acceptable carrier, diluents and excipients are disclosed, for example, in Remington, The Science and Practice of Pharmacy, 19 th edition, Gennaro (ed.), Mack publishing Co., Easton, Pa., 1995.
- Pharmaceutical compositions of the invention are administered in a single dose or in multiple doses.
- said pharmaceutical composition further comprises at least one further antibody, wherein preferably said at least one further antibody is specifically binding an influenza antigen, preferably an influenza M2e antigen.
- said pharmaceutical composition further comprises at least one further antibody, wherein preferably said at least one further antibody is specifically binding an influenza antigen, wherein said influenza antigen is an antigen of influenza A virus HA protein or an antigen of influenza A virus NA protein.
- the monoclonal antibodies of the invention may be used in passive immunization, preferably of humans, and further preferably against influenza A virus.
- the monoclonal antibodies of the invention are therefore useful in the treatment and/or prophylaxis of influenza A infection.
- the invention relates to a method of passive immunization, preferably against influenza A virus, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention.
- the monoclonal antibody and/or the pharmaceutical composition of the invention are preferably administered to a subject, preferably to a human, using standard administration techniques, preferably selected from oral administration, intravenous administration, intraperitoneal administration, subcutaneous administration, pulmonary administration, transdermal administration, intramuscular administration, intranasal administration, buccal administration, sublingual administration, and suppository administration.
- the invention relates to a method of treating influenza A virus infection, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said subject is a human, and wherein further preferably said subject suffers from influenza A virus infection.
- the invention relates to a method of preventing influenza A virus infection, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said subject is a human, and wherein further preferably said subject is not infected with influenza A virus.
- the invention relates to the monoclonal antibody of the invention or to the pharmaceutical composition of the invention, for use in passive immunization, preferably against influenza A virus, preferably in a human, wherein further preferably said monoclonal antibody is to be administered to said human.
- the invention relates to the monoclonal antibody of the invention or to the pharmaceutical composition of the invention, for use in a method of treatment and/or prophylaxis of influenza A virus infection, preferably in a human.
- the invention relates to the use of the monoclonal antibody of the invention in the manufacture of a medicament for passive immunization, preferably against influenza A virus.
- the invention relates to a monoclonal antibody of the invention for use in passive immunization, preferably against influenza A virus.
- the invention relates to the use of the monoclonal antibody of the invention in the manufacture of a medicament for the treatment and/or prophylaxis of influenza A virus infection, preferably in a human.
- the invention relates to a monoclonal antibody of the invention for use in a method of treating or preventing influenza A virus infection, preferably in a human.
- a further aspect of the invention is the use of an antibody of the invention in a method of quantitative and/or qualitative detection of influenza A virus M2 protein, preferably in a blood sample and most preferably by ELISA.
- PBMC Peripheral blood mononuclear cells
- Table 7 coupled to Q ⁇ (2.4 ⁇ g/ml) in combination with a Alexa 488 nm-labeled Q ⁇ -specific mouse mAb (2 ⁇ g/ml), as well as a M2-specific mouse mAb (0.5 ⁇ g/ml) in combination with FITC-labeled donkey anti-mouse IgG antibody (1 ⁇ g/ml; Jackson ImmunoResearch); (2) PE-labeled mouse anti-human IgM (diluted 1:50; BD Biosciences/Pharmingen), mouse anti-human IgD (diluted 1:100; BD Biosciences/Pharmingen), mouse anti-human CD14 (diluted 1:50; BD Biosciences/Pharmingen), and mouse anti-human CD3 (diluted 1:50; BD Biosciences/Pharmingen) antibodies; and (3) PE-TexasRed-labeled mouse anti-human CD19 antibody (diluted 1:50; Caltag Laboratories).
- 334 M2e-specific B cells (FL1-positive, FL2-negative, FL3-positive, FL4-negative) were sorted on a FACSVantage® SE flow cytometer (Becton Dickinson).
- Antigen-specific B cells were used for the construction of a Sindbis-based scFv cell surface display library essentially as described (see WO 1999/025876 A1 for Sindbis-based screening in general and WO 2008/055795 A1 for its application in antibody screening, the entirety of which is incorporated herein by reference).
- M2e-specific scFv antibodies were isolated using M2e coupled to RNase A (5 ⁇ g/ml) in combination with an RNase-specific rabbit polyclonal antibody (2.5 ⁇ g/ml; Abcam) and a FITC-labeled donkey anti-rabbit IgG antibody (1.5 ⁇ g/ml; Jackson ImmunoResearch) or using (Q ⁇ -M2e (1 ⁇ g/ml) in combination with a M2-specific mouse mAb (0.5 ⁇ g/ml) and FITC-labeled donkey anti-mouse IgG antibody (1 ⁇ g/ml; Jackson ImmunoResearch). Each cell was sorted into a well of a 24-well plate containing 50% confluent BHK feeder cells. Upon virus spread (2 days post sorting), the infected cells were tested by FACS analysis for M2e-binding to identify virus clones encoding M2e-specific scFv antibodies.
- each of the clones was transfected into HEK-293T cells in a 24-well plate format, using Lipofectamine 2000 (Invitrogen) according to the manufacturer's recommendations. 2-3 days post transfection, supernatants containing transiently expressed scFv-Fc fusion proteins were harvested. To check for M2e-specific binding, ELISA plates were coated with M2e-conjugated RNAse A at a concentration of 4 ⁇ g/ml in phosphate-buffered saline (PBS) over night at 4° C. In parallel, scFv-Fc expression levels were monitored in by sandwich ELISA.
- PBS phosphate-buffered saline
- Bound scFv-Fc fusion proteins were then detected by a 1 h incubation with a HRPO-labeled, Fc ⁇ -specific, goat anti-human IgG antibody (Jackson ImmunoResearch Laboratories 109-035-098). After extensive washing with wash buffer, plates were developed with OPD solution (1 OPD tablet, 25 ml OPD buffer and 8 ⁇ l 30% H 2 O 2 ) for 5 to 10 min and the reaction was stopped with 5% H 2 SO 4 solution. Plates were then read at OD 450 nm on an ELISA reader (Biorad Benchmark).
- the clones D005, E040 and F052 represent three of most abundant combinations of LCVR and HCVR (1A-1A, 2A-1A, and 3A-1A, cf. Table 3) and were thus chosen as representative clones for further analysis.
- clones D005, E040 and F052 were expressed and purified as scFv-mouse Fc- ⁇ 2c (msFc ⁇ 2c) fusion proteins.
- the nucleotide sequences encoding the D005, E040 and F052 scFv-mouse Fc- ⁇ 2c (msFc ⁇ 2c) fusion proteins correspond to SEQ ID NOs:42, 44 and 46, respectively.
- the amino acid sequences of the D005, E040 and F052 scFv-mouse Fc- ⁇ 2c (msFc ⁇ 2c) fusion proteins correspond to SEQ ID NOs: 43, 45 and 47, respectively.
- the corresponding scFv coding regions were excised from the pCEP-SP-Sfi-Fc expression vectors with the restriction endonuclease Sfi1 and the resulting fragments were cloned into the expression vector pCEP-SP-Sfi-msFc ⁇ 2c (SEQ ID NO:41).
- the Sfi-digested fragments of monoclonal antibodies D005, E042, and F052 correspond to SEQ ID NOs 38, 39 and 40, respectively. These Sfi-fragments encode the entire scFv fragment of the corresponding antibody, including the linker sequence, but do not include the Fc domain.
- scFv-msFc ⁇ 2c fusion proteins were done in HEK-293T cells.
- 10 7 293T cells were plated onto a 14 cm tissue culture plate for each protein to be expressed.
- Cells were then transfected with the respective scFv-msFc ⁇ 2c fusion construct using Lipofectamine Plus (Invitrogen) according to the manufacturer's recommendations, incubated one day, and replated on three 14 cm dishes in the presence of 1 ⁇ g/ml puromycin. After three days of selection, puromycin-resistant cells were transferred to six 14 cm plates and grown to confluency. Finally, cells were transferred to a poly-L-lysine coated roller bottle.
- the consecutive harvests were pooled and applied to a protein A-sepharose column.
- the column was washed with 10 column volumes of phosphate-buffered saline (PBS), and bound protein eluted with 0.1 M Glycine pH 3.6. 1 ml fractions were collected in tubes containing 0.1 ml of 1 M Tris pH 7.5 for neutralization. Protein-containing fractions were analyzed by SDS-PAGE and pooled.
- the buffer was exchanged with PBS by dialysis using 10,000 MWCO Slide-A-Lyzer dialysis cassettes (Pierce).
- the purified proteins in PBS were then filtered through 0.22 ⁇ m Millex GV sterile filters (Millipore) and aliquotted. Working stocks were kept at 4° C., whereas aliquots for long-term storage were flash-frozen in liquid nitrogen and kept ⁇ 80° C.
- ELISA plates were coated with M2e conjugated to RNAse A at a concentration of 4 ⁇ g/ml in phosphate-buffered saline (PBS), over night at 4° C. The plates were then washed with wash buffer (PBS/0.05% Tween) and blocked for 2 h at 37° C. with 3% BSA in wash buffer.
- PBS phosphate-buffered saline
- the plates were then washed again and incubated with purified scFv-D005-msFc ⁇ 2c, scFv-E040-msFc ⁇ 2c and scFv-F052-msFc ⁇ 2c at a concentration of 100 ng/ml in the absence or presence of increasing concentrations of M2e, an M2 extracellular domain peptide derived from H5N1 Influenza A VN1203 (M2e-VN; SEQ ID NO:50), or a shortened M2e peptide (M2e-short; SEQ ID NO:49) (Table 7). Plates were incubated at room temperature for 2 h and then extensively washed with wash buffer.
- Bound scFv-Fc fusion proteins were then detected by a 1 h incubation with a HRPO-labeled, Fc ⁇ -specific, goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories 115-035-071). After extensive washing with wash buffer, plates were developed with OPD solution and read on an ELISA reader as described above. Binding of each of the antibodies to immobilized M2e was inhibited by all three peptides to a similar extent, indicating that all three peptides were recognized equally well (Table 6).
- L929-M2#E9 cells were brought to a single-cell suspension and incubated with 2-fold serial dilutions of, respectively, scFv-D005-msFc ⁇ 2c, scFv-E040-msFc ⁇ 2c or scFv-F052-msFc ⁇ 2c in FACS® buffer (phosphate-buffered saline containing 1% FCS). After a 1 h incubation on ice, cells were washed in FACS® buffer and bound antibodies detected by a half hour incubation on ice with Cy5-labeled goat anti-mouse antibody (Jackson Immuno, Cat No 115-176-071) in FACS buffer.
- FACS® buffer phosphate-buffered saline containing 1% FCS
- the antibodies scFv-D005-msFc ⁇ 2c, scFv-E040-msFc ⁇ 2c and scFv-F052-msFc ⁇ 2c were found to bind native, cell surface-expressed M2-PR with a high affinity, with an EC50 of 0.68, 0.73 and 0.46 nM, respectively.
- the efficacy anti-M2 scFv-msFc ⁇ 2c antibodies in a prophylactic setting was tested in a mouse model of Influenza A infection.
- This model reflects most of the immunological and histological aspects of Influenza infection in humans and is therefore routinely used to assess the efficacy of anti-viral agents.
- six week old female C57BL/6 mice were injected intraperitoneally with 500 ⁇ g of scFv-D005-msFc ⁇ 2c, scFv-E040-msFc ⁇ 2c, scFv-F052-msFc ⁇ 2c or mouse IgG in PBS (6 mice per group).
- mice were bled in order to verify the presence of the antibodies in the blood by ELISA. Antibodies were readily detectable in the sera of all mice, except for one mouse receiving clone D005, which was subsequently removed from the analysis (not shown).
- day 0 mice were infected intranasally with a lethal dose of mouse-adapted Influenza A virus PR8 (4 ⁇ LD50) followed by monitoring of weight-loss and fever (temperature drop) for 12 days.
- Control mice treated with mouse IgG developed severe signs of morbidity, characterized by dramatic temperature drop and weight loss, within 5 to 6 days and invariably died on days 7 or 8 ( FIG. 3C ).
- animals treated with M2-specific antibodies were almost completely protected from any signs of morbidity, developed hardly any signs of fever and lost weight only temporarily ( FIGS. 3A and B).
- mice were injected intraperitoneally with decreasing amounts of the antibody (200, 60, 20, or 6 ⁇ g per mouse) or, as a control, with 200 ⁇ g of mouse IgG (6 mice per group).
- mice were bled in order to verify the presence of the antibodies in the blood by ELISA.
- Antibodies were readily detectable in the sera of all mice, except for one mouse receiving the 60 ⁇ g dose, which was subsequently removed from the analysis (not shown).
- mice were infected intranasally with a lethal dose of influenza A virus strain PR/8/34 (4 ⁇ LD50) and monitored for 21 days ( FIG. 4A ).
- control mice quickly succumbed to the disease and were dead in less than two weeks.
- antibody D005 showed protective activity at all doses tested.
- groups of mice receiving 200, 60 or 20 ⁇ g antibody all animals survived the lethal challenge. Even at the lowest dose of 6 ⁇ g D005, half of the mice recovered and survived infection, indicating that the M2-specific antibody is a potent prophylactic agent.
- mice were infected intranasally with a lethal dose of mouse-adapted Influenza A virus PR8 (4 ⁇ LD 50 ). 1, 2, or 3 days later, groups of mice were injected intraperitoneally with 200 ⁇ g of scFv-D005-msFc ⁇ 2c in PBS (6 mice per group). As controls, one group of mice each was injected with scFv-D005-msFc ⁇ 2c or mouse IgG two days prior to infection.
- mice were bled one day after receiving antibody in order to verify the presence of the antibodies in the blood (not shown). The mice were observed closely to monitor signs of morbidity as well as mortality for a total of 21 days ( FIG. 4B and not shown). All mice receiving the control antibody eventually died, whereas all mice receiving a prophylactic injection of scFv-D005-msFc ⁇ 2c two days prior to infection survived for at least 3 weeks. Significantly, therapeutic efficacy of the antibody could be shown in groups of mice treated as much as 3 days after infection. Survival rates of mice treated 1, 2 and 3 days after infection were 100, 83 and 17%, respectively. The measurement of survival rates generally corresponds to mortality (the proportion of deaths to a specified population), whereas morbidity general corresponds to the incidence of disease or the rate of sickness (in a specified population).
- Expression vectors allowing for expression of the clones D005, E040 and F052 as fully human IgG1 ⁇ were generated.
- DNA sequences encoding a human ⁇ 1 heavy chain shared by clones D005, E040 and F052, as well as each of the unique ⁇ light chains were produced by total gene synthesis (SEQ ID NOs 30, 32, 34, and 36, by GeneArt AG, Germany).
- the heavy chain coding sequence was flanked by a Asc1 recognition site upstream and a Pac1 recognition site downstream of the open reading frame (cf. SEQ ID NO:30).
- the light chain coding sequences were flanked by Nhe1 recognition sites upstream and Pme1 recognition sites downstream of the respective open reading frame (cf.
- SEQ ID NOs 32, 34, and 36 The amino acid sequence of the entire human ⁇ 1 heavy chain, including the signal peptide, is depicted in SEQ ID NO:31.
- the amino acid sequences of the ⁇ light chains of D005, E040 and F052 are depicted in SEQ ID NOs 33, 35 and 37, respectively.
- Heavy and light chain coding regions were then combined into the EBNA-based expression vector pCB15 (disclosed as SEQ ID NO:104 of WO 2008/055795 A1).
- the heavy chain coding region was digested with the restriction enzymes Asc1 and Pac1, and ligated into Asc1-Pac1 digested pCB15, generating the plasmid pCB15-fh-HC- ⁇ 1-D005.
- This plasmid was then digested with the restriction enzymes Nhe1 and Pme1 and ligated to each of the Nhe1-Pme1 digested light chain coding regions, generating the plasmids pCB15-fh-IgG1 ⁇ -D005, pCB15-fh-IgG1 ⁇ -E040 and pCB15-fh-IgG1 ⁇ -F052.
- IgG1-D005 In view of the similarities of clones D005, E040 and F052 in sequence, affinity and prophylactic activity, only IgG1-D005 was analyzed in more detail. The ability of the fully human mAb IgG1-D005 to recognize native, cell surface-expressed M2 was assessed by analyzing its reactivity with 293T cells expressing full-length M2 variants. Thus, 293T cells were transfected with a recombinant expression vector encoding the M2 protein of A/PR/8/34 (M2-PR, SEQ ID NO:84) or the fusion protein M2-VN/PR (SEQ ID NO:85), respectively.
- M2-VN/PR comprises an extracellular domain derived from H5N1 Influenza A VN1203 (M2e-VN, SEQ ID NO:50) which is fused to the N-terminus of the transmembrane and intercellular regions of M2-PR (cf. Table 7, the part of SEQ ID NO:84 which is shown in italics).
- Transfected 293T cells were then brought to a single-cell suspension and incubated with 2-fold serial dilutions of IgG1-D005 in FACS buffer (phosphate-buffered saline containing 1% FCS). After a 1 h incubation on ice, cells were washed in FACS buffer and bound antibodies detected by a half hour incubation on ice with Cy5-labeled goat anti-human antibody in FACS buffer. After a final wash, the fluorescence-intensity of the stained cells was analyzed by flow cytometry using a FACScalibur (Becton Dickinson). The mAb IgG1-D005 bound native, cell surface-expressed M2-PR and M2-VN/PR with identical affinities, with an EC50 of 3.9 nM.
- FACS buffer phosphate-buffered saline containing 1% FCS
- mice six week old female C57BL/6 mice were injected intraperitoneally with equimolar amounts of IgG1-D005 (200 ⁇ g), scFv-D005-msFc ⁇ 2c (144 ⁇ g), scFv-D005-hFcm (144 ⁇ g), or human IgG (200 ⁇ g) in PBS (6 mice per group).
- mice were bled in order to verify the presence of the antibodies in the blood by ELISA. Antibodies were readily detectable in the sera of all mice (not shown).
- mice were infected intranasally with a lethal dose of mouse-adapted Influenza A virus PR8 (4 ⁇ LD 50 ) followed by monitoring of weight-loss and fever (temperature drop) for 16 days.
- Control mice treated with mouse IgG developed severe signs of morbidity, characterized by dramatic temperature drop and weight loss, within 6 to 7 days and died between days 8 and 11 ( FIG. 5 ).
- mice treated with scFv-D005-msFc ⁇ 2c those treated with hIgG1k-D005 were almost completely protected from any signs of morbidity, developed hardly any signs of fever and lost weight only temporarily ( FIGS. 5A and B).
- mice treated with scFv-D005-msFc ⁇ 2c were not protected and developed severe signs of morbidity similar to mice treated with the control IgG ( FIGS. 5A and B). Consequently, all animals treated with scFv-D005-hFcm succumbed to disease and were dead by day 9 ( FIG. 5C ). Thus, Fc receptor interaction is required for protection, suggesting that ADCC is a major component of the prophylactic activity.
- the dissociation constants (Kd) of antibody binding to M2e in solution were determined using an ELISA-based method essentially as described (Friguet B. et al., 1985, J. Immunol. Meth. 77, 305-319).
- RNAse conjugated to influenza A M2e SEQ ID NO:48
- free antibody was detected by a classical ELISA similar to the one described in Example 4.
- ELISA plates that had been coated with RNAse-M2e conjugate at a concentration of 20 ng/ml at 4° C. overnight were washed with wash buffer (PBS/0.05% Tween) and blocked for 1 h at 37° C. with 3% BSA in wash buffer. The plates were then washed again and incubated with the solution binding reactions for 30 min at room temperature. After extensive washing with wash buffer, bound scFv-Fc ⁇ 2c fusion proteins were detected by a 1 h incubation at room temperature with a HRPO-labeled, Fc ⁇ -specific, goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories 115-035-071).
- the Kd values were determined as the EC50 of the ELISA signal as a function of the RNAse-M2e concentration present in the solution binding reaction.
- the antibodies scFv-D005-msFc ⁇ 2c, scFv-E040-msFc ⁇ 2c and scFv-F052-msFc ⁇ 2c were found to bind soluble RNase-M2e with a high affinity. Kd values were found to be 4 pM (D005), 13 pM (E040) and 6 pM (F052).
- the same assay was repeated under otherwise identical conditions using free M2e peptide (SEQ ID NO:48) instead of the RNAse-M2e conjugate.
- the antibodies scFv-D005-msFc ⁇ 2c, scFv-E040-msFc ⁇ 2c and scFv-F052-msFc ⁇ 2c were found to bind soluble M2e peptide with a high affinity. Kd values were found to be 4 nM (D005, E040) and 5 nM (F052).
- antibody D005 to distinguish between native, cell-associated M2 and an unstructured, soluble M2e peptide was assessed by flow cytometry.
- mouse monoclonal antibody 14C2 was also analyzed (Zebedee et al., 1988, J. Virol. 62(8): 2762-2772).
- scFv-D005-msFc ⁇ 2c and mAb 14C2 were incubated in FACS buffer at a concentration of 0.5 ⁇ g/ml in the presence or absence of 12 nM soluble M2e peptide for 1 hour on ice.
- the prebound antibodies were then used for staining of L929-M2#E9 cells.
- L929-M2#E9 cells were brought to a single-cell suspension and incubated with the prebound antibodies or, as a control, with FACS buffer. After a 50 min incubation on ice, cells were washed in FACS buffer and bound antibodies detected by a 20 min incubation on ice with Cy5-labeled goat anti-mouse antibody (Jackson Immuno, Cat No 115-176-071) in FACS buffer. After a final wash, the fluorescence intensity of the stained cells was analyzed by flow cytometry using a FACScalibur® (Becton Dickinson) ( FIG. 6 ). Both antibodies were found to bind native, cell surface-expressed M2 with similar efficiency in the absence of peptide.
- mouse mAb 14C2 did not efficiently recognize L292/M2#E9 cells.
- antibody scFv-D005-msFc ⁇ 2c efficiently stained the cells despite the presence of an excess of competing peptide. This indicates that antibody D005, but not mAb 14C2, may bind a conformational epitope only present in native, cell-surface M2.
- Binding was assayed at two antibody concentrations, 0.5 ⁇ g/ml and 0.05 ⁇ g/ml, revealing that antibody D005 is broadly cross-reactive. Significantly, all peptides tested were recognized, and 19 of the peptides were recognized as well as the one corresponding to the M2e consensus sequence ( FIG. 8A ).
- the minimal epitope was determined in a similar manner, by testing the binding of IgG1k-D005 to solid phase bound variants of a peptide corresponding to peptide M2e-short (SEQ ID NO:49) (analysis performed by Pepscan Presto BV, Lelystad, the Netherlands). Three types of analyses were done: first, N- and C-terminal deletions; second, epitope scanning by synthesizing all 105 different 3 to 16 mer variants; and third, point mutations by synthesiszing all 304 possible single positional variants. The 3 analyses yielded comparable results ( FIG. 8B ). N-/C-terminal deletion and epitope scanning analyses narrowed down the region recognized by D005 to the 8-mer peptide LLTEVETP (SEQ ID NO:93).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pulmonology (AREA)
- Communicable Diseases (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The present invention relates to human antibodies, preferably to fully human antibodies, which are specifically binding to influenza M2e antigen. The invention further relates to individual light- and/or heavy chains of such antibodies, to nucleic acids encoding said antibodies or their light- and/or heavy chain, and to expression vectors for the expression of said antibodies. Furthermore, the invention relates to the use of said antibodies in the treatment and/or prevention of influenza A virus infection, preferably in humans.
Description
- This application is a continuation of U.S. application Ser. No. 13/132,658, filed Jun. 3, 2011, which is a national stage filing under 35 U.S.C. §371 of international application PCT/EP2009/066052, filed Nov. 30, 2009, which was published under PCT Article 21(2) in English, and claims priority to EP 09173548, filed Oct. 20, 2009 and EP 08170749, filed Dec. 4, 2008.
- The present invention relates to human antibodies, preferably to fully human antibodies, which are specifically binding to influenza M2e antigen. The invention further relates to individual light- and/or heavy chains of such antibodies, to nucleic acids encoding said antibodies or their light- and/or heavy chain, and to expression vectors for the expression of said antibodies. Furthermore, the invention relates to the use of said antibodies in the treatment and/or prevention of influenza A virus infection, preferably in humans.
- Influenza A virus still is a major cause of disease in humans, accounting for three to five million cases of severe illness and 250,000-500,000 deaths each year. Efficient influenza A vaccines are available, which act by inducing neutralizing antibodies against hemagglutinin (HA). Since HA undergoes continuous change due to mutations (antigenic drift), new antigenic variants of influenza A arise every year requiring constant update of the vaccines. Effective vaccination is further complicated by the occasional re-assortment of the segmented viral genome leading to the replacement of HA or neuraminidase (NA) from one subtype by another subtype, a process called antigenic shift. Passive immunization with monoclonal antibodies (mAbs) targeting HA is very efficient, however, suffers the same disadvantages as the current vaccines due to antigenic shift and drift.
- An ideal target for active and passive immunization strategies would therefore be a conserved viral protein. The matrix protein 2 (M2) fits the bill and has received considerable attention as a potential target against influenza infection over the past decades (Zebedee S L, Lamb R A: Influenza A virus M2 protein: monoclonal antibody restriction of virus growth and detection of M2 in virions. J Virol 1988, 62:2762-2772). M2 is a tetrameric ion channel which is involved in virus uncoating in the endosome and in virus maturation in the trans-Golgi network. Its 23 amino acid extracellular domain has remained remarkably conserved in human influenza A virus isolates over the last hundred years, at least in part due to the fact that the M2 protein is co-transcribed with the matrix protein 1 (M1). Whereas M2 is abundantly expressed on infected cells, only very few M2 molecules are present in Influenza A virus membranes. In accordance with these observations M2 specific antibodies were shown to protect by the elimination of infected cells by ADCC rather than by preventing infection through neutralization of the virus (Jegerlehner A, Schmitz N, Storni T, Bachmann M F: Influenza A vaccine based on the extracellular domain of M2: weak protection mediated via antibody-dependent NK cell activity. J. Immunol. 2004, 172:5598-5605).
- Passive immunization with monoclonal antibodies has several advantages over vaccination. In particular, it allows treating people which poorly respond to vaccines, such as the elderly, young children or immune compromised individuals. In addition, passive immunization is the treatment option of choice in situations where rapid protection is crucial, such as for post-exposure treatment or prophylaxis for the acutely exposed. A number of M2 ectodomain (M2e)-specific mAbs have been reported to protect mice from a lethal challenge in a prophylactic setting. While these mAbs include fully human antibodies derived from transchromosomic mice (Wang R et al., Antiviral Res. 2008, 80:168-177; WO2006/061723A2; and WO03/078600A2), no natural human M2e-specific antibodies have been reported to date. However, for application in human subjects, natural human antibodies are the preferred choice. In contrast to humanized and fully human antibodies derived from phage display or transchromosomic mice, natural human antibodies combine the advantage of minimal immunogenicity with the smallest possible off-target reactivity and toxicity. Furthermore, human derived antibodies have the advantage of having gone through the affinity maturation process, resulting in high affinity antibodies.
- A library-based screening led to the identification, isolation and cloning of 53 human scFv which showed high affinity to the extracellular domain of the influenza A M2 protein. Fully human monoclonal IgG1 antibodies have been generated from representative scFv clones. Human, and in particular fully human antibodies, are advantageous because they show less severe side effects when administered to a human subject. Without being bound to any theory this is because human, and in particular fully human, antibodies are typically and preferably not recognized by the human immune system. It has surprisingly been found that the selected antibody clones show different combinations of identical and/or highly similar CDR sequences in their light chain variable regions (LCVR) and in their heavy chain variable regions (HCVR). Based on the particular combination of CDRs, different types of LCVRs and HCVRs can be distinguished (cf. Tables 1 and 2). However, the LCVRs and HCVRs of all clones are highly similar as can be deduced from the sequence information which is provided in Tables 1 and 2. It was therefore concluded that the antibodies of the invention are clonally related. Table 3 provides an overview of the different combinations of LCVR and HCVR types as defined by their CDRs which were found in the selected clones. The table also indicates the abundance of each of these combinations among the 53 clones. Further surprisingly it has been found that the antibodies of the invention show a very high affinity towards influenza M2e antigen, and in particular towards the extracellular domain of the influenza A M2 protein. The dissociation constants (Kd) between the antibodies and RNAse—influenza A M2e antigen conjugate was found to be in the low picomolar range. An epitope mapping revealed that the minimal epitope which is recognized by antibody clone D005 is comprised in the amino acid sequence LLTEVETP (SEQ ID NO:93). This epitope is comprised by the M2 protein of most known influenza A strains. Consequently, it has been found, that the antibodies of the invention show a similarly high affinity to different variants of the extracellular domain of influenza A M2 protein which are derived from different strains of influenza A virus. It has also been demonstrated that the antibodies of the invention are specifically binding to cells which are expressing recombinant influenza A M2 protein on their surface. Moreover, antibodies of the invention were found to exhibit a preferential binding to cell-associated influenza A M2 protein. Furthermore it was found that antibodies of the invention are capable of specifically binding influenza A M2 protein in the context of influenza A virus particles. Most importantly, it has been demonstrated in a mouse model for influenza A virus infection that the antibodies of the invention are highly effective in the treatment and/or prevention of influenza A virus infection. Contrary to other influenza A M2 specific human antibodies which are known in the art, the antibodies of the invention have therapeutic activity when administered as a single dose on day one or day two after infection. The antibodies disclosed herein are therefore useful as a medicament against influenza A virus infection in a therapeutic as well as in a prophylactic setting.
-
TABLE 1 CDRs of the LCVRs of fully human M2 specific monoclonal antibodies. Nine types of LCVRs can be distinguished based on the combination of their CDR sequences (1A to 3B). Based on sequence similarities in the LC CDRs 3 groups of LCVRs can be distinguished: 1A to 1E, 2A to 2B, and 3A to 3B). Type Clones LC CDR1 LC CDR2 LC CDR 3 1A D005 and qsvlytsnnkny was qqyfmtpit 31 others (SEQ ID NO: 1) (SEQ ID NO: 7) (SEQ ID NO: 8) 1B F048, F084 qsvlntsnnkny was qqyfmtpit (SEQ ID NO: 2) (SEQ ID NO: 7) (SEQ ID NO: 8) 1C E011 qsvlhtsnnkny was qqyfmtpit (SEQ ID NO: 3) (SEQ ID NO: 7) (SEQ ID NO: 8) 1D E036 qsvlytsnnkny was qqyfmapit (SEQ ID NO: 1) (SEQ ID NO: 7) (SEQ ID NO: 9) 1E F076 qsvlytsnnkny was qqyfvtpit (SEQ ID NO: 1) (SEQ ID NO: 7) (SEQ ID NO: 10) 2A E040 and qsvlyssnneny was qqyfmtpit 10 others (SEQ ID NO: 4) (SEQ ID NO: 7) (SEQ ID NO: 8) 2B E043 qsvlyssnnedy was qqyfmtpit (SEQ ID NO: 5) (SEQ ID NO: 7) (SEQ ID NO: 8) 3A F052, F015, qsllyssnnkny was qqyfmtpit F077 (SEQ ID NO: 6) (SEQ ID NO: 7) (SEQ ID NO: 8) 3B F027 qsllyssnnkny was qqyfmtpia (SEQ ID NO: 1) (SEQ ID NO: 7) (SEQ ID NO: 11) -
TABLE 2 CDRs of the HCVRs of fully human M2 specific monoclonal antibodies. Six types of HCVRs can be distinguished based on the combination of their CDR sequences. Type Clones HC CDR1 HC CDR2 HC CDR 3 1A D005 and 45 glnfgdyp iksksygvtt tsssgflyyfdy others (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 15) 1B E031, F023, glnfgdyp iksksygvtt tsssgflyyfdh F057 (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 16) 1C E005 glnfgdyp iksksygvtt tssssflyyfdy (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 17) 1D E034 glnfgdyp iksksygvtt tsnsgflyyfdy (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 18) 1E E044 glnfgdyp ikskpygvtt tsssgflyyfdy (SEQ ID NO: 12) (SEQ ID NO: 14) (SEQ ID NO: 15) 1F F071 glnfgdyp iksksygvtt tsssgfsyyfdy (SEQ ID NO: 12) (SEQ ID NO: 13) (SEQ ID NO: 19) -
TABLE 3 Combination of LCVRs and HCVRs as occurring in 53 independent clones of fully human M2 specific monoclonal antibodies. Clones D005, E040 and F052 (highlighted in bold) represent three of most abundant combinations of LCVR and HCVR and were thus chosen as representative clones for further analysis. Combinations of CDR types (LC Number of VR - HC VR) Clones Clones 1A-1A D005, D013, D019, D033, D037, 26 E007, E012, E021, E028, E029, E033, E035, E049, E051, F004, F005, F025, F037, F039, F040, F045, F046, F054, F065, F075, F087 1A-1B E031, F023, F057 3 1A-1D E034 1 1A-1E E044 1 1A-1F F071 1 1B-1A F048, F084 2 1C-1A E011 1 1D-1A E036 1 1E-1A F076 1 2A-1A E006, E023, E030, E040, E048, 10 F003, F020, F044, F062, F066 2A-1C E005 1 2B-1A E043 1 3A-1A F015, F052, F077 3 3B-1A F027 1 - In one aspect, the invention relates to a monoclonal antibody, preferably to an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody, wherein preferably the EC50 value and/or the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 1000 nM, preferably at most 100 nM, more preferably at most 10 nM, still more preferably at most 1 nM, still more preferably at most 100 pM, still more preferably at most 10 pM, and most preferably at most 1 pM.
- In a preferred embodiment, (i) said monoclonal antibody comprises at least one LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - In a further aspect the invention relates to an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein preferably said monoclonal antibody is a human monoclonal antibody, most preferably a fully human monoclonal antibody, and wherein said antibody comprises at least one antigen binding site, wherein said antigen binding site comprises: (a) one LCVR, wherein said LCVR comprises: (i) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs SEQ ID NOs 13 and 14; and (iii) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - A further aspect of the invention is a LCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, most preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs - A further aspect of the invention is a HCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said HCVR comprises: one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of
SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - In a further aspect, the invention relates a nucleic acid molecule encoding a HCVR or a LCVR of the invention, a monoclonal antibody of the invention or an individual chain thereof.
- In a further aspect, the invention relates to an expression vector for the recombinant expression of an antibody of the invention.
- In a further aspect, the invention relates to a host cell comprising at least one nucleic acid molecule or at least one expression vector of the invention.
- In a further aspect, the invention relates to a pharmaceutical composition comprising at least one monoclonal antibody of the invention.
- In a further aspect, the invention relates to a method of passive immunization, preferably against influenza A virus, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said monoclonal antibody is an IgG1.
- In a further aspect, the invention relates to a method of treating and/or preventing influenza A virus infection, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said subject is a human, and wherein further preferably said monoclonal antibody is an IgG1.
- In a further aspect, the invention relates to a monoclonal antibody of the invention or to the pharmaceutical composition of the invention, for use in passive immunization, preferably against influenza A virus, preferably in a human, and wherein further preferably said monoclonal antibody is an IgG1.
- In a further aspect, the invention relates to the use of the monoclonal antibody of the invention in the manufacture of a medicament for the treatment and/or prophylaxis of influenza A virus infection, preferably in a human, and wherein further preferably said monoclonal antibody is an IgG1.
-
FIG. 1 . Alignment of LCVR sequences (amino acids 5 to 113) of M2-specific human antibodies. Identical amino acids are shown as dots. LC CDRs 1-3 are boxed. -
FIG. 2 . Alignment of HCVR sequences (amino acids 7 to 121) of M2-specific human antibodies (the same antibodies as inFIG. 1 ). Identical amino acids are shown as dots. HC CDRs 1-3 are boxed. -
FIG. 3 . Effect of M2-specific antibodies on Influenza-induced morbidity and mortality. Mice were treated with 500 μg of the indicated scFv-msFcγ2c antibody on day −2, infected with Influenza A virus PR8 onday 0, and weight (A), body temperature (B) and survival (C) were monitored on the indicated days. -
FIG. 4 . Effect of scFv-D005-msFcγ2c on survival of Influenza-infected mice. (A) Dose titration. Mice were treated with the indicated amounts of antibody on day −2, infected with Influenza A virus PR8 onday 0, and survival was monitored for 21 days. (B) Therapeutic application of antibody. Mice were infected with Influenza A virus PR8 onday 0, treated with 200 μg of the antibody on the indicated days, and survival was monitored for 21 days. Control, mouse IgG on day −2. -
FIG. 5 . Effect of M2-specific antibodies on Influenza-induced morbidity and mortality. Mice were treated with the antibody D005 in the indicated format on day −2, infected with Influenza A virus PR8 onday 0, and weight (A), body temperature (B) and survival (C) were monitored on the indicated days. -
FIG. 6 . Binding to cell surface M2 in the presence of soluble M2e peptide. L929/M2#E9 cells were stained with antibody 14C2 (A) or D005 (B) in the presence (solid line) or absence (heavy line) of soluble M2e peptide and analyzed by FACS. Dotted line, staining with fluorescently labelled secondary antibody alone. -
FIG. 7 . Direct binding of antibody D005 to Influenza A PR8 virus particles. The indicated amount of virus was captured on wells of an ELISA plate previously coated with anti-HA antibody. Virus was detected with hIgG1k-D005 or an irrelevant isotype control. -
FIG. 8 . Characterization of binding specificity of antibody D005. (A) Reactivity of IgG1k-D005 with M2e-derived peptides from different strains of Influenza A. (B) Epitope mapping. - “Antibody”: As used herein, the term “antibody” refers to a molecule, preferably a protein, which is capable of specifically binding an antigen, typically and preferably by binding an epitope or antigenic determinant of said antigen, or a hapten. Preferably, the term antibody refers to an antigen or hapten binding molecule comprising at least one variable region, wherein preferably said molecule comprises least one HCVR and/or at least one LCVR. Further preferably, the term antibody refers to an antigen or hapten binding molecule comprising at least one, preferably exactly two antigen binding sites, wherein each of said antigen binding site(s) is formed by one HCVR and one LCVR. Furthermore, the term antibody refers to whole antibodies, preferably of the IgG, IgA, IgE, IgM, or IgD class, more preferably of the IgG class, most preferably IgG1, IgG2, IgG3, and IgG4, and to antigen binding fragments thereof. In a preferred embodiment said whole antibodies comprise either a kappa or a lambda light chain. The term “antibody” also refers to antigen or hapten binding antibody fragments, preferably to proteolytic fragments and their recombinant analogues. most preferably to Fab, Fab′ and F(ab′)2, and Fv. The term antibody further encompasses a protein comprising at least one, preferably two variable regions, wherein further preferably said protein comprises exactly one HCVR and exactly one LCVR. In a preferred embodiment the term antibody refers to a single chain antibody, preferably to scFv. Thus, preferred antibodies are single chain antibodies, preferably scFvs, disulfide-linked Fvs (sdFv) and fragments comprising either a light chain variable region (LCVR) or a heavy chain variable region (HCVR). In the context of the invention the term “antibody” preferably refers to recombinant antibodies, including recombinant proteins consisting of a single polypeptide, wherein said polypeptide comprises at least one, preferably exactly one, variable region. In the context of the invention recombinant antibodies may further comprise functional elements, such as, for example, a linker region, a signal peptide or hydrophobic leader sequence, a detection tag and/or a purification tag (e.g. Fc).
- “recognizing”: An antibody is said to be “recognizing” an epitope when said antibody is specifically binding an antigen comprising said epitope in a position which is available for interaction with said antibody, and when said antibody does not specifically bind an otherwise identical antigen which does not comprise said epitope, or wherein said epitope is located in a position which is not available for interaction with said antibody. Similarly, an antigen binding site is said to be recognizing an epitope, when an antibody comprising said antigen binding site is recognizing said epitope, wherein typically and preferably said antibody does not comprise a second antigen binding site having a different structure.
- “Fv”: The term Fv refers to the smallest proteolytic fragment of an antibody capable of binding an antigen or hapten and to recombinant analogues of said fragment.
- “single chain antibody”: A single chain antibody is an antibody consisting of a single polypeptide. Preferred single chain antibodies consist of a polypeptide comprising at least one, preferably exactly one VR, wherein preferably said VR is a HCVR. More preferred single chain antibodies consist of a polypeptide comprising a at least one, preferably exactly one, HCVR and at least one, preferably exactly one, LCVR. Still more preferred single chain antibodies comprise exactly one HCVR and exactly one LCVR. Typically and preferably said HCVR and said LCVR are forming an antigen binding site. Most preferred single chain antibodies are scFv, wherein said scFv consist of a single polypeptide comprising exactly one HCVR and exactly one LCVR, wherein said HCVR and said LCVR are linked to each other by a linker region, wherein preferably said linker region consists of at least 15, preferably of 15 to 20 amino acids (Bird et al. (1988) Science, 242(4877):423-426). Further preferred single chain antibodies are scFv, wherein said scFv are encoded by a coding region, wherein said coding region, in 5′ to 3′ direction, comprises in the following order: (1) a light chain variable region (LCVR) consisting of light chain framework (LC FR) 1, complementary determining region (LC CDR) 1, LC FR2,
LC CDR 2, LC FR3, LC CDR3 and LC FR4 from a κ or λ light chain; (2) a flexible linker (L), and (3) a heavy chain variable region (HCVR) consisting of framework (HC FR) 1, complementary determining region (HC CDR) 1, HC FR2, HC CDR2, HC FR3, HC CDR3 and HC FR4. Alternatively, single chain antibodies are scFv, wherein said scFv are encoded by a coding region, wherein said coding region, in 5′ to 3′ direction, comprises in the following order: (1) a heavy chain variable region (HCVR) consisting of framework (HC FR) 1, complementary determining region (HC CDR) 1, HC FR2, HC CDR2, HC FR3, HC CDR3 and HC FR4; (2) a flexible linker (L), and (3) a light chain variable region (LCVR) consisting of light chain framework (LC FR) 1, complementary determining region (LC CDR) 1, LC FR2, LC CDR2, LC FR3, LC DR3 and LC FR4 from a κ or λ light chain. - “diabody”: The term “diabody” refers to an antibody comprising two polypeptide chains, preferably two identical polypeptide chains, wherein each polypeptide chain comprises a HCVR and a LCVR, wherein said HCVR and said LCVR are linked to each other by a linker region, wherein preferably said linker region comprises at most 10 amino acids (Huston et al. (1988), PNAS 85(16):587958-83; Holliger et al. (1993), PNAS 90(14):6444-6448, Hollinger & Hudson, 2005, Nature Biotechnology 23(9):1126-1136; Arndt et al. (2004) FEBS Letters 578(3):257-261). Preferred linker regions of diabodies comprise 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids.
- “human antibody”: As used herein, the term “human antibody” refers to an antibody, preferably a recombinant antibody, essentially having the amino acid sequence of a human immunoglobulin, or a fragment thereof, and includes antibodies isolated from human immunoglobulin libraries. In the context of the invention “human antibodies” may comprise a limited number of amino acid exchanges as compared to the sequence of a native human antibody. Such amino acid exchanges can, for example, be caused by cloning procedures. However, the number of such amino acid exchanges in human antibodies of the invention is preferably minimized Preferably, the amino acid sequence of human antibodies is at least 85%, preferably 90%, more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to that of native human antibodies. More preferably, the amino acid sequence of human antibodies is at least 85%, preferably 90%, more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to that of native human antibodies which are specifically binding to the antigen or hapten of interest. Most preferably, the amino acid sequence of human antibodies is at least 85%, preferably 90%, more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to that of native human antibodies which are specifically binding influenza M2e antigen, wherein preferably said influenza M2e antigen is selected from any one of SEQ ID NOs 48 to 52, and wherein most preferably said influenza M2e antigen is SEQ ID NO:48.
- Preferred recombinant human antibodies differ from native human antibodies in at most 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid. Very preferably, differences in the amino acid sequence of recombinant human antibodies and native human antibodies are eliminated my means of molecular cloning, and thus, most preferably, the amino acid sequence of a recombinant human antibodies and native human antibodies are identical. Such antibodies are also referred to as “fully human antibodies”. An illustrative example how a fully human antibody may be obtained from a human antibody selected from a human antibody library is provided in Example 8. Typically and preferably, fully human antibodies are not immunogenic in humans.
- Preferred human antibodies comprise (a) least one, preferably one, HCVR, (b) at least one, preferably one, HCCR, (c) at least one, preferably one, LCVR, and (d) at least one, preferably one, LCCR, wherein said at least one HCVR, and/or said at least one HCCR, and/or said at least one LCVR, and/or said at least one LCCR are at least 85%, preferably 90%, more preferably 95%, still more preferably at least 96%, again still more preferably 97%, again still more preferably 98%, again still more preferably 99%, and most preferably 100% identical to the respective native human regions.
- It is well established that the constant regions of immunoglobulins, including human immunoglobulins, exist in various allotypes, i.e. that the amino acid sequence of said constant regions may differ to a certain extend between individuals of a population. Allotypes of the constant regions of human immunoglobulins are very well studied and the sequence information is readily available to the artisan from various sources, including the Immuno Genetics Information System. It is to be understood that different allotypes of the constant regions of one immunoglobulin are interchangeable for the purpose of the invention. For example, the
human gamma 1 heavy chain of a monoclonal antibody of the invention may comprise any existing allotype of ahuman gamma 1 HCCR. - “monoclonal antibody”: As used herein, the term “monoclonal antibody” refers to an antibody population comprising only one single antibody species, i.e. antibodies having an identical amino acid sequence.
- “constant region (CR)”: The term “constant region” refers to a light chain constant region (LCCR) or a heavy chain constant region (HCCR) of an antibody. Typically and preferably, said CR comprises one to four immunoglobulin domains characterized by disulfide stabilized loop structures. Preferred CRs are CRs of immunoglobulins, preferably of human immunoglobulins, wherein further preferably said immunoglobulins, preferably said human immunoglobulins are selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM, and IgD. Very preferred CRs are human CRs comprising or consisting of an amino acid sequence available from public databases, including, for example the Immunogenetic Information System.
- light chain constant region (LCCR): The LCCR, more specifically the kappa LCCR or the lambda LCCR, typically represents the C-terminal half of a native kappa or lambda light chain of an native antibody. A LCCR typically comprises about 110 amino acids representing one immunoglobulin domain.
- heavy chain constant region (HCCR): The constant region of a heavy chain comprises about three quarters or more of the heavy chain of an antibody and is situated at its C-terminus Typically, the HCCR comprises either three or four immunoglobulin domains. Preferred HCCRs are selected from gamma HCCR, alpha HCCR, epsilon HCCR, my HCCR, and delta HCCR. Very preferred are gamma HCCR, wherein preferably said gamma HCCR is selected from
gamma 1 HCCR,gamma 2 HCCR, gamma 3 HCCR, andgamma 4 HCCR, wherein most preferably said gamma HCCR is agamma 1 HCCR. - “variable region (VR)”: Refers to the variable region or variable domain of an antibody, more specifically to the heavy chain variable region (HCVR) or to the light chain variable region (LCVR). Typically and preferably, a VR comprises a single immunoglobulin domain. Preferred VRs are VRs of immunoglobulins, preferably of human immunoglobulins, wherein further preferably said immunoglobulins, preferably said human immunoglobulins, are selected from the group consisting of IgG1, IgG2, IgG3, IgG4, IgA, IgE, IgM, and IgD. VRs of various species are known in the art. Preferred VRs are human VRs, wherein the framework of said human VRs exhibit at least 80%, preferably at least 85%, more preferably 90%, again more preferably at least 95%, most preferably at least 99% sequence identity with the framework of any known human VR sequence. Preferred VRs are human VRs, wherein the framework of said human VRs exhibit at least 80%, preferably at least 85%, more preferably 90%, again more preferably at least 95%, most preferably at least 99% sequence identity with the framework of any human VR sequence available from public databases, most preferably with any human VR sequence available from the Immunogenetics Information System.
- Each VR comprises so called complementarity determining regions (CDRs) which are determining the binding characteristics of the antibody and which are embedded in the so called framework. Typically and preferably, VRs comprise three CDRs, preferably CDR1, CDR2, and CDR3, which are embedded into the framework (FR 1-4). Thus, in a preferred embodiment, a VR comprises the following elements in the following order from the N— to the C-terminus: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
- Generally VRs comprise or preferably consist of a polypeptide, wherein said polypeptide is a product of a member of a family of V-gene segments in combination with further gene segments as, for example, D and J gene segments (HCVR) or J gene segments (LCDR).
- “light chain variable region (LCVR)”: Light chain variable regions are encoded by rearranged nucleic acid molecules and are either a kappa LCVR or a lambda LCVR. Human kappa LCVRs comprise a polypeptide, wherein said polypeptide is a product of a member of
family 1 to 7 of human kappa V-gene segments. In the context of the invention preferred kappa LCVRs are human kappa LCVRs, preferably human kappa LCVRs which are encoded by a DNA which can be amplified from human B cells using a primer combination of any one of the oligonucleotides disclosed as SEQ ID NO:49 to 52 of WO2008/055795A1 with any one oligonucleotide disclosed as SEQ ID NO:53 to 56 of WO2008/055795A1, and further preferably, PCR conditions described in Example 3 or of WO2008/055795A1. - Human lambda LCVRs comprise a polypeptide, wherein said polypeptide is a product of a member of
family 1 to 11 of human lambda V-gene segments. In the context of the invention preferred lambda LCVRs are human lambda LCVRs, preferably human lambda LCVRs which are encoded by a DNA which can be amplified from human B cells using a primer combination of any one of SEQ ID NO:57 to 65 of WO2008/055795A1 with any one of SEQ ID NO:66 to 68 of WO2008/055795A1, and further preferably, PCR conditions described in Example 3 of WO2008/055795A1. - Typically and preferably, LCVRs comprise three LC CDRs, preferably LC CDR1, LC CDR2, and LC CDR3, which are embedded into the light chain framework (LC FR 1-4). Thus, in a preferred embodiment, a LCVR comprises the following elements in the following order from the N- to the C-terminus: LC FR1-LC CDR1-LC FR2-LC CDR2-LC FR3-LC CDR3-LC FR4.
- “heavy chain variable region (HCVR)”: Heavy chain variable regions are encoded by rearranged nucleic acid molecules. Human HCVRs comprise a polypeptide, wherein said polypeptide is a product of a member of
family 1 to 7 of human lambda V-gene segments. In the context of the invention preferred HCVRs are human HCVRs, preferably human HCVRs which are encoded by a DNA which can be amplified from human B cells using a primer combination of any one of SEQ ID NO:42 to 47 of WO2008/055795A1 with SEQ ID NO:48 of WO2008/055795A1 and, further preferably, PCR conditions described in Example 3 of WO2008/055795A1. - Typically and preferably, HCVRs comprise three HC CDRs, preferably HC CDR1, HC CDR2, and HC CDR3, which are embedded into the heavy chain framework (HC FR 1-4). Thus, in a preferred embodiment, a HCVR comprises the following elements in the following order from the N- to the C-terminus: HC FR1-HC CDR1-HC FR2-HC CDR2-HC FR3-HC CDR3-HC FR4.
- “CDR”: The complementarity determining region (CDR) 1, 2 and 3 of the HCVR and of the LCVR, respectively, of an antibody can be identified by methods generally known in the art. For the purpose of this application, CDR and FR boundaries are defined as set forth by Scavinger et al. 1999 (Exp Clin Immunogenet., Vol. 16 pp. 234-240), or by Lefranc et al. 2003 (Developmental and Comparative Immunology Vol. 27 pp. 55-77).
- “antigen”: As used herein, the term “antigen” refers to a molecule which is bound by an antibody. An antigen is recognized by the immune system and/or by a humoral immune response and can have one or more epitopes, preferably B-cell epitopes, or antigenic determinants.
- “extracellular domain of the influenza A virus M2 protein”: As used herein, the term “extracellular domain of the influenza A virus M2 protein” refers to the N-terminal extracellular domain of the M2 protein of influenza A virus, or to any consecutive stretch of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23, amino acids thereof. Preferably, extracellular domain of the influenza A virus M2 protein refers to
amino acid residues 2 to 24 of the influenza A virus M2 protein, or to any consecutive stretch of at least of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids thereof. In a more preferred embodiment the extracellular domain of the influenza A virus M2 protein comprises or consists of a peptide selected from any one of SEQ ID NOs 48 to 83 and 90 to 92, or to any consecutive stretch of at least of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids thereof. In a very preferred embodiment the extracellular domain of the influenza A virus M2 protein comprises or consists of a peptide selected from any one of SEQ ID NOs 48 to 50. Most preferably, the extracellular domain of the influenza A virus M2 protein is the M2e consensus sequence (SEQ ID NO:48). -
TABLE 4 Variants of the extracellular domain of influenza A virus M2 protein. Sequences are shown without the N-terminal Methionine. Influenza A M2e variant aa Sequence SEQ ID NO aa 2-24 of SEQ ID NO: 84 (PR8) SLLTEVETPIRNEWGCRCNGSSD 51 M2-T: SLLTEVETPTRNEWGCRCNDSSD 52 M2e consensus SLLTEVETPIRNEWGCRCNDSSD 48 M2e-short SLLTEVETPIRNEWGC 49 M2-KE: SLLTEVETPTKNEWECRCNDSSD 53 M2-K: A/Wisconsin/3523/88 (H1N1) SLLTEVETPIRNEWGCKCNDSSD 54 M2-E: SLLTEVETPIRNEWECRCNDSSD 55 M2-GE: SLLTEVETPIRNGWECRCNDSSD 56 M2-S: SLLTEVETPIRSEWGCRCNDSSD 57 M2-FP: SFLPEVETPIRNEWGCRCNDSSD 58 M2-DSSN: SLLTEVETPIRNEWGCRCNDSSN 59 M2-K: SLLTEVETPIRKEWGCRCNDSSD 61 M2-F: FLLTEVETPIRNEWGCRCNDSSD 62 M2-EG: A/NewYork/687/1995/(H3N2) SLLTEVETPIRNEWECRCNGSSD 63 M2-PS: SLPTEVETPIRSEWGCRCNDSSD 64 M2-P: SLLPEVETPIRNEWGCRCNDSSD 65 M2-PG: SLLPEVETPIRNGWGCRCNDSSD 66 M2-TGE: A/DK/ST/5048/2001 (H3N8) SLLTEVETPTRNGWECRCNDSSD 67 M2-FG: A/X-31 (H3N2) SFLTEVETPIRNEWGCRCNGSSD 68 M2-EYS: SLLTEVETPIRNEWEYRCSDSSD 69 M2-LTGS: A/HK/156/97 (H9N2) SLLTEVETLTRNGWGCRCSDSSD 70 M2-LTKGS: A/HK/542/97 (H5N1) SLLTEVETLTKNGWGCRCSDSSD 71 M2-HTES: SLLTEVETHTRNEWECRCNDSSD 72 M2-TES: A/VN/1203/2004 (H5N1) M2e-VN SLLTEVETPTRNEWECRCSDSSD 50 M2-TGEK: A/Neth/33/03 (H7N1) SLLTEVETPTRNGWECKCNDSSD 73 M2-FLTGEKS: SFLTEVETLTRNGWECRCSDSSD 74 M2-LTGEKS: A/HK/1074/99 (H9N2) SLLTEVETLTRNGWECKCSDSSD 75 M2-DLTGS: A/HK/485/97/(H5N1) SLLTEVDTLTRNGWGCRCSDSSD 76 M2-TGS: A/chicken/SH/F/98/(H9N2) SLLTEVETPTRNGWGCRCSDSSD 77 M2-KTGEKS: A/Quail/AR/16309-7/94 SLLTEVKTPTRNGWECKCSDSSD 78 (H7N3NSA) M2-TDGEKS: A/Chick/Pen/13552-1/98 SLLTEVETPTRDGWECKCSDSSD 79 (H7N2NSB) M2-HTGEKS: A/Chick/CA/1002a/00 SLLTEVETHTRNGWECKCSDSSD 80 (H6N2) M2-P: A/swine/Quebec/192/81/(H1N1) SLPTEVETPIRNEWGCRCNDSSD 81 M2-SG: A/swine/Tenn/25/77/(H1N1) SLLTEVETPIRSEWGCRCNDSGD 82 M2-KGENS: A/Turkey/VA/158512/02 SLLTEVETPIRKGWECNCSDSSD 83 (H7N2) M2TGEKS: A/Canada/rv504/2004 (H7N3) SLLTEVETPTRNGWECKCSDSSD 90 M2GHTGKS: A/chicken/HongKong/SF1/03 SLLTGVETHTRNGWGCKCSDSSD 91 (H9N2) M2PHTGS: A/chicken/HongKong/YU427/03 SLLPEVETHTRNGWGCRCSDSSD 92 (H9N2) - “influenza M2e antigen”: As used herein the expression “influenza M2e antigen” refers to an antigen comprising at least one epitope of the extracellular domain of the influenza A virus M2 protein. In a preferred embodiment, the term influenza M2e antigen refers to an antigen comprising at least one epitope of any one of the peptides of SEQ ID NOs 48 to 83 and 90 to 92. More preferably, the term influenza M2e antigen refers to an antigen comprising or consisting of the extracellular domain of the influenza A M2 protein. Still more preferably, the term influenza M2e antigen refers to an antigen comprising or consisting of the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, or to any consecutive stretch of at least of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 amino acids thereof. In a very preferred embodiment, the influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 50. Most preferably, said influenza M2e antigen comprises or preferably consists of the M2e consensus sequence (SEQ ID NO:48).
- The term “influenza M2e antigen” also includes conjugates, fusion or coupling products comprising at least one epitope of the extracellular domain of the influenza A virus M2 protein. This includes conjugates of the extracellular domain of the influenza A virus M2 protein with a carrier, wherein preferably said carrier is RNAse A. In particular, the term “influenza M2e antigen” also includes virus-like particles, preferably virus like particles of RNA bacteriophages, wherein an extracellular domain of the influenza A virus M2 protein is coupled to said virus like particle, preferably to said virus-like particle of a RNA bacteriophage. Preferred virus-like particles are virus-like particles of RNA bacteriophages Qβ or AP205, most preferably of RNA bacteriophage Qβ. A very preferred influenza M2e antigen is a virus-like particle of RNA bacteriophage Qβ, wherein the peptide of SEQ ID NO:48 is coupled to said virus-like particle, wherein preferably said peptide is coupled to said virus-like particle by means of a covalent non-peptide bond. The term influenza M2e antigen also includes fusion proteins comprising the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof. In particular, the term influenza M2e antigen includes fusion proteins comprising a peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92. Preferred fusion proteins are chimeric proteins, wherein said chimeric proteins comprise an extracellular domain of a first influenza A virus M2 protein and the transmembrane- and intercellular domain of a second influenza A virus M2 protein. A very preferred chimeric protein is the protein of SEQ ID NO:85.
- Furthermore, the term influenza M2e antigen includes virus particles or virus-like particles comprising the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof. Thus, influenza M2e antigen also refers to influenza virus particles or influenza virus-like particles, preferably to influenza A virus particles or influenza A virus-like particles.
- In a preferred embodiment, the term influenza M2e antigen refers to cells, preferably to eukaryotic cells, comprising the extracellular domain of the influenza A virus M2 protein on their cell surface. This includes cells which are infected by influenza virus, preferably by influenza A virus. This also includes stably transformed or transfected cells expressing a recombinant protein, wherein said protein comprises the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof, and wherein preferably said recombinant protein comprises a domain which allows the integration of said recombinant protein into the cell membrane. Preferred recombinant proteins in this context are influenza A M2 proteins or chimeric proteins, wherein said chimeric proteins comprise an extracellular domain of a first influenza A virus M2 protein and the transmembrane- and intercellular domain of a second influenza A virus M2 protein. In a preferred embodiment said recombinant protein is the protein of any one of SEQ ID NOs 84 or 85, preferably SEQ ID NO:84, wherein further preferably the N-terminal methionine residue of said recombinant proteins is cleaved off.
- In a further preferred embodiment influenza M2e antigen refers to a eukaryotic cell, preferably to a L929 cell or to a 293T cell, wherein said cell is expressing a recombinant protein, wherein said protein comprises the extracellular domain of the influenza A virus M2 protein or at least one epitope thereof, and wherein preferably said recombinant protein comprises a domain which allows the integration of said recombinant protein into the cell membrane. Preferred recombinant proteins in this context are influenza A M2 proteins or chimeric proteins, wherein said chimeric proteins comprise an extracellular domain of a first influenza A virus M2 protein and the transmembrane- and intercellular domain of a second influenza A virus M2 protein. In a preferred embodiment said recombinant protein is the protein of any one of SEQ ID NOs 84 or 85, wherein further preferably the N-terminal methionine residue of said recombinant proteins is cleaved off.
- “specifically binding”: The specificity of an antibody relates to the antibody's capability of specifically binding an antigen. The specificity of this interaction between the antibody and the antigen (affinity) is characterized by a binding constant or, inversely, by a dissociation constant (Kd). It is to be understood that the apparent affinity of an antibody to an antigen depends on the structure of the antibody and of the antigen, and on the actual assay conditions. The apparent affinity of an antibody to an antigen in a multivalent interaction may be significantly higher than in a monovalent interaction due to avidity. Thus, affinity is preferably determined under conditions favoring monovalent interactions. Kd can be determined by methods known in the art. Preferably, Kd of a given combination of antibody and antigen is determined by Friguet ELISA essentially as described (Friguet B. et al., 1985, J. Immunol. Meth. 77, 305-319), wherein a constant amount of purified antibody, for example scFv or Fab fragment, is contacted with a serial dilution of a known concentration of antigen.
- Very preferably, Kd of an antibody and an antigen in solution is determined by Friguet ELISA, wherein preferably said antibody is an scFv antibody, most preferably a scFv-msFcγ2c fusion, and wherein further preferably said antigen is an influenza M2e antigen, and wherein still more preferably said influenza M2e antigen comprises or consists of the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, most preferably of the peptide of SEQ ID NO:48. In one embodiment, said influenza M2e antigen is a conjugate of RNAse-A and of the peptide of SEQ ID NO:48. In a preferred embodiment said Friguet-ELISA is performed under conditions essentially as described in Example 11 herein. In a very preferred embodiment said Friguet-ELISA is performed under conditions essentially as described in Example 11, wherein said influenza M2e antigen is in solution, and wherein said influenza M2e antigen is SEQ ID NO:48. The affinity of a given combination of antibody and antigen may also be determined by ELISA, wherein a constant amount of immobilized antigen is contacted with a serial dilution of a known concentration of a purified antibody, preferably a scFv or Fab fragment. The affinity is then determined as the concentration of the antibody where half-maximal binding is observed (EC50). Very preferably, EC50 of an antibody and an immobilized antigen is determined by ELISA, wherein preferably said antibody is an scFv antibody, most preferably a scFv-msFcγ2c fusion, and wherein further preferably said antigen is an influenza M2e antigen, wherein preferably said influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 83, most preferably of the peptide of SEQ ID NO:48. Most preferably, said influenza M2e antigen is a conjugate of RNAse-A and of the peptide of SEQ ID NO:48. In a very preferred embodiment said ELISA is performed as described in the first paragraph of Example 4 herein. Alternatively, Kd of an interaction of an antibody and an antigen is determined by Biacore analysis as the ratio of on rate (kon) and off rate (koff). Kd may also be determined by equilibrium dialysis.
- Lower values of Kd indicate a more specific binding of the antibody to the antigen than higher values. In the context of the application, an antibody is considered to be “specifically binding an antigen”, when the dissociation constant (Kd) as determined by Friguet ELISA as described above is at most 10 nM (<=10−8 M), preferably at most 1 nM (<=10−9 M), more preferably at most 100 pM (<=10−10 M), still more preferably at most 10 pM (<=1011 M), most preferably at most 1 pM (<=10−12 M). Very preferred are antibodies capable of binding an antigen with a Kd of less than 20 pM, wherein further preferably said Kd is determined in solution. In the context of the application, an antibody is further considered to be “specifically binding an antigen”, when the EC50, preferably determined as described above is at most 1000 nM (<=10−6 M), preferably at most 100 nM (<=10−7 M), more preferably at most 10 nM (<=10−8 M), still more preferably at most 1 nM (<=10−9 M), still more preferably at most 100 pM (<=10−10 M), still more preferably at most 10 pM (<=1011 M), and most preferably at most 1 pM (<=10−12 M). Very preferred are antibodies capable of binding an antigen with a EC50 of less than 100 pM, wherein further preferably said EC50 is determined with immobilized antigen. In this context, Kd and/or EC50 values are referred to as being in the “low picomolar range” when these values are below 100 pM.
- The affinity of an antibody to influenza M2e antigen may also be determined in an experimental set-up, wherein said influenza M2e antigen is a cell, typically and preferably a living cell, and wherein said cell comprises the extracellular domain of the influenza A virus M2 protein or an epitope thereof on the cell surface. The affinity of an antibody to a cell is preferably determined by FACS technology, preferably in an experimental set-up essentially as disclosed in Examples 5 and 9 herein. It is to be understood that the EC50 values for a specific combination of antibody and cells are comparable only within the same experimental set-up relative to a control antibody. An antibody is regarded as specifically binding an influenza M2e antigen, wherein said influenza M2e antigen is a cell, when the EC50 value for the interaction between a control antibody and said influenza M2e antigen is at least 103-fold, preferably at least 104-fold, more preferably at least 105-fold, and most preferably at least 106-fold higher than the EC50 value for the interaction between said antibody and said influenza M2e antigen.
- “effective amount”: A therapeutically effective amount of a monoclonal antibody of the invention or of a pharmaceutical composition of the invention generally refers to an amount necessary to achieve, at dosages and periods of time necessary, the desired therapeutic result, wherein preferably said result is preventing, reducing or ameliorating infection with influenza virus, preferably with influenza A virus. With respect to a therapeutic treatment of a human, an “effective amount” typically refers to an amount of 1 mg to 1000 mg, preferably 10 mg to 500 mg, more preferably 10 mg to 300 mg, still more preferably 50 mg to 200 mg, and most preferably about 100 mg of said monoclonal antibody.
- “Tag”: The term tag, preferably a purification or detection tag, refers to a polypeptide segment that can be attached to a second polypeptide to provide for purification or detection of the second polypeptide or provides sites for attachment of the second polypeptide to a substrate. In principle, any peptide or protein for which an antibody or other specific binding agent is available can be used as an affinity tag. Tags include haemagglutinin tag, myc tag, poly-histidine tag, protein A, glutathione S transferase, Glu-Glu affinity tag, substance P, FLAG peptide, streptavidin binding peptide, or other antigenic epitope or binding domain (mostly taken from U.S. Pat. No. 6,686,168).
- A library-based screening method for the identification, isolation and cloning of scFv specifically binding an antigen of interest is disclosed in WO2008/055795A1. In particular, said method allows for the identification, isolation and cloning of human scFv and for the subsequent generation of fully human antibodies, including Fab fragments and whole IgG. Applying said technology, human monoclonal antibodies specifically binding influenza M2e antigen have been identified and cloned.
- In one aspect, the invention provides a monoclonal antibody, preferably an isolated monoclonal antibody, specifically binding influenza M2e antigen, wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody. In a preferred embodiment said monoclonal antibody is a recombinant monoclonal antibody.
- In a preferred embodiment said human monoclonal antibody, preferably said fully human monoclonal antibody, is not recognized by the human immune system.
- The specificity of an antibody is mainly determined by the amino acid sequence of the complementarity determining regions (CDRs) in the heavy chain variable regions (HCVR) of said antibody and/or by the CDRs in the light chain variable regions said antibody (LCVR). The invention discloses CDRs of HCVRs (HC CDRs) and CDRs of the LCVRs (LC CDRs) of monoclonal antibodies, wherein said monoclonal antibodies are capable of specifically binding influenza A M2, and wherein typically and preferably said HCVRs and said LCVRs are forming an antigen binding site.
- It has surprisingly been found that the monoclonal antibodies of the invention which are capable of specifically binding influenza M2e antigen share identical or closely related HC CDRs and/or LC CDRs in different combinations, wherein the closely related HC CDRs and/or LC CDRs differ in at most a few amino acid residues (cf. Tables 1-3). It is therefore concluded that all antibodies of Tables 1-3 are clonally related.
- Thus, in one embodiment said monoclonal antibody comprises (i) at least one, preferably exactly one, LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6, and wherein preferably said LC CDR1 is located at CDR1 position within the framework of said LCVR; (b) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7, and wherein preferably said LC CDR2 is located at CDR2 position within the framework of said LCVR; (c) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11, and wherein preferably said LC CDR3 is located at CDR3 position within the framework of said LCVR; and/or said monoclonal comprises (ii) at least one, preferably exactly one HCVR, wherein said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12, and wherein preferably said HC CDR1 is located at CDR1 position within the framework of said HCVR; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14, and wherein preferably said HC CDR2 is located at CDR2 position within the framework of said HCVR; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19, and wherein preferably said HC CDR3 is located at CDR3 position within the framework of said HCVR.
- In a further embodiment said monoclonal antibody comprises (i) at least one, preferably exactly one, LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - Typically and preferably, said monoclonal antibody comprises exactly one LCVR and exactly one HCVR, which are preferably forming an antigen binding site. In case of an antibody in the IgG format, said monoclonal antibody comprises exactly two LCVR and exactly two HCVR. However, the antibody of the invention may also comprise or alternatively consist of only one LCVR or of only one HCVR. Thus, in a further preferred embodiment said monoclonal antibody comprises or alternatively consists of at least one, preferably exactly one, LCVR, wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs - In a further preferred embodiment said monoclonal antibody comprises or alternatively consists of at least one, preferably exactly one HCVR, wherein said HCVR comprises: (a) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of
SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - Typically and preferably the antibodies of the invention comprise at least on antigen binding site comprising one LCVR and one HCVR, wherein said antigen binding site recognizes an epitope of influenza A M2e antigen. One aspect of the invention therefore is an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein preferably said monoclonal antibody is a human monoclonal antibody, more preferably a fully human monoclonal antibody, and wherein said antibody comprises at least one antigen binding site, wherein said antigen binding site comprises: (a) one LCVR, wherein said LCVR comprises: (i) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (ii) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO:7; and (iii) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11; and (b) one HCVR, wherein said HCVR comprises: (i) one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (ii) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (iii) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
- Based on sequence similarities between the amino acid sequences of LC CDR1 and LC CDR3 three closely relates groups of antibodies can be distinguished (cf. Table 1). Thus, in one embodiment said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - In a further embodiment LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - In a further embodiment, said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - Among the antibodies of the invention nine different types of LCVRs were identified comprising different combinations of LC CDR sequences (cf. Table 1). Thus, in a preferred embodiment said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (b) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:2, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (c) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:3, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (d) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:9; (e) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:10; (f) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:4, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (g) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:5, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (h) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:6, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; and (i) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:11.
- Among the antibodies of the invention the most abundant combinations of LC CDRs are types 1A, 1A and 3A (cf. Table 1). Thus, in a preferred embodiment said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (b) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:4, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; and (c) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:6, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8. In a very preferred embodiment, said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8.
- Antibodies obtained from library screening may differ from fully human antibodies in certain amino acid positions of the VRs due to cloning artifacts, wherein typically these positions are located near the N- and/or C-terminus of the variable region. Preferably, these artifacts are removed from the antibody in order to obtain fully human antibodies. For example, in order to obtain fully human LCVRs,
position 1 to 4 of the LCVRs is replaced by SEQ ID NO:24. Thus, in apreferred embodiment position 1 to 4 of said LCVR consists of SEQ ID NO:24. - In a preferred embodiment said LCVR comprises or preferably consists of any one of the amino acid sequences depicted in
FIG. 1 . In a further preferredembodiment position 5 to 113 of said LCVR consists of the peptide of any one ofSEQ ID NOs 20, 21 and 22, wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24. - In a further preferred
embodiment position 5 to 113 of said LCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of any one of SEQ ID NOs 86, 87, and 88, wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24. - Furthermore, among the antibodies of the invention six different types of HCVRs were identified comprising different combinations of HC CDR sequences (cf. Table 2). Thus, in a preferred embodiment said HCVR is selected from: (a) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:15; (b) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:16; (c) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:17; (d) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:18; (e) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:14, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:15; and (f) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:19.
- Among the antibodies of the invention the most abundant combination of HC CDRs is type 1A (cf. Table 2). Thus, in a preferred embodiment said HCVR is selected from: (a) a HCVR, wherein (i) said HC CDR1 consists of the peptide of SEQ ID NO:12, (ii) said HC CDR2 consists of the peptide of SEQ ID NO:13, and (iii) said HC CDR3 consists of the peptide of SEQ ID NO:15;
- In order to remove cloning artifacts and to obtain fully human HCVRs, typically and preferably
position 1 to 6 of the HCVRs is replaced by SEQ ID NO:25. Thus, in apreferred embodiment position 1 to 6 of said HCVR consists of SEQ ID NO:25. - In a preferred embodiment said HCVR comprises or preferably consists of any one of the amino acid sequences depicted in
FIG. 2 . In a further preferred embodiment position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, wherein preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. In a further preferred embodiment position 7 to 121 of said HCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of SEQ ID NO:89, wherein preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - Among the antibodies of the invention fourteen different combinations of LC CDRs and HC CDRs were identified (cf. Table 2). Thus in one embodiment said monoclonal antibody comprises at least one, preferably exactly one antigen binding site, wherein the combination of LC CDRs and HC CDRs is selected from any one of the combinations of Table 3. Preferably said combination is chosen from one of the most abundant combinations 1A-1A, 1A-1B, 2A-1A, and 3A-1A.
- In a very preferred embodiment said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs - In a very preferred embodiment said LC CDR1 consists of the peptide of SEQ ID NO:1, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a very preferred embodiment said LC CDR1 consists of the peptide of SEQ ID NO:1, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:16.
- In a very preferred embodiment said LC CDR1 consists of the peptide of SEQ ID NO:4, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a very preferred embodiment said LC CDR1 consists of the peptide of SEQ ID NO:6, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a preferred embodiment said LCVR comprises a peptide, wherein said peptide consists of any one of the amino acid sequences depicted in
FIG. 1 ; and said HCVR comprises a peptide, wherein said peptide consists of any one of the amino acid sequences depicted inFIG. 2 . - In a very preferred embodiment LCVR comprises a peptide, wherein said peptide consists of any one of the amino acid sequences depicted in
FIG. 1 ; and said HCVR comprises a peptide, wherein said peptide consists the amino acid sequence depicted inFIG. 2 , wherein said amino acid sequence depicted inFIG. 2 has the same designator as the amino acid sequence depicted inFIG. 1 . The designator is a character followed by three digits (e.g. D005). - In a preferred embodiment said antigen binding site comprises one LCVR and one HCVR, (a) wherein
position 5 to 113 of said LCVR consists of the peptide of any one ofSEQ ID NOs 20, 21 and 22, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - In a preferred embodiment said antigen binding site comprises one LCVR and one HCVR, (a) wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:20, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - In a preferred embodiment said antigen binding site comprises one LCVR and one HCVR, (a) wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:21, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - In a preferred embodiment said antigen binding site comprises one LCVR and one HCVR, (a) wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:22, and (b) wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, and wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - In a further preferred embodiment said antigen binding site comprises one LCVR and one HCVR, (a) wherein
position 5 to 113 of said LCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of any one of SEQ ID NOs 86, 87 and 88, and (b) wherein position 7 to 121 of said HCVR consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of SEQ ID NO:89, and wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24, and/or wherein further preferablyposition 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - In a further preferred
embodiment position 5 to 113 of said LCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to the peptide of any one ofSEQ ID NOs 20, 21, and 22, preferably to the peptide of SEQ ID NO:24; and position 7 to 121 of said HCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to the peptide of SEQ ID NO:23. - In a further preferred embodiment said LCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to any one of the amino acid sequences depicted in
FIG. 1 ; and said HCVR is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to any one of the amino acid sequences depicted inFIG. 2 . - In a further preferred embodiment said LCVR is at least 95%, preferably at least 96%, more preferably 97%, still more preferably 98%, still more preferably 99%, and most preferably 100% identical to any one of the amino acid sequences depicted in
FIG. 1 ; and wherein said HCVR is at least 95%, preferably at least 96%, more preferably 97%, still more preferably 98%, still more preferably 99%, and most preferably 100% identical to any one of the amino acid sequences depicted inFIG. 2 . - In a further preferred embodiment the differences in the amino acid sequences referred to above are located outside of the CDR positions of said LCVR and/or of said HCVR. Whether the amino acid sequence of a peptide or polypeptide has an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to another, can be determined conventionally using known computer programs such the Bestfit program.
- A monoclonal antibody of the invention can be recombinantly produced in any naturally occurring or synthetic format. The following embodiments thus explicitly refer to all aspects and embodiments of the invention. In one embodiment said monoclonal antibody is a recombinant antibody. In a preferred embodiment the monoclonal antibody of the invention is an antibody selected from the group consisting of: (a) single chain antibody, preferably scFv; (b) Fab fragment; (c) F(ab′)2 fragment; (d) scFv-Fc fusion; (e) IgG1; (f) IgG2; (g) IgG3; (h) IgG4; (i) IgA; (j) IgE; (k) IgM; (l) IgD; and (m) diabody. In a preferred embodiment said monoclonal antibody comprises or preferably consists of exactly one LCVR and/or of exactly one HCVR.
- In a further preferred embodiment said monoclonal antibody is a single chain antibody, wherein preferably said single chain antibody is an scFv. In a further preferred embodiment said single chain antibody comprises or preferably consists of a peptide, wherein said peptide is encoded by the nucleic acid sequence of any one of
SEQ ID NOs 38 to 40. In a further preferred embodiment said single chain antibody is an Fc-fusion, preferably a Fcγ2c fusion, wherein further preferably said Fcγ2c fusion comprises or preferably consists of the a peptide, wherein said peptide is encoded by any one of SEQ ID NOs 42, 44, and 46. In a further preferred embodiment said single chain antibody comprises the peptide of any one of SEQ ID NOs 43, 45, and 47. - In a further preferred embodiment said monoclonal antibody is an IgG, preferably a human IgG. In a further preferred embodiment said monoclonal antibody is a IgG1, preferably a human IgG1. In a further preferred embodiment said monoclonal antibody comprises at least one, preferably exactly two, kappa LC(s), wherein preferably said kappa LC(s) comprise(s) or more preferably consist(s) of a peptide, wherein said peptide is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to any one of SEQ ID NOs 26 to 28. In a further preferred embodiment said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or preferably consist(s) of the peptide of any one of SEQ ID NOs 26 to 28.
- In a further preferred embodiment said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein preferably saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of a peptide, wherein said peptide is at least 80%, preferably 85%, more preferably 90%, again more preferably 95%, even more preferably at least 96%, still more preferably 97%, again still more preferably 98%, again still more preferably 99% and most preferably 100% identical to SEQ ID NO:29. In a further preferred embodiment saidgamma 1 HC(s) comprise(s) or preferably consist(s) of the peptide of SEQ ID NO:29. - In a very preferred embodiment said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of a peptide of any one of SEQ ID NOs 26 to 28, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - In a very preferred embodiment said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:26, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - In a very preferred embodiment said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:27, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - In a very preferred embodiment said monoclonal antibody is a human IgG1, wherein said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:28, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - Preferably, the monoclonal antibody of the invention is an IgG1, preferably a human IgG1, most preferably a fully human IgG1. Thus, in a preferred embodiment said monoclonal antibody comprises two, preferably exactly two, of said
gamma 1 HCs, wherein further preferably said two, preferably said exactly two of saidgamma 1 HCs are identical. - In a further preferred embodiment said monoclonal antibody comprises two, preferably exactly two LCs, wherein preferably said LCs are selected from (a) lambda LC; and (b) kappa LC, most preferably kappa LC; wherein still further preferably said two, preferably said exactly two of said LCs are identical.
- In a preferred embodiment said monoclonal antibody, preferably said isolated monoclonal antibody, is specifically binding influenza M2e antigen, wherein said influenza M2e antigen comprises or consists of at least one epitope of the extracellular domain of the influenza A M2 protein. In a further preferred embodiment said influenza M2e antigen comprises or consists of the extracellular domain of the influenza A M2 protein, preferably of
amino acids 2 to 24 of the influenza A M2 protein. In a further preferred embodiment, said influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, wherein preferably said influenza M2e antigen comprises or preferably consists of the peptide of any one of SEQ ID NOs 48 to 50, and wherein most preferably said influenza M2e antigen comprises or preferably consists of the peptide of SEQ ID NO:48. - In a further preferred embodiment, said influenza M2e antigen comprises or consists of at least one epitope of SEQ ID NO:48, preferably said influenza M2e antigen comprises or consists of an epitope comprised by the amino acid sequence of SEQ ID NO:93.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the EC50 value and/or the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 1000 nM (<=10−6 M), preferably at most 100 nM (<=10−7 M), more preferably at most 10 nM (<=10−8 M), still more preferably at most 1 nM (<=10−9 M), still more preferably at most 100 pM (<=10−10 M), still more preferably at most 10 pM (<=10−11 M), and most preferably at most 1 pM (<=10−12 M), wherein preferably said influenza M2e antigen is the extracellular domain of influenza A M2 protein, wherein preferably said influenza M2e antigen is the peptide of any one of SEQ ID NOs 48 to 83, more preferably of any one of SEQ ID NOs 48 to 50, and most preferably of SEQ ID NO:48, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and/or wherein said EC50 value is determined by ELISA, preferably under conditions essentially as described in the first paragraph of Example 4 herein.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 100 nM, preferably at most 10 nM, more preferably at most 6 nM and most preferably at most 5 nM, wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, wherein further preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 0.01 pM to 1000 nM, preferably 0.1 pM to 100 nM, more preferably 0.1 pM to 10 nM, still more preferably 0.1 pM to 1 nM, still more preferably 0.1 pM to 100 pM, still more preferably 0.1 pM to 50 pM, still more preferably 0.1 pM to 20 pM, still more preferably 0.1 pM to 15 pM, still more preferably 1 pM to 15 pM, and most preferably 1 pM to 10 pM, wherein preferably said influenza M2e antigen is an RNAse conjugate of the extracellular domain of influenza A M2 protein, most preferably in solution, wherein further preferably said influenza M2e antigen comprises the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92, more preferably of any one of SEQ ID NOs 48 to 50, and most preferably of SEQ ID NO:48, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11.
- In a further preferred embodiment the said monoclonal antibody is specifically binding influenza M2e antigen, wherein said influenza M2e antigen is a cell comprising at least one epitope of the extracellular domain of influenza A M2 protein on its cell surface.
- In a further preferred embodiment the said monoclonal antibody is specifically binding influenza M2e antigen, wherein said influenza M2e antigen is a cell comprising the extracellular domain of influenza A M2 protein on its cell surface.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein further preferably said LC CDR1 consists of the peptide of any one of
SEQ ID NOs - In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:1, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein
position 5 to 113 of said LCVR consists of the peptide of any one ofSEQ ID NOs 20, 21 and 22. - In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23.
- In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5 nM, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein
position 5 to 113 of said LCVR consists of the peptide of any one ofSEQ ID NOs 20, 21 and 22, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23. - In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23. - In a further preferred embodiment said monoclonal antibody is specifically binding influenza M2e antigen, wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is 1 to 100 nM, preferably 1 to 10 nM, more preferably 1 to 6 nM, still more preferably 3 to 6 nM, and most preferably 4 to 5, and wherein preferably said influenza M2e antigen is SEQ ID NO:48, most preferably in solution, and wherein still further preferably said Kd is determined by Friguet-ELISA, most preferably under conditions essentially as described in Example 11, and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of a peptide of any one of SEQ ID NOs 26 to 28, preferably SEQ ID NO:20, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - An epitope mapping revealed that the minimal epitope which is recognized by an antibody of the invention is comprised in the amino acid sequence LLTEVETP (SEQ ID NO:93) of the M2e consensus sequence (SEQ ID NO:48). It has been shown that an antibody of the invention is capable of recognizing variants of this epitope occurring in M2e of other influenza A genotypes (see
FIG. 8A ). - In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:1, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23. - In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:26, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:4, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:21, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23. - In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:27, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein further preferably said LC CDR1 consists of the peptide of SEQ ID NO:6, said LC CDR2 consists of the peptide of SEQ ID NO:7, said LC CDR3 consists of the peptide of SEQ ID NO:8, said HC CDR1 consists of the peptide of SEQ ID NO:12, said HC CDR2 consists of the peptide of SEQ ID NO:13, and said HC CDR3 consists of the peptide of SEQ ID NO:15.
- In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein
position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO:22, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23. - In a further preferred embodiment said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO:93), and wherein said monoclonal antibody is a human IgG, preferably a human IgG1, wherein preferably said human IgG1 comprises at least one, preferably exactly two, kappa LC(s), wherein said kappa LC(s) comprise(s) or more preferably consist(s) of the peptide of SEQ ID NO:28, and wherein said monoclonal antibody comprises at least one, preferably exactly two,
gamma 1 HC(s), wherein saidgamma 1 HC(s) comprise(s) or more preferably consist(s) of the of SEQ ID NO:29. - It is to be understood that it is well within the skill of the artisan to use a HCVR of a first antibody specifically binding influenza M2e antigen, to select a corresponding LCVR from a suitable source, and to create a second antibody, wherein said second antibody comprises said HCVR of said first antibody and the selected LCVR, and wherein said second antibody is capable of binding influenza A Me2 antigen with about the same specificity as said first antibody (“chain shuffling”). It is furthermore apparent for the artisan that in an analogous manner the LCVR of a first antibody can be used to select a corresponding HCVR from a suitable source. Suitable sources for the amplification of LCVRs and/or HCVRs are, for example, cDNA from naive human B cells, cDNA from B cells of a human subject immunized with an influenza M2e antigen, and fully synthetic libraries, such as Morphosys' HuCAL library. These methods are described in detail in Kang A S et al. (Proc Natl Acad Sci USA 88, 11120-11123, 1991), Marks J D et al. (Biotechnology (N Y) 10, 779-783, 1992), and Jespers et al. (Biotechnology (NY) 12, 899-903, 1994).
- Thus, a further aspect of the invention is a LCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, most preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said LCVR comprises: (a) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs SEQ ID NOs - In a preferred embodiment said LCVR is selected from: (a) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (b) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:2, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (c) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:3, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (d) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:9; (e) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:10; (f) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:4, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (g) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:5, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; (h) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:6, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:8; and (i) a LCVR, wherein (i) said LC CDR1 consists of the peptide of SEQ ID NO:1, (ii) said LC CDR2 consists of the peptide of SEQ ID NO:7, and (iii) said LC CDR3 consists of the peptide of SEQ ID NO:11.
- In a very
preferred embodiment position 5 to 113 of said LCVR consists of the peptide of any one ofSEQ ID NOs 20, 21 and 22, most preferably SEQ ID NO:20, wherein preferablyposition 1 to 4 of said LCVR consists of the peptide of SEQ ID NO:24. - A further aspect of the invention is a HCVR of a monoclonal antibody, wherein said monoclonal antibody is a human monoclonal antibody, preferably a fully human monoclonal antibody, and wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said HCVR comprises: one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of
SEQ ID NOs 13 and 14; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one ofSEQ ID NOs - In a further preferred embodiment, said HCVR comprises: one HC CDR1, wherein said HC CDR1 consists of the peptide of SEQ ID NO:12; (b) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NO:13; and (c) one HC CDR3, wherein said HC CDR3 consists of the peptide of SEQ ID NO:15. In a preferred embodiment position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23, wherein preferably
position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO:25. - All aspects of the invention, and hereby in particular the pharmaceutical compositions, methods and uses, which are disclosed in the following, relate to any one of the monoclonal antibodies disclosed herein. However, embodiments which relate to the antibody clones D005, E040 and F052 are preferred, and hereby in particular clone D005. Especially preferred are therefore embodiments, wherein said monoclonal antibody comprises at least one antigen binding site, wherein said antigen binding site comprises: (a) one LCVR, wherein said LCVR comprises: (i) one LC CDR1, wherein said LC CDR1 consists of the peptide of any one of
SEQ ID NOs position 5 to 113 of said LCVR consists of the peptide of any one ofSEQ ID NOs 20, 21 and 22, preferably of SEQ ID NO:20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO:23. Still more preferred are embodiments, wherein said monoclonal antibody is an IgG1, and wherein said monoclonal antibody comprises at least one light chain, and wherein said monoclonal antibody further comprises at least one heavy chain, wherein said light chain comprises or preferably consists of the amino acid sequence of any one ofSEQ ID NOs 26, 27, and 28, preferably of SEQ ID NO:26, and wherein said heavy chain comprises or preferably consists of the amino acid of SEQ ID NO:29. - In a further aspect, the invention relates a nucleic acid molecule encoding a HCVR or a LCVR of the invention, a monoclonal antibody of the invention or an individual chain thereof. In a preferred embodiment said nucleic acid molecule is encoding a peptide selected from (a) a LCVR of the invention, wherein preferably said LCVR comprises or preferably consists of any one of the peptides depicted in
FIG. 1 ; (b) a LCVR, wherein said LCVR comprises or preferably consists of the peptide of any one ofSEQ ID NOs 20, 21, and 22; (c) a HCVR of the invention, wherein preferably said HCVR comprises or preferably consists of any one of the peptides depicted inFIG. 2 ; (d) a HCVR, wherein said HCVR comprises or preferably consists of the peptide of SEQ ID NO:23; (e) a single chain antibody of the invention, wherein preferably said single chain antibody comprises or preferably consists of the peptide of any one of SEQ ID NOs 43, 45 and 47; (f) a kappa LC of the invention, wherein preferably said kappa LC comprises or preferably consists of the peptide of any one ofSEQ ID NOs 26, 27, and 28; (g) agamma 1 HC of the invention, wherein preferably saidgamma 1 HC comprises or preferably consists of the peptide of SEQ ID NO:29; and (h) a monoclonal antibody of the invention. - In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 86 to 89. In a further preferred embodiment said nucleic acid molecule comprises the nucleotide sequence of any one of SEQ ID NOs 86 to 88, and wherein said nucleic acid molecule further comprises the nucleotide sequence of SEQ ID NO:89.
- In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of
SEQ ID NOs SEQ ID NOs - In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of
SEQ ID NOs - In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of SEQ ID NO:41.
- In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 42, 44, and 46. In a further preferred embodiment said nucleic acid molecule comprises or preferably consists of the nucleotide sequence of any one of SEQ ID NOs 42, 44, and 46.
- In a further aspect, the invention relates to an expression vector for the recombinant expression of an antibody of the invention. In a preferred embodiment, said expression vector comprises at least one nucleic acid molecule of the invention. Expression vectors suitable for the expression of the monoclonal antibodies of the invention are disclosed, for example, in WO2008/055795A1. In a preferred embodiment said expression vector comprises the nucleotide sequence of any one of SEQ ID NOs 86 to 89. In a further preferred embodiment said expression vector comprises the nucleotide sequence of any one of SEQ ID NOs 86 to 88, wherein preferably said expression vector further comprises the nucleotide sequence of SEQ ID NO:89. In a further preferred embodiment said expression vector comprises the nucleotide sequence of SEQ ID NO:41.
- In a further aspect, the invention relates to a host cell comprising at least one nucleic acid molecule or at least one expression vector of the invention, wherein preferably said host cell is a bacteria cell or an eukaryotic cell. In a preferred embodiment said host cell is a eukaryotic cell selected from (a) yeast cell, (b) insect cell; and (c) mammalian cell, wherein preferably said mammalian cell is selected from HEK-293T cell, CHO cell, and COS cell. Very preferably, said mammalian cells is a HEK-293T cell.
- In a further aspect, the invention relates to the monoclonal antibody of the invention for use as a pharmaceutical.
- The monoclonal antibody of the invention can be incorporated into compositions suitable for administration to a subject. Thus, in a further aspect, the invention relates to a pharmaceutical composition comprising at least one monoclonal antibody of the invention, wherein preferably said pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent or excipient. Pharmaceutically acceptable carriers, diluents and excipients are disclosed, for example, in Remington, The Science and Practice of Pharmacy, 19th edition, Gennaro (ed.), Mack publishing Co., Easton, Pa., 1995. Pharmaceutical compositions of the invention are administered in a single dose or in multiple doses.
- In a preferred embodiment said pharmaceutical composition further comprises at least one further antibody, wherein preferably said at least one further antibody is specifically binding an influenza antigen, preferably an influenza M2e antigen.
- In a further preferred embodiment said pharmaceutical composition further comprises at least one further antibody, wherein preferably said at least one further antibody is specifically binding an influenza antigen, wherein said influenza antigen is an antigen of influenza A virus HA protein or an antigen of influenza A virus NA protein.
- The monoclonal antibodies of the invention may be used in passive immunization, preferably of humans, and further preferably against influenza A virus. The monoclonal antibodies of the invention are therefore useful in the treatment and/or prophylaxis of influenza A infection. In a further aspect, the invention relates to a method of passive immunization, preferably against influenza A virus, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention.
- The monoclonal antibody and/or the pharmaceutical composition of the invention are preferably administered to a subject, preferably to a human, using standard administration techniques, preferably selected from oral administration, intravenous administration, intraperitoneal administration, subcutaneous administration, pulmonary administration, transdermal administration, intramuscular administration, intranasal administration, buccal administration, sublingual administration, and suppository administration.
- In a further aspect, the invention relates to a method of treating influenza A virus infection, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said subject is a human, and wherein further preferably said subject suffers from influenza A virus infection.
- In a further aspect, the invention relates to a method of preventing influenza A virus infection, said method comprising administering to a subject an effective amount of the monoclonal antibody of the invention or an effective amount of the pharmaceutical composition of the invention, wherein preferably said subject is a human, and wherein further preferably said subject is not infected with influenza A virus.
- In a further aspect, the invention relates to the monoclonal antibody of the invention or to the pharmaceutical composition of the invention, for use in passive immunization, preferably against influenza A virus, preferably in a human, wherein further preferably said monoclonal antibody is to be administered to said human.
- In a further aspect, the invention relates to the monoclonal antibody of the invention or to the pharmaceutical composition of the invention, for use in a method of treatment and/or prophylaxis of influenza A virus infection, preferably in a human.
- In a further aspect, the invention relates to the use of the monoclonal antibody of the invention in the manufacture of a medicament for passive immunization, preferably against influenza A virus.
- In a further aspect, the invention relates to a monoclonal antibody of the invention for use in passive immunization, preferably against influenza A virus.
- In a further aspect, the invention relates to the use of the monoclonal antibody of the invention in the manufacture of a medicament for the treatment and/or prophylaxis of influenza A virus infection, preferably in a human.
- In a further aspect, the invention relates to a monoclonal antibody of the invention for use in a method of treating or preventing influenza A virus infection, preferably in a human.
- A further aspect of the invention is the use of an antibody of the invention in a method of quantitative and/or qualitative detection of influenza A virus M2 protein, preferably in a blood sample and most preferably by ELISA.
- It is to be understood that the all aspects of the invention relate to any monoclonal antibody which is disclosed herein.
- Peripheral blood mononuclear cells (PBMC) were isolated from 10 ml of heparinized blood of an individual with high M2-titers using the BD Vacutainer™ CPT™ Tube method (BD Biosciences, Franklin Lakes, N.J.). PBMC were pre-incubated with Alexa 647 nm-labeled Qβ (5.5 μg/ml) and human gamma globulin (11 μg/ml; Jackson ImmunoResearch) and then stained with: (1) an M2 extracellular domain consensus peptide (M2e; SEQ ID NO:48, cf. Table 7) coupled to Qβ (2.4 μg/ml) in combination with a Alexa 488 nm-labeled Qβ-specific mouse mAb (2 μg/ml), as well as a M2-specific mouse mAb (0.5 μg/ml) in combination with FITC-labeled donkey anti-mouse IgG antibody (1 μg/ml; Jackson ImmunoResearch); (2) PE-labeled mouse anti-human IgM (diluted 1:50; BD Biosciences/Pharmingen), mouse anti-human IgD (diluted 1:100; BD Biosciences/Pharmingen), mouse anti-human CD14 (diluted 1:50; BD Biosciences/Pharmingen), and mouse anti-human CD3 (diluted 1:50; BD Biosciences/Pharmingen) antibodies; and (3) PE-TexasRed-labeled mouse anti-human CD19 antibody (diluted 1:50; Caltag Laboratories). After staining, cells were washed and filtered, and 334 M2e-specific B cells (FL1-positive, FL2-negative, FL3-positive, FL4-negative) were sorted on a FACSVantage® SE flow cytometer (Becton Dickinson).
- Antigen-specific B cells were used for the construction of a Sindbis-based scFv cell surface display library essentially as described (see WO 1999/025876 A1 for Sindbis-based screening in general and WO 2008/055795 A1 for its application in antibody screening, the entirety of which is incorporated herein by reference). Cells displaying M2e-specific scFv antibodies were isolated using M2e coupled to RNase A (5 μg/ml) in combination with an RNase-specific rabbit polyclonal antibody (2.5 μg/ml; Abcam) and a FITC-labeled donkey anti-rabbit IgG antibody (1.5 μg/ml; Jackson ImmunoResearch) or using (Qβ-M2e (1 μg/ml) in combination with a M2-specific mouse mAb (0.5 μg/ml) and FITC-labeled donkey anti-mouse IgG antibody (1 μg/ml; Jackson ImmunoResearch). Each cell was sorted into a well of a 24-well plate containing 50% confluent BHK feeder cells. Upon virus spread (2 days post sorting), the infected cells were tested by FACS analysis for M2e-binding to identify virus clones encoding M2e-specific scFv antibodies.
- The supernatants of BHK cells encoding putative M2e-specific antibodies, each containing a monoclonal recombinant Sindbis virus, were subjected to RT-PCR as described (see WO 2008/055795 A1). The resulting PCR products, each comprising a scFv coding region, were digested with the restriction endonuclease Sfi1 and cloned into the expression vector pCEP-SP-Sfi-Fc (disclosed as SEQ ID NO:37 in WO 2008/055795 A1), allowing for expression of scFv proteins fused to a C-terminal human Fc-γ1 domain under the control of a CMV promoter.
- For ELISA analysis, each of the clones was transfected into HEK-293T cells in a 24-well plate format, using Lipofectamine 2000 (Invitrogen) according to the manufacturer's recommendations. 2-3 days post transfection, supernatants containing transiently expressed scFv-Fc fusion proteins were harvested. To check for M2e-specific binding, ELISA plates were coated with M2e-conjugated RNAse A at a concentration of 4 μg/ml in phosphate-buffered saline (PBS) over night at 4° C. In parallel, scFv-Fc expression levels were monitored in by sandwich ELISA. For this, an identical set of plates was coated with Fcγ-specific, goat anti-human F(ab′)2 antibody (Jackson ImmunoResearch Laboratories 109-006-098) at a concentration of 2.5 μg/ml. The plates were then washed with wash buffer (PBS/0.05 Tween) and blocked for 2 h at room temperature with 3% BSA in wash buffer. The plates were then washed again and incubated with 3-fold serial dilutions of the cell culture supernatants, starting at a dilution of 1/10. All dilutions were done in wash buffer. Plates were incubated at room temperature for 2 h and then extensively washed with wash buffer. Bound scFv-Fc fusion proteins were then detected by a 1 h incubation with a HRPO-labeled, Fcγ-specific, goat anti-human IgG antibody (Jackson ImmunoResearch Laboratories 109-035-098). After extensive washing with wash buffer, plates were developed with OPD solution (1 OPD tablet, 25 ml OPD buffer and 8
μl 30% H2O2) for 5 to 10 min and the reaction was stopped with 5% H2SO4 solution. Plates were then read at OD 450 nm on an ELISA reader (Biorad Benchmark). - In total, 53 ELISA-positive clones encoding M2e-specific scFv antibodies, each binding with an EC50 in the range of 2 to 10 ng/ml (approximately 18 to 90 pM), were sequenced as described (see WO 2008/055795 A1). All antibody sequences were very similar and obviously clonally related, with heavy chain variable regions comprising VH3 family sequences and light chain variable regions comprising VK4 family sequences. The amino acid sequences of the light chains of all 53 clones are depicted in
FIG. 1 . The amino acid sequences of the heavy chains of the same clones are depicted inFIG. 2 . An overview about the CDR sequences, including references to the SEQ ID NOs, of the light and heavy chains of these antibodies is provided in Tables 1 and 2. The combinations of LCVRs and HCVRs observed in the clones, and the frequency of each of these combinations, are disclosed in Table 3. - The clones D005, E040 and F052 represent three of most abundant combinations of LCVR and HCVR (1A-1A, 2A-1A, and 3A-1A, cf. Table 3) and were thus chosen as representative clones for further analysis.
- To investigate the effect of M2e-specific human antibodies on Influenza A infection in a mouse model, clones D005, E040 and F052 were expressed and purified as scFv-mouse Fc-γ2c (msFcγ2c) fusion proteins. The nucleotide sequences encoding the D005, E040 and F052 scFv-mouse Fc-γ2c (msFcγ2c) fusion proteins correspond to SEQ ID NOs:42, 44 and 46, respectively. The amino acid sequences of the D005, E040 and F052 scFv-mouse Fc-γ2c (msFcγ2c) fusion proteins correspond to SEQ ID NOs: 43, 45 and 47, respectively. The corresponding scFv coding regions were excised from the pCEP-SP-Sfi-Fc expression vectors with the restriction endonuclease Sfi1 and the resulting fragments were cloned into the expression vector pCEP-SP-Sfi-msFcγ2c (SEQ ID NO:41). The Sfi-digested fragments of monoclonal antibodies D005, E042, and F052 correspond to
SEQ ID NOs - Large-scale expression of scFv-msFcγ2c fusion proteins was done in HEK-293T cells. One day before transfection, 107 293T cells were plated onto a 14 cm tissue culture plate for each protein to be expressed. Cells were then transfected with the respective scFv-msFcγ2c fusion construct using Lipofectamine Plus (Invitrogen) according to the manufacturer's recommendations, incubated one day, and replated on three 14 cm dishes in the presence of 1 μg/ml puromycin. After three days of selection, puromycin-resistant cells were transferred to six 14 cm plates and grown to confluency. Finally, cells were transferred to a poly-L-lysine coated roller bottle. After 1-2 days medium was replaced by serum-free medium and supernatants containing the respective scFv-msFcγ2c fusion protein was collected every 3 days and filtered through a 0.22 μm Millex GV sterile filter (Millipore).
- For each of the scFv-msFcγ2c fusion proteins, the consecutive harvests were pooled and applied to a protein A-sepharose column. The column was washed with 10 column volumes of phosphate-buffered saline (PBS), and bound protein eluted with 0.1 M Glycine pH 3.6. 1 ml fractions were collected in tubes containing 0.1 ml of 1 M Tris pH 7.5 for neutralization. Protein-containing fractions were analyzed by SDS-PAGE and pooled. The buffer was exchanged with PBS by dialysis using 10,000 MWCO Slide-A-Lyzer dialysis cassettes (Pierce). The purified proteins in PBS were then filtered through 0.22 μm Millex GV sterile filters (Millipore) and aliquotted. Working stocks were kept at 4° C., whereas aliquots for long-term storage were flash-frozen in liquid nitrogen and kept −80° C.
- To confirm binding of scFv-msFcγ2c fusion proteins to M2e, an ELISA analysis was carried out with purified scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c. Thus, ELISA plates were coated with M2e (SEQ ID NO:48) conjugated to RNAse A at a concentration of 4 μg/ml in phosphate-buffered saline (PBS), one hour at 37° C. The plates were then washed with wash buffer (PBS/0.05% Tween) and blocked for 1 h at 37° C. with 3% BSA in wash buffer. The plates were then washed again and incubated with serial dilutions of purified scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c. Plates were incubated at room temperature for 1.5 h at 37° C. and then extensively washed with wash buffer. Bound scFv-Fc fusion proteins were then detected by a 1 h incubation at room temperature with a HRPO-labeled, Fcγ-specific, goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories 115-035-071). After extensive washing with wash buffer, plates were developed with OPD solution (1 OPD tablet, 25 ml OPD buffer and 8
μl 30% H2O2) for 10 min and the reaction was stopped with 5% H2SO4 solution. Plates were then read at OD 450 nm on an ELISA reader (Biorad Benchmark). The antibodies scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c were found to bind immobilized M2e with a high apparent affinity. The apparent affinity of the same antibodies towards immobilized M2e-short (SEQ ID NO:49) and M2e-VN (SEQ ID NO:50) was determined using the same experimental set-up. The apparent affinities for each combination of antibody and antigen are provided in Table 5. These values correspond well with the ones obtained with unpurified culture supernatants (described in Example 2). -
TABLE 5 Apparent affinities of scFv-D005-msFcγ2c, scFv- E040-msFcγ2c and scFv-F052-msFcγ2c towards different versions of influenza M2 extracellular domain. Antibody M2e M2e-short M2e-VN D005 81.5 pM 80.9 pM 51.5 pM E040 88.3 pM 90.2 pM 46.4 pM F052 50.6 pM 62.8 pM 45.9 pM - To further investigate binding of the scFv-msFcγ2c fusion proteins to different M2-derived peptides, also a competition ELISA was carried out. Thus, ELISA plates were coated with M2e conjugated to RNAse A at a concentration of 4 μg/ml in phosphate-buffered saline (PBS), over night at 4° C. The plates were then washed with wash buffer (PBS/0.05% Tween) and blocked for 2 h at 37° C. with 3% BSA in wash buffer. The plates were then washed again and incubated with purified scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c at a concentration of 100 ng/ml in the absence or presence of increasing concentrations of M2e, an M2 extracellular domain peptide derived from H5N1 Influenza A VN1203 (M2e-VN; SEQ ID NO:50), or a shortened M2e peptide (M2e-short; SEQ ID NO:49) (Table 7). Plates were incubated at room temperature for 2 h and then extensively washed with wash buffer. Bound scFv-Fc fusion proteins were then detected by a 1 h incubation with a HRPO-labeled, Fcγ-specific, goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories 115-035-071). After extensive washing with wash buffer, plates were developed with OPD solution and read on an ELISA reader as described above. Binding of each of the antibodies to immobilized M2e was inhibited by all three peptides to a similar extent, indicating that all three peptides were recognized equally well (Table 6).
-
TABLE 6 Inhibition of scFv-msFcγ2c binding to immobilized M2e by soluble M2 peptides. EC50 values (μM) of inhibition of binding are shown. scFv-msFcγ2c M2e M2e-VN M2e-short D005 18.8 32.5 27.5 E040 21.3 43.2 35.5 F052 22.0 50.8 46.8 -
TABLE 7 M2 variants used in this study. Sub- SEQ M2e variant Abbreviation type ID NO M2 Sequence(2) Consensus(1) M2e n/a 48 SLLTEVETPIRNEWGCRCNDSSD Short M2e-short n/a 49 SLLTEVETPIRNEWGC A/VN/1203/04 M2e-VN H5N1 50 SLLTEVETPTRNEWECRCSDSSD A/PR/8/34 M2-PR H1N1 84 SLLTEVETPIRNEWGCRCNGSSDPLTIAANIIGI LHLTLWILDRLFFKCIYRRFKYGLKGGPSTE GVPKSMREEYRKEQQSAVDADDGHFVSIELE A/VN/1203/04 M2- H5N1 85 SLLTEVETPTRNEWECRCSDSSDPLTIAANIIGI VN/PR LHLTLWILDRLFFKCIYRRFKYGLKGGPSTE GVPKSMREEYRKEQQSAVDADDGHFVSIELE (1)M2e consensus sequence derived from H1, H2, and H3 subtypes of human Influenza A viruses. (2)Variations from M2 consensus sequence are shown in bold (Tompkins et al. 2007, Emerging Infectious Diseases Vol. 13, No. 3, pp. 426-435, cf. Table therein). All sequences are shown without the N-terminal Methionine, which is removed upon expression in vivo. - The ability of the recombinant antibodies to recognize native M2 was assessed by analyzing their reactivity with L929-M2#E9 cells, a clone of L929 cells expressing full-length M2 derived from mouse-adapted H1N1 Influenza A PR8 (M2-PR; SEQ ID NO:84) (Table 7). Thus, L929-M2#E9 cells were brought to a single-cell suspension and incubated with 2-fold serial dilutions of, respectively, scFv-D005-msFcγ2c, scFv-E040-msFcγ2c or scFv-F052-msFcγ2c in FACS® buffer (phosphate-buffered saline containing 1% FCS). After a 1 h incubation on ice, cells were washed in FACS® buffer and bound antibodies detected by a half hour incubation on ice with Cy5-labeled goat anti-mouse antibody (Jackson Immuno, Cat No 115-176-071) in FACS buffer. After a final wash, the fluorescence intensity of the stained cells was analyzed by flow cytometry using a FACScalibur® (Becton Dickinson). The antibodies scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c were found to bind native, cell surface-expressed M2-PR with a high affinity, with an EC50 of 0.68, 0.73 and 0.46 nM, respectively.
- The efficacy anti-M2 scFv-msFcγ2c antibodies in a prophylactic setting was tested in a mouse model of Influenza A infection. This model reflects most of the immunological and histological aspects of Influenza infection in humans and is therefore routinely used to assess the efficacy of anti-viral agents. Thus, six week old female C57BL/6 mice were injected intraperitoneally with 500 μg of scFv-D005-msFcγ2c, scFv-E040-msFcγ2c, scFv-F052-msFcγ2c or mouse IgG in PBS (6 mice per group). One day later, mice were bled in order to verify the presence of the antibodies in the blood by ELISA. Antibodies were readily detectable in the sera of all mice, except for one mouse receiving clone D005, which was subsequently removed from the analysis (not shown). Another day later (day 0), mice were infected intranasally with a lethal dose of mouse-adapted Influenza A virus PR8 (4×LD50) followed by monitoring of weight-loss and fever (temperature drop) for 12 days. Control mice treated with mouse IgG developed severe signs of morbidity, characterized by dramatic temperature drop and weight loss, within 5 to 6 days and invariably died on days 7 or 8 (
FIG. 3C ). In contrast, animals treated with M2-specific antibodies were almost completely protected from any signs of morbidity, developed hardly any signs of fever and lost weight only temporarily (FIGS. 3A and B). - To determine the minimal amount of antibody required to achieve full protection of mice in a prophylactic setting, scFv-msFc-γ2c D005 was titrated. To this end, six week old female C57BL/6 mice were injected intraperitoneally with decreasing amounts of the antibody (200, 60, 20, or 6 μg per mouse) or, as a control, with 200 μg of mouse IgG (6 mice per group). One day later, mice were bled in order to verify the presence of the antibodies in the blood by ELISA. Antibodies were readily detectable in the sera of all mice, except for one mouse receiving the 60 μg dose, which was subsequently removed from the analysis (not shown). Another day later (day 0), animals were infected intranasally with a lethal dose of influenza A virus strain PR/8/34 (4×LD50) and monitored for 21 days (
FIG. 4A ). As expected, control mice quickly succumbed to the disease and were dead in less than two weeks. In contrast, antibody D005 showed protective activity at all doses tested. In groups of mice receiving 200, 60 or 20 μg antibody, all animals survived the lethal challenge. Even at the lowest dose of 6 μg D005, half of the mice recovered and survived infection, indicating that the M2-specific antibody is a potent prophylactic agent. - In view of the similarities of clones D005, E040 and F052 in sequence, affinity and prophylactic activity, only scFv-D005-msFcγ2c was tested in a therapeutic setting. Thus, six weeks old female C57BL/6 mice were infected intranasally with a lethal dose of mouse-adapted Influenza A virus PR8 (4×LD50). 1, 2, or 3 days later, groups of mice were injected intraperitoneally with 200 μg of scFv-D005-msFcγ2c in PBS (6 mice per group). As controls, one group of mice each was injected with scFv-D005-msFcγ2c or mouse IgG two days prior to infection. Each mouse was bled one day after receiving antibody in order to verify the presence of the antibodies in the blood (not shown). The mice were observed closely to monitor signs of morbidity as well as mortality for a total of 21 days (
FIG. 4B and not shown). All mice receiving the control antibody eventually died, whereas all mice receiving a prophylactic injection of scFv-D005-msFcγ2c two days prior to infection survived for at least 3 weeks. Significantly, therapeutic efficacy of the antibody could be shown in groups of mice treated as much as 3 days after infection. Survival rates of mice treated 1, 2 and 3 days after infection were 100, 83 and 17%, respectively. The measurement of survival rates generally corresponds to mortality (the proportion of deaths to a specified population), whereas morbidity general corresponds to the incidence of disease or the rate of sickness (in a specified population). - Expression vectors allowing for expression of the clones D005, E040 and F052 as fully human IgG1κ were generated. Thus, DNA sequences encoding a human γ1 heavy chain shared by clones D005, E040 and F052, as well as each of the unique κ light chains were produced by total gene synthesis (
SEQ ID NOs SEQ ID NOs SEQ ID NOs 33, 35 and 37, respectively. - Heavy and light chain coding regions were then combined into the EBNA-based expression vector pCB15 (disclosed as SEQ ID NO:104 of WO 2008/055795 A1). Thus, the heavy chain coding region was digested with the restriction enzymes Asc1 and Pac1, and ligated into Asc1-Pac1 digested pCB15, generating the plasmid pCB15-fh-HC-γ1-D005. This plasmid was then digested with the restriction enzymes Nhe1 and Pme1 and ligated to each of the Nhe1-Pme1 digested light chain coding regions, generating the plasmids pCB15-fh-IgG1κ-D005, pCB15-fh-IgG1κ-E040 and pCB15-fh-IgG1κ-F052. Expression of IgG1κ-D005, IgG1κ-E040 and IgG1κ-F052 in HEK-293T cells, as well as purification by protein A-sepharose chromatography, was done as described for the scFv-Fc fusion proteins (Example 2).
- In view of the similarities of clones D005, E040 and F052 in sequence, affinity and prophylactic activity, only IgG1-D005 was analyzed in more detail. The ability of the fully human mAb IgG1-D005 to recognize native, cell surface-expressed M2 was assessed by analyzing its reactivity with 293T cells expressing full-length M2 variants. Thus, 293T cells were transfected with a recombinant expression vector encoding the M2 protein of A/PR/8/34 (M2-PR, SEQ ID NO:84) or the fusion protein M2-VN/PR (SEQ ID NO:85), respectively. M2-VN/PR comprises an extracellular domain derived from H5N1 Influenza A VN1203 (M2e-VN, SEQ ID NO:50) which is fused to the N-terminus of the transmembrane and intercellular regions of M2-PR (cf. Table 7, the part of SEQ ID NO:84 which is shown in italics).
- Transfected 293T cells were then brought to a single-cell suspension and incubated with 2-fold serial dilutions of IgG1-D005 in FACS buffer (phosphate-buffered saline containing 1% FCS). After a 1 h incubation on ice, cells were washed in FACS buffer and bound antibodies detected by a half hour incubation on ice with Cy5-labeled goat anti-human antibody in FACS buffer. After a final wash, the fluorescence-intensity of the stained cells was analyzed by flow cytometry using a FACScalibur (Becton Dickinson). The mAb IgG1-D005 bound native, cell surface-expressed M2-PR and M2-VN/PR with identical affinities, with an EC50 of 3.9 nM.
- In view of the similarities of clones D005, E040 and F052 in sequence, affinity and prophylactic activity, only antibody D005 was analyzed in more detail in a mouse model of Influenza A infection. On one hand, the prophylactic activity of fully human IgG1k-D005 was tested and compared to the scFv-D005-msFcγ2c fusion protein. On the other hand, the involvement of antibody-dependent cellular cytotoxicity (ADCC) was investigated, by using a scFv-D005 antibody fused to a mutated human Fcγ1 incapable of binding to Fc receptors (scFv-D005-hFcm). Thus, six week old female C57BL/6 mice were injected intraperitoneally with equimolar amounts of IgG1-D005 (200 μg), scFv-D005-msFcγ2c (144 μg), scFv-D005-hFcm (144 μg), or human IgG (200 μg) in PBS (6 mice per group). One day later, mice were bled in order to verify the presence of the antibodies in the blood by ELISA. Antibodies were readily detectable in the sera of all mice (not shown). Another day later (day 0), mice were infected intranasally with a lethal dose of mouse-adapted Influenza A virus PR8 (4×LD50) followed by monitoring of weight-loss and fever (temperature drop) for 16 days. Control mice treated with mouse IgG developed severe signs of morbidity, characterized by dramatic temperature drop and weight loss, within 6 to 7 days and died between
days 8 and 11 (FIG. 5 ). In contrast, similar to animals treated with scFv-D005-msFcγ2c, those treated with hIgG1k-D005 were almost completely protected from any signs of morbidity, developed hardly any signs of fever and lost weight only temporarily (FIGS. 5A and B). Thus, fully human IgG1k-D005 has a strong prophylactic activity in mice and is equipotent to scFv-D005-msFcγ2c. Significantly, mice treated with scFv-D005-hFcm were not protected and developed severe signs of morbidity similar to mice treated with the control IgG (FIGS. 5A and B). Consequently, all animals treated with scFv-D005-hFcm succumbed to disease and were dead by day 9 (FIG. 5C ). Thus, Fc receptor interaction is required for protection, suggesting that ADCC is a major component of the prophylactic activity. - The dissociation constants (Kd) of antibody binding to M2e in solution were determined using an ELISA-based method essentially as described (Friguet B. et al., 1985, J. Immunol. Meth. 77, 305-319). Briefly, a 10 ng/ml solution of, respectively, scFv-D005-msFcγ2c, scFv-E040-msFcγ2c or scFv-F052-msFcγ2c, was incubated in the presence of different concentrations of RNAse conjugated to influenza A M2e (SEQ ID NO:48) (3-fold serial dilutions ranging from 10 nM to 0.17 pM with respect to the content of influenza A M2e) in PBS/1% BSA. After 2 h at room temperature, free antibody was detected by a classical ELISA similar to the one described in Example 4. For this, ELISA plates that had been coated with RNAse-M2e conjugate at a concentration of 20 ng/ml at 4° C. overnight were washed with wash buffer (PBS/0.05% Tween) and blocked for 1 h at 37° C. with 3% BSA in wash buffer. The plates were then washed again and incubated with the solution binding reactions for 30 min at room temperature. After extensive washing with wash buffer, bound scFv-Fcγ2c fusion proteins were detected by a 1 h incubation at room temperature with a HRPO-labeled, Fcγ-specific, goat anti-mouse IgG antibody (Jackson ImmunoResearch Laboratories 115-035-071). After extensive washing with wash buffer, plates were developed with OPD solution (1 OPD tablet, 25 ml OPD buffer and 8
μl 30% H2O2) for 15 min and the reaction was stopped with 5% H2SO4 solution. Plates were then read at OD 450 nm on an ELISA reader (Biorad Benchmark). The Kd values were determined as the EC50 of the ELISA signal as a function of the RNAse-M2e concentration present in the solution binding reaction. The antibodies scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c were found to bind soluble RNase-M2e with a high affinity. Kd values were found to be 4 pM (D005), 13 pM (E040) and 6 pM (F052). - The same assay was repeated under otherwise identical conditions using free M2e peptide (SEQ ID NO:48) instead of the RNAse-M2e conjugate. The antibodies scFv-D005-msFcγ2c, scFv-E040-msFcγ2c and scFv-F052-msFcγ2c were found to bind soluble M2e peptide with a high affinity. Kd values were found to be 4 nM (D005, E040) and 5 nM (F052).
- The ability of antibody D005 to distinguish between native, cell-associated M2 and an unstructured, soluble M2e peptide was assessed by flow cytometry. For comparison, mouse monoclonal antibody 14C2 was also analyzed (Zebedee et al., 1988, J. Virol. 62(8): 2762-2772). Thus, scFv-D005-msFcγ2c and mAb 14C2 were incubated in FACS buffer at a concentration of 0.5 μg/ml in the presence or absence of 12 nM soluble M2e peptide for 1 hour on ice. The prebound antibodies were then used for staining of L929-M2#E9 cells. Thus, L929-M2#E9 cells were brought to a single-cell suspension and incubated with the prebound antibodies or, as a control, with FACS buffer. After a 50 min incubation on ice, cells were washed in FACS buffer and bound antibodies detected by a 20 min incubation on ice with Cy5-labeled goat anti-mouse antibody (Jackson Immuno, Cat No 115-176-071) in FACS buffer. After a final wash, the fluorescence intensity of the stained cells was analyzed by flow cytometry using a FACScalibur® (Becton Dickinson) (
FIG. 6 ). Both antibodies were found to bind native, cell surface-expressed M2 with similar efficiency in the absence of peptide. However, in the presence of peptide, mouse mAb 14C2 did not efficiently recognize L292/M2#E9 cells. In contrast, antibody scFv-D005-msFcγ2c efficiently stained the cells despite the presence of an excess of competing peptide. This indicates that antibody D005, but not mAb 14C2, may bind a conformational epitope only present in native, cell-surface M2. - To investigate the ability of antibody D005 to directly bind to Influenza A virus particles, a capture ELISA was carried out. Thus, wells of an ELISA plate were coated overnight at 4° C. with HA-specific mouse mAb H37-80 at a concentration of 10 μg/ml in coating buffer. The plate was then washed with wash buffer (PBS/0.05% Tween) and blocked for 3 h at 37° C. with 5% BSA in wash buffer. The plate was then washed again and incubated with 108, 5×107, 2.5×107, or 1.25×107 pfu Influenza A PR8 per well in wash buffer/1% BSA. After 1 hour incubation at room temperature, the plate was washed again and incubated with 1 μg/ml fully-human IgG1k-D005 or an isotype-matched control antibody (human IgG1k, Sigma, Cat. No. 15154) in wash buffer/1% BSA. After 1 hour incubation at room temperature, the plate was washed again and incubated with a 1:1000 dilution of HRPO-conjugated goat anti-human IgG (Jackson Immuno, Cat No 109-035-098) in wash buffer/1% BSA. After 1 hour incubation at room temperature, the plate was washed extensively with wash buffer, developed with OPD solution and read on an ELISA reader as described above. Whereas no detectable ELISA signal was obtained with the control antibody, hIgG1k-D005 readily detected captured Influenza A particles in a dose-dependent manner (
FIG. 7 ). - Crossreactivity of antibody D005 with M2 sequences derived from different Influenza A strains was analyzed by testing the binding of IgG1k-D005 to solid phase bound peptide variants (analysis performed by Pepscan Presto BV, Lelystad, the Netherlands). Since it was previously found that the epitope recognized by D005 is comprised within the 16 amino acid peptide M2e-short (SEQ ID NO:49) (Example 4), only peptides spanning this region were synthesized. In doing so, 35 of the 23-mer peptides listed in Table 4 (SEQ IDs NO:48, 50-59, 61-83, and 90-92) were covered by 28 different 16-mer peptides. Binding was assayed at two antibody concentrations, 0.5 μg/ml and 0.05 μg/ml, revealing that antibody D005 is broadly cross-reactive. Significantly, all peptides tested were recognized, and 19 of the peptides were recognized as well as the one corresponding to the M2e consensus sequence (
FIG. 8A ). - The minimal epitope was determined in a similar manner, by testing the binding of IgG1k-D005 to solid phase bound variants of a peptide corresponding to peptide M2e-short (SEQ ID NO:49) (analysis performed by Pepscan Presto BV, Lelystad, the Netherlands). Three types of analyses were done: first, N- and C-terminal deletions; second, epitope scanning by synthesizing all 105 different 3 to 16 mer variants; and third, point mutations by synthesiszing all 304 possible single positional variants. The 3 analyses yielded comparable results (
FIG. 8B ). N-/C-terminal deletion and epitope scanning analyses narrowed down the region recognized by D005 to the 8-mer peptide LLTEVETP (SEQ ID NO:93).
Claims (19)
1. A method of producing an isolated monoclonal antibody, wherein said monoclonal antibody is specifically binding influenza M2e antigen, and wherein said monoclonal antibody is a human monoclonal antibody, and wherein said antibody comprises at least one antigen binding site, wherein said antigen binding site comprises:
(a) one light chain variable region (LCVR), wherein said LCVR comprises: (i) one light chain complementarity determining region 1 (LC CDR1), wherein said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 2, 3, 4, 5, and 6; (ii) one LC CDR2, wherein said LC CDR2 consists of the peptide of SEQ ID NO: 7; and (iii) one LC CDR3, wherein said LC CDR3 consists of the peptide of any one of SEQ ID NOs 8, 9, 10, and 11; and
(b) one heavy chain variable region (HCVR), wherein said HCVR comprises: (i) one heavy chain complementarity determining region 1 (HC CDR1), wherein said HC CDR1 consists of the peptide of SEQ ID NO: 12; (ii) one HC CDR2, wherein said HC CDR2 consists of the peptide of any one of SEQ ID NOs 13 and 14; and (iii) one HC CDR3, wherein said HC CDR3 consists of the peptide of any one of SEQ ID NOs 15, 16, 17, 18, and 19.
2. The method of claim 1 , wherein said at least one antigen binding site recognizes an epitope comprised by the amino acid sequence LLTEVETP (SEQ ID NO: 93).
3. The method of claim 1 , wherein
said LC CDR1 consists of the peptide of any one of SEQ ID NOs 1, 4 and 6,
said LC CDR2 consists of the peptide of SEQ ID NO: 7,
said LC CDR3 consists of the peptide of SEQ ID NO: 8,
said HC CDR1 consists of the peptide of SEQ ID NO: 12,
said HC CDR2 consists of the peptide of SEQ ID NO: 13, and
said HC CDR3 consists of the peptide of SEQ ID NO: 15.
4. The method of claim 3 , wherein
said LC CDR1 consists of the peptide of SEQ ID NO: 1,
said LC CDR2 consists of the peptide of SEQ ID NO: 7,
said LC CDR3 consists of the peptide of SEQ ID NO: 8,
said HC CDR1 consists of the peptide of SEQ ID NO: 12,
said HC CDR2 consists of the peptide of SEQ ID NO: 13, and
said HC CDR3 consists of the peptide of SEQ ID NO: 15.
5. The method of claim 1 , wherein position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22.
6. The method of claim 1 , wherein position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, and wherein position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO: 24.
7. The method of claim 1 , wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO: 23.
8. The method of claim 1 , wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO: 23, and wherein position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO: 25.
9. The method of claim 1 , wherein position 5 to 113 of said LCVR consists of the peptide of any one of SEQ ID NOs 20, 21 and 22, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO: 23.
10. The method of claim 1 , wherein position 5 to 113 of said LCVR consists of the peptide of SEQ ID NO: 20, and wherein position 7 to 121 of said HCVR consists of the peptide of SEQ ID NO: 23, and wherein position 1 to 4 of said LCVR consists of the peptide of SEQ ID NO: 24, and wherein position 1 to 6 of said HCVR consists of the peptide of SEQ ID NO: 25.
11. The method of claim 1 , wherein said monoclonal antibody comprises at least one light chain, and wherein said monoclonal antibody further comprises at least one heavy chain, wherein said light chain comprises the amino acid sequence of any one of SEQ ID NOs 26, 27, and 28, and wherein said heavy chain comprises of the amino acid of SEQ ID NO: 29.
12. The method of claim 1 , wherein said monoclonal antibody comprises at least one light chain, and wherein said monoclonal antibody further comprises at least one heavy chain, wherein said light chain consists of the amino acid sequence of any one of SEQ ID NOs 26, 27, and 28, and wherein said heavy chain consists of the amino acid of SEQ ID NO: 29.
13. The method of claim 1 , wherein said influenza M2e antigen is the extracellular domain of the influenza A M2 protein, and wherein said influenza M2e antigen is the peptide of any one of SEQ ID NOs 48 to 83 and 90 to 92.
14. The method of claim 1 , wherein said influenza M2e antigen is the extracellular domain of the influenza A M2 protein, and wherein said influenza M2e antigen is the peptide of any one of SEQ ID NO: 48.
15. The method of claim 11 , wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 100 nM or less.
16. The method of claim 11 , wherein the dissociation constant (Kd) of said monoclonal antibody and said influenza M2e antigen is at most 10 nM or less.
17. A method of producing an isolated polynucleotide comprising a nucleic acid encoding the monoclonal antibody of the method of claim 1 .
18. A method of producing an expression vector comprising a nucleic acid encoding the monoclonal antibody of the method of claim 1 .
19. A method of producing an isolated host cell comprising at least one expression vector comprising a nucleic acid encoding the monoclonal antibody of the method of claim 1 .
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US13/728,056 US20130109845A1 (en) | 2008-12-04 | 2012-12-27 | Fully human influenza m2 specific antibodies |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP08170749 | 2008-12-04 | ||
EP08170749.9 | 2008-12-04 | ||
EP09173548 | 2009-10-20 | ||
EP09173548.0 | 2009-10-20 | ||
PCT/EP2009/066052 WO2010063675A1 (en) | 2008-12-04 | 2009-11-30 | Fully human influenza m2 specific antibodies |
US201113132658A | 2011-06-03 | 2011-06-03 | |
US13/728,056 US20130109845A1 (en) | 2008-12-04 | 2012-12-27 | Fully human influenza m2 specific antibodies |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2009/066052 Continuation WO2010063675A1 (en) | 2008-12-04 | 2009-11-30 | Fully human influenza m2 specific antibodies |
US201113132658A Continuation | 2008-12-04 | 2011-06-03 |
Publications (1)
Publication Number | Publication Date |
---|---|
US20130109845A1 true US20130109845A1 (en) | 2013-05-02 |
Family
ID=42232909
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/132,658 Expired - Fee Related US8460670B2 (en) | 2008-12-04 | 2009-11-30 | Fully human influenza M2 specific antibodies |
US13/728,056 Abandoned US20130109845A1 (en) | 2008-12-04 | 2012-12-27 | Fully human influenza m2 specific antibodies |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US13/132,658 Expired - Fee Related US8460670B2 (en) | 2008-12-04 | 2009-11-30 | Fully human influenza M2 specific antibodies |
Country Status (7)
Country | Link |
---|---|
US (2) | US8460670B2 (en) |
EP (1) | EP2365827A1 (en) |
JP (1) | JP2012510802A (en) |
CN (1) | CN102238963A (en) |
AU (1) | AU2009324251A1 (en) |
CA (1) | CA2745598A1 (en) |
WO (1) | WO2010063675A1 (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009064805A1 (en) | 2007-11-12 | 2009-05-22 | Spaltudaq Corporation | Compositions and methods for the therapy and diagnosis of influenza |
JP2012510802A (en) * | 2008-12-04 | 2012-05-17 | インターセル アーゲー | Completely human influenza M2-specific antibody |
US8858948B2 (en) * | 2009-05-20 | 2014-10-14 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
AU2012217867A1 (en) * | 2011-02-14 | 2013-09-05 | Theraclone Sciences, Inc. | Compositions and methods for the therapy and diagnosis of influenza |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8460670B2 (en) * | 2008-12-04 | 2013-06-11 | Intercell Ag | Fully human influenza M2 specific antibodies |
Family Cites Families (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US6197502B1 (en) | 1997-11-17 | 2001-03-06 | Cytos Biotechnology Ag | Expression cloning processes for the discovery characterization, and isolation of genes encoding polypeptides with a predetermined property |
US6686168B1 (en) | 1999-11-04 | 2004-02-03 | Zymogenetics, Inc. | Cell surface display of proteins by recombinant host cells |
US20050170334A1 (en) | 2002-03-13 | 2005-08-04 | Toshifumi Mikayama | Human monoclonal antibodies to influenza M2 protein and methods of making and using same |
US8003106B2 (en) | 2002-03-13 | 2011-08-23 | Kyowa Hakko Kirin Co., Ltd. | Human monoclonal antibodies to influenza M2 protein and methods of making and using same |
JP2005519619A (en) * | 2002-03-13 | 2005-07-07 | 麒麟麦酒株式会社 | Human monoclonal antibody against influenza M2 protein and method for producing and using the antibody |
WO2006061723A2 (en) | 2004-12-06 | 2006-06-15 | Kirin Beer Kabushiki Kaisha | Human monoclonal antibodies to influenza m2 protein and methods of making and using same |
EP1921142A1 (en) | 2006-11-07 | 2008-05-14 | Cytos Biotechnology AG | Selection of human monoclonal antibodies by eukaryotic cell display |
-
2009
- 2009-11-30 JP JP2011538980A patent/JP2012510802A/en not_active Ceased
- 2009-11-30 CN CN2009801487074A patent/CN102238963A/en active Pending
- 2009-11-30 US US13/132,658 patent/US8460670B2/en not_active Expired - Fee Related
- 2009-11-30 WO PCT/EP2009/066052 patent/WO2010063675A1/en active Application Filing
- 2009-11-30 CA CA2745598A patent/CA2745598A1/en not_active Abandoned
- 2009-11-30 AU AU2009324251A patent/AU2009324251A1/en not_active Abandoned
- 2009-11-30 EP EP09768353A patent/EP2365827A1/en not_active Withdrawn
-
2012
- 2012-12-27 US US13/728,056 patent/US20130109845A1/en not_active Abandoned
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US8460670B2 (en) * | 2008-12-04 | 2013-06-11 | Intercell Ag | Fully human influenza M2 specific antibodies |
Non-Patent Citations (2)
Title |
---|
Beerli RR et al. Isolation of human monoclonal antibodies by mammalian cell display. Proc Natl Acad Sci U S A. 2008 Sep 23;105(38):14336-41. * |
Liu et al. N-terminus of M2 protein could induce antibodies with inhibitory activity against influenza virus replication. FEMS Immunol Med Microbiol. 2003 Mar 20;35(2):141-6. * |
Also Published As
Publication number | Publication date |
---|---|
AU2009324251A1 (en) | 2010-06-10 |
WO2010063675A1 (en) | 2010-06-10 |
CN102238963A (en) | 2011-11-09 |
JP2012510802A (en) | 2012-05-17 |
US20110268740A1 (en) | 2011-11-03 |
EP2365827A1 (en) | 2011-09-21 |
US8460670B2 (en) | 2013-06-11 |
CA2745598A1 (en) | 2010-06-10 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10973905B2 (en) | Cross-protective pathogen protection, methods and compositions thereof | |
AU2012205663B2 (en) | Antibodies directed against influenza | |
KR102668588B1 (en) | Humanized influenza monoclonal antibodies and methods of using the same | |
EP2793945B1 (en) | Antibodies useful in passive influenza immunization | |
RU2721706C2 (en) | Neutralizing binding molecules directed against influenza virus, and methods of their application | |
US8344111B2 (en) | Human monoclonal nicotine specific antibodies | |
CN106243218B (en) | Broad-spectrum monoclonal antibody against Flu B and use thereof | |
US10357563B2 (en) | Methods and composition for neutralization of influenza | |
US20130109845A1 (en) | Fully human influenza m2 specific antibodies | |
US20240117014A1 (en) | Methods and composition for neutralization of influenza | |
US20220242935A1 (en) | Pan-neuraminidase inhibiting antibodies | |
Paul | Characterization and Optimization of Interaction of Monoclonal Antibodies with Influenza a Hemagglutinin |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: INTERCELL AG, AUSTRIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BACHMANN, MARTIN F.;BAUER, MONIKA;BEERLI, ROGER;AND OTHERS;SIGNING DATES FROM 20110718 TO 20110720;REEL/FRAME:029700/0572 |
|
AS | Assignment |
Owner name: ELATOS GMBH, AUSTRIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:INTERCELL AG;REEL/FRAME:030465/0141 Effective date: 20130513 |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |