US20120064093A1 - Antibody - Google Patents

Antibody Download PDF

Info

Publication number
US20120064093A1
US20120064093A1 US13/144,872 US201013144872A US2012064093A1 US 20120064093 A1 US20120064093 A1 US 20120064093A1 US 201013144872 A US201013144872 A US 201013144872A US 2012064093 A1 US2012064093 A1 US 2012064093A1
Authority
US
United States
Prior art keywords
antibody
amino acid
acid sequence
substantial homology
antibody according
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US13/144,872
Inventor
Christopher Thornton
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Exeter
Original Assignee
University of Exeter
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Exeter filed Critical University of Exeter
Priority to US13/144,872 priority Critical patent/US20120064093A1/en
Assigned to THE UNIVERSITY OF EXETER reassignment THE UNIVERSITY OF EXETER ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: THORNTON, CHRISTOPHER
Publication of US20120064093A1 publication Critical patent/US20120064093A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/14—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from fungi, algea or lichens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/10—Antimycotics
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56961—Plant cells or fungi
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/37—Assays involving biological materials from specific organisms or of a specific nature from fungi
    • G01N2333/38—Assays involving biological materials from specific organisms or of a specific nature from fungi from Aspergillus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2469/00—Immunoassays for the detection of microorganisms
    • G01N2469/20—Detection of antibodies in sample from host which are directed against antigens from microorganisms

Definitions

  • This invention relates to a method of diagnosing a fungal infection, and to antibodies and related molecules for use in such a method.
  • A. fumigatus accounts for ⁇ 90% of cases of IA (Denning, D. W. 1998. Invasive Aspergillosis. Clin. Infect. Dis. 26:781-805).
  • Monoclonal antibodies have been successfully used in the detection of GM, and they form the basis of commercial laboratory-based tests such as the Platelia Aspergillus ELISA kit that incorporates a rat mAb (EB-A2) directed against tetra (1 ⁇ 5)- ⁇ -D-galactofuranoside, the immunodominant epitope in the antigen (Morelle, W., M. Bernard, J.-P. Debeaupuis, M. Buitrago, M. Tabouret, and J.-P. Latgé. 2005. Galactomannoproteins of Aspergillus fumigatus . Euk. Cell 4:1308-1316, Stynen, D, A. Goris, J.
  • Cryptococcus neoformans galactoxylomannan contains an epitope(s) that is cross-reactive with Aspergillus galactomannan. J. Clin. Microbiol. 43:2929-2931, De Jesus, M., E. hackett, M. Durkin, P. Connolly, A. Casadevall, R. Petraitiene, T. J. Walsh, and L. J. Wheat. 2007. Galactoxylomannan does not exhibit cross-reactivity in the Platelia Aspergillus enzyme immunoassay. Clin. Vacc. Immun.
  • Cyclophosphamide induces false-positive results in detection of Aspergillus antigen in urine. Chest 105:975-976), and with GM in food, drink and infant milk formulas (Ansorg, R., R. Van den Boom, and P. M. Rath. 1997. Detection of Aspergillus galactomannan antigen in foods and antibiotics. Mycoses 40:353-357). Contamination of ⁇ -lactamantibiotics with Penicillium GM may account for serum reactivity of patients receiving piperacillin/tazobactam or amoxicillin/clavulanic acid (Aubry, A., R. Porcher, J. Bottero, S. Touratier, T. Leblanc, B.
  • False-positive Aspergillus galactomannan enzyme-linked immunosorbent assay results in vivo during amoxicillin-clavulanic acid treatment. J. Clin. Microbiol. 42:5362-5363, Verweij, P. E., and M. A. S. H. Mennink-Kersten. 2006. Issues with galactomannan testing. Med. Mycol. 44:179-183, Viscoli, C., M. Machetti, P. Cappellano, B. Bucci, P. Bruzzi, M. T. Van Lint, and A. Bacigalupo. 2004. False-positive galactomannan Platelia Aspergillus test results for patients receiving piperacillin-tazobactam. Clin. Infect.
  • Non-GM and non-Afmp1p surrogate markers for IA
  • development of a non-invasive immunodiagnostic test that is rapid, reliable and relatively inexpensive and that detects surrogate (non-GM and non-Afmp1p) markers for IA, would allow routine testing of vulnerable patients who have an elevated risk of infection, such as allogeneic haematopoietic stem-cell-transplant recipients, patients with haematological malignancies and recipients of solid organ transplants, especially of the lung.
  • the inventors here report the development of a mouse hybridoma cell line secreting an Aspergillus glycoprotein-specific mAb (JF5) and its utilization in the development of a lateral flow device (LFD) for the rapid serodiagnosis of IA.
  • JF5 Aspergillus glycoprotein-specific mAb
  • the assay exploits lateral flow technology that has been used, to date, in diagnostic tests for viruses, bacteria and toxins (Iweala, O. I. 2004. HIV diagnostic tests: an overview. Contraception 70:141-147, Ketema, F., C. Zeh, D. C. Edelman, R. Saville, and N. T. Constantine. 2001. Assessment of the performance of a rapid, lateral flow assay for the detection of antibodies to HIV. J. Acquir. Immune. Defic. Syndr. 27:63-70, Sharma, S. K., B. S. Eblen, R. L. Bull, D. H. Burr, and R. C. Whiting. 2005.
  • the inventors identified an Aspergillus antigen found in growing hyphae. The inventors then produced molecules that bind to that antigen.
  • the particular binding molecules, especially antibodies, may be used to not only identify an Aspergillus infection, but also to distinguish between active, growing colonies of Aspergillus and quiescent or dead colonies.
  • an antibody which may be obtained by culture of the hybridoma, or a functional fragment of such an antibody.
  • an antibody, or antibody fragment or other molecule capable of specifically binding to Aspergillus , that antibody, fragment or binding molecule comprising a CDR, light chain, heavy chain, light chain variable region, heavy chain variable region or antigen binding region, especially FAb region, that shows substantial homology with the corresponding region of the antibody according to the second aspect of the invention.
  • the antibody, fragment or binding molecule also exhibits similar binding properties to the antibody according to the second aspect of the invention.
  • an antibody comprising a CDR comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
  • an antibody comprising a first CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
  • an antibody comprising a first CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
  • an antibody comprising a heavy chain comprising one or more CDRs having an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
  • the invention further provides an antibody comprising a light chain comprising one or more CDRs having an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
  • an antibody comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
  • the invention also provides an antibody comprising a heavy chain variable region having substantial homology to an amino acid sequence selected from the sequences shown in figures:
  • the antibody has a light chain variable region having substantial homology to the amino acid sequence selected from the sequences shown in figures:
  • X is any amino acid. Preferably it is a non-polar amino acid, especially glycine.
  • n is an integer between 0 and 8, preferably between 0 and 5, more preferably between 0 and 3, more preferably between 0 and 2, more preferably 0.
  • X may represent the same or a number of different amino acids.
  • each X may represent the same or a number of different amino acids.
  • Each n may represent the same or different integers.
  • the invention further provides an antibody encoded by a nucleotide sequence having substantial homology to a nucleotide sequence selected from the sequences shown in figures:
  • an antibody comprising a heavy chain variable region encoded by a nucleotide sequence having substantial homology to a nucleotide sequence selected from the sequences shown in figures:
  • the antibody comprises a light chain variable region encoded by a nucleotide sequence having substantial homology to the nucleotide sequence selected from the sequences shown in figures:
  • an antibody that binds to the same epitope as an antibody according to other aspects of the invention.
  • antibody is well known in the art. Herein it means an immunoglobulin or any functional fragment thereof. It encompasses any polypeptide that has an antigen-binding site. It includes but is not limited to monoclonal, polyclonal, monospecific, polyspecific, non-specific, humanized, human, single-chain, chimeric, synthetic, recombinant, hybrid, mutated, grafted, and in vitro generated antibodies.
  • antibody encompasses antibody fragments such as Fab, F(ab′) 2, Fv, scFv, Fd, dAb, and any other antibody fragments that retain antigen-binding function. Typically, such fragments would comprise an antigen-binding domain.
  • the term “antibody” means a whole antibody molecule, namely two heavy chains, each with one variable region and three constant regions, and two light chains, each with one variable region and one constant region.
  • Intact antibodies are also known as immunoglobulins (Ig). As indicated above, intact antibodies comprise light chains and heavy chains. Light chains are classified into two isotypes, and heavy chains are classified into five isotypes (A, D, E, G, and M). Some heavy chain isotypes are further divided into isotype subclasses, e.g., IgG1, IgG2, IgG3, and IgG4. It is particularly preferred that the antibodies of the invention are IgG antibodies. In particular, IgG2b and IgG2a antibodies are preferred.
  • the domain and three dimensional structures of different antibodies are known in the art.
  • the light chain is composed of a constant domain (C) and an N-terminal variable domain (V).
  • the heavy chain is composed of three or four constant domains (C H ), a hinge region, and a N-terminal variable domain (V H ).
  • the C H adjacent to the V H domain is designated C H1 .
  • the V H and V L domains contain four regions of conserved sequence called framework (FR) regions (FR1, FR2, FR3, and FR4), which form a scaffold for three regions of hypervariable sequence called complementarity determining regions (CDR).
  • the CDRs (CDR1, CDR2, and CDR3) contain most of the antibody amino acids that specifically binds antigen.
  • Heavy chain CDRs are denoted H1, H2, and H3, while light chain CDRs are denoted L1, L2, and L3.
  • the term CDR is well known in the art. One skilled in the art would be able to recognise CDRs in an antibody or fragment by using Kabat numbering and the amino acids found either side of the CDRs.
  • the Fab fragment (Fragment antigen-binding) consists of V H , C H1 , V L and C L domains covalently linked by a disulfide bond between the constant regions.
  • the Fv fragment is smaller and consists of V H and V L domains non-covalently linked.
  • a single chain Fv fragment (scFv) can be constructed.
  • the scFv contains a flexible polypeptide that links the C-terminus of V H to the N-terminus of V L , or the C-terminus of V L to the N-terminus of V H .
  • a 15-mer (Gly 4 Ser) 3 peptide may be used as a linker, but other linkers are well known.
  • antigen-binding site means the part of an antibody that specifically binds antigen.
  • the part of the antigen that is recognised and bound by the antibody is referred to as the “epitope”.
  • An antigen-binding domain usually comprises variable regions from both the light chain (V L ) and the heavy chain (V H ), but it does not have to comprise both.
  • Antigen-binding fragments include Fab fragments (monovalent fragments consisting of the V L , V H , C L and C H1 domains); F(ab′) 2 fragments (bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region); Fd fragments (the two V H and C H1 domains); Fv fragments (V L or V H domains, dAb fragments (Ward et al., (1989) Nature 341: 544-546), one or more complementarity determining regions (CDR); and single chain Fvs.
  • the various antibody fragments can be obtained using conventional techniques known to those with skill in the art. It is possible to screen for the functionality of the fragments, e.g. binding and agonising a receptor using techniques known in the art.
  • the antibodies according to the invention are preferably chimeric, humanised (CDR grafted or reshaped).
  • chimeric refers to antibodies in which the whole of the variable regions of a mouse or rat antibody are expressed along with human constant regions. This provides the antibody with human effector functions and also reduces immunogenicity (HAMA) caused by the murine Fc region.
  • HAMA immunogenicity
  • “Humanised” antibodies are an alternative to chimeric antibodies in which only the complimentarily determining regions from the rodent antibody V-regions are combined with framework regions from human V-regions. The idea is that these antibodies should be more human-like than chimeric and thus perhaps less immunogenic than chimeric antibodies.
  • Transgenic mice have been created which have a repertoire of human immunoglobulin germline gene segments. These mice when immunised thus make human like antibodies. B cells from such immunised mice may be used in the production of monoclonal antibodies.
  • the invention also encompasses functional fragments of antibodies. Whilst certain fragments are mentioned specifically, any functional fragment, that is to say, any fragment that exhibits similar binding properties as the relevant whole antibody is encompassed by the invention.
  • the antibodies of the invention are preferably able to bind to an epitope from an Aspergillus cell, especially an Aspergillus fumigatus cell. It is particularly preferred that the epitope is from growing hyphae.
  • the antibodies and nucleic acids of the invention are preferably isolated.
  • isolated refers to a molecule that is substantially free of its natural environment.
  • an isolated protein is substantially free of cellular material or other proteins from the cell or tissue source from which it was derived.
  • the term also refers to preparations where the isolated protein is sufficiently pure for pharmaceutical compositions; or at least 70-80% (w/w) pure; or at least 80-90% (w/w) pure; or at least 90-95% (w/w) pure; or at least 95%, 96%, 97%, 98%, 99%, or 100% (w/w) pure.
  • substantially homologous means that the relevant amino acid or nucleotide sequence (e.g., CDR (s), V H or V L domain) will be identical to or have minor differences to the specifically defined sequences. Minor differences include minor amino acid changes, such as 1 or 2 substitutions in a 5 amino acid sequence of a specified region.
  • the second antibody has the same specificity and has at least 50% of the affinity of the same.
  • sequences substantially identical or homologous e.g., at least about 85% sequence identity
  • sequence identity can be about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or higher.
  • substantial homology preferably means at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homology.
  • homology may be at least 85%, 87%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%.
  • Sequences including constant regions may have less homology, for example, 75%, 80%, 85%, 87%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or higher.
  • Substantially identical or homologous sequences also include nucleic acid sequences that will hybridize under selective hybridization conditions (e.g., highly stringent hybridization conditions), to the complement of the specifically defined strand.
  • the percent identity can be determined by standard alignment algorithms, for example, the Basic Local Alignment Tool (BLAST) described by Altshul et al. ((1990) J. Mol. Biol., 215: 403-410); the algorithm of Needleman et al. ((1970) J. Mol. Biol., 48: 444-453); or the algorithm of Meyers et al. ((1988) Comput. Appl. Biosci., 4: 11-17).
  • the percent identity between two amino acid or nucleotide sequences can also be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0). This would be known by those skilled in the art.
  • stringent describes conditions for hybridization and washing. Stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
  • Antibodies can be made by any method known in the art. A preferred method is using traditional hybridoma techniques (Kohler and Milstein (1975) Nature, 256: 495-499). For additional antibody production techniques, see Antibodies: A Laboratory Manual, eds. Harlow et al., Cold Spring Harbor Laboratory, 1988. No limitation is placed on the present invention as to method of production or source of antibody.
  • the invention provides antibodies that bind to Aspergillus . It is further envisaged that one skilled in the art could create more antibodies by altering the V H and/or V L sequence(s) provided. Such antibodies may be derived by a skilled person using techniques known in the art and are also encompassed by the invention. For example, modifications such as amino acid substitutions, deletions, or additions can be introduced into any part of the antibody, providing functionality remains. Changes may be introduced into the framework regions, especially to, for example improve the stability of the antibody. Changes may also be introduced into the CDRs to alter the antibody's affinity for the epitope. The affinity of an antibody for the epitope may be tested using standard techniques known in the art.
  • V H and V L sequences are envisaged in particular. Such changes will produce molecules having functional and chemical characteristics similar to those of the antibodies from which the modifications are made. Conservative modifications are modifications unlikely to dramatically change the shape or function of the antibody, such as replacing one amino acid with another amino acid that has similar characteristics, e.g. replacing a hydrophobic amino acid with another hydrophobic amino acid.
  • natural amino acids may be used, as may non-naturally occurring amino acids that have been created by, for example, chemical synthesis.
  • the antibodies according to the invention may be linked to other molecules.
  • antibodies may be linked to a protein or to a nonproteinaceous polymer such as polyethylene glycol, polypropylene glycol, and polyoxyalkylenes.
  • Linking antibodies to such molecules is well known in the art and may be carried out by standard methods. Linking antibodies to such molecules can have an effect on certain characteristics of the antibodies, for example half life in blood.
  • antibodies include detectable or functional tags or labels, such as enzymatic labels, e.g. horseradish peroxidase or alkaline phosphatase, radiolabels and chemical moieties e.g. biotin.
  • detectable or functional tags or labels such as enzymatic labels, e.g. horseradish peroxidase or alkaline phosphatase, radiolabels and chemical moieties e.g. biotin.
  • the antibodies may also be linked to toxic agents such as toxins, cytostatic or cytotoxic molecules and radioisotopes. Alternatively, the antibodies may be linked to other antibodies.
  • the invention also provides methods of making antibodies, including a method of generating an antibody or functional fragment thereof comprising:
  • CDR2 or CDR3 encoding region to be replaced or lacks a CDR1, CDR2 or CDR3 encoding region
  • the term “repertoire” refers to a genetically diverse collection of nucleotide sequences derived wholly or partially from sequences encoding immunoglobulins.
  • the sequences may be generated by the method given above, or by rearrangement in vivo of the V, D, and J segments of heavy chains, and the V and J segments of light chains.
  • the sequences can be generated from a cell in response to which rearrangement occurs, e.g., in vitro stimulation.
  • part or all of the sequences may be obtained by DNA splicing, nucleotide synthesis, mutagenesis, and other methods, see, e.g., U.S. Pat. No. 5,565,332.
  • the method may additionally comprise selecting an antibody that binds an Aspergillus epitope from the expressed antibodies and isolating it.
  • the invention also provides isolated nucleic acids encoding antibodies according to the invention including nucleotides encoding the CDRs, variable domains and other functional fragments of such antibodies, and substantially homologous sequences.
  • the nucleic acids may comprise DNA or RNA, and they may be synthetic (completely or partially) or recombinant (completely or partially).
  • nucleotide sequences provided and references thereto encompass DNA molecules with the specified sequence, and encompass RNA molecules with the specified sequence in which U is substituted for T.
  • a nucleic acid may encode any part of the antibody for example, a CDR, a variable region, a light chain, a heavy chain, an scFv, a Fab, the entire antibody or any other functional fragment thereof.
  • nucleic acid having substantial homology to a sequence selected from the sequences shown in figures:
  • nucleic acids of the invention are substantially homologous to the sequences provided.
  • sequences are preferably at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homologous to the sequences provided.
  • an antibody comprising culturing host cells under appropriate conditions so they express the antibody from the nucleic acid. Following expression and production, any desired fragment or antibody may be isolated and/or purified using any suitable technique, then used as appropriate.
  • Suitable host cells include mammalian cells, insect cells, plant cells, yeast cells, or prokaryotic cells, e.g., E. coli .
  • Mammalian cells available in the art for heterologous polypeptide expression include lymphocytic cell lines (e.g. NSO), HEK293 cells, Chinese Hamster Ovary (CHO) cells, COS cells, HeLa cells, baby hamster kidney cells, oocyte cells.
  • the antibodies of the invention are monoclonal antibodies.
  • Monoclonal antibodies may be produced by standard methods, as first described by Kohler and Milstein.
  • the antibodies may be produced using a hybridoma.
  • a hybridoma is well known in the art, is a cell created artificially by fusion of a tumour cell with a B-lymphocyte. Such cells are produced in the standard method of producing monoclonal antibodies, as first described by Kohler and Milstein.
  • the antibodies of the invention have multiple uses. Firstly, they may be used to identify the presence of an Aspergillus species, especially Aspergillus fumigatus . This may be a diagnostic use, identifying the presence of the species in a sample obtained from a patient. Also the use may be to identify the presence of the species in a sample obtained from a location, such as a building where an Aspergillus species may be present.
  • the sample may be a swab taken from a wall of such a building, for example.
  • the sample may be a sample obtained from a human or animal, and may be any appropriate sample, for example blood, serum, urine, plasma or bronchoalveolar lavage (BAL).
  • the sample may be obtained from a site thought to contain Aspergillus , for example a swab taken from a building wall.
  • a labeled antibody is an antibody to which a detectable label has been attached. Suitable labels are well known in the art and examples are discussed above.
  • a device or kit for carrying out the assay method comprising a labeled antibody according to the invention.
  • the device or kit is in the form of a lateral flow device.
  • composition comprising an antibody according to the invention.
  • composition is suitable for administration to patients.
  • it may comprise one or more appropriate pharmaceutical excipient(s) such as solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents.
  • suitable pharmaceutical excipient(s) such as solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents.
  • suitable pharmaceutical excipients such as solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents.
  • Other active compounds may also be included.
  • the pharmaceutical compositions may also be included in a container, pack, or dispenser together with instructions for administration.
  • a pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Methods to accomplish the administration are known to those of ordinary skill in the art. It may be possible to create compositions which may be topically or orally administered, or which may be capable of transmission across mucous membranes. For example, the administration may be intravenous, intraperitoneal, intramuscular, intracavity, subcutaneous, or transdermal.
  • Solutions or suspensions used for intradermal or subcutaneous application typically include at least one of the following components: a sterile diluent such as water, saline solution, fixed oils, polyethylene glycol, glycerine, propylene glycol, or other synthetic solvent; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetate, citrate, or phosphate; and tonicity agents such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases.
  • Such preparations may be enclosed in ampoules, disposable syringes, or multiple dose vials.
  • Solutions or suspensions used for intravenous administration include a carrier such as physiological saline, bacteriostatic water, CremophorELT“” (BASF, Parsippany, N.J.), ethanol, or polyol.
  • a carrier such as physiological saline, bacteriostatic water, CremophorELT“” (BASF, Parsippany, N.J.), ethanol, or polyol.
  • the composition must be sterile and fluid for easy syringability. Proper fluidity can often be obtained using lecithin or surfactants.
  • the composition must also be stable under the conditions of manufacture and storage. Prevention of microorganisms can be achieved with antibacterial and antifungal agents, e.g., parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, etc.
  • isotonic agents sucrose
  • polyalcohols mannitol and sorbitol
  • sodium chloride may be included in the composition.
  • Prolonged absorption of the composition can be accomplished by adding an agent which delays absorption, e.g., aluminium monostearate and gelatin.
  • Oral compositions include an inert diluent or edible carrier.
  • the composition can be enclosed in gelatin or compressed into tablets.
  • the antibodies can be incorporated with excipients and prepared as tablets or capsules, for example.
  • the oral composition may also contain, for example, a binder, an excipient, a lubricant and flavourings.
  • compositions may also be administered by a transmucosal or transdermal route.
  • antibodies that comprise a Fc portion may be capable of crossing mucous membranes in the intestine, mouth, or lungs (via Fc receptors).
  • Transmucosal administration can be accomplished through the use of lozenges, nasal sprays, inhalers, or suppositories.
  • Transdermal administration can also be accomplished through the use of composition containing ointments, salves, gels, or creams known in the art.
  • penetrants appropriate to the barrier to be permeated are used.
  • antibodies are delivered in an aerosol spray from a pressured container or dispenser, which contains a propellant (e.g., liquid or gas) or a nebulizer.
  • a propellant e.g., liquid or gas
  • a nebulizer e.g., nebulizer
  • antibodies of this invention are prepared with carriers to protect the antibodies against rapid elimination from the body.
  • Biodegradable polymers e.g., ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic acid
  • ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic acid are often used.
  • Antibodies or compositions according to the invention may be administered in therapeutically effective amounts, as determined, based on, for example, the patient's weight, gender, age and medical condition.
  • the antibodies or compositions may be administered in a single dose, as a bolus or as continuous therapy.
  • the term effective amount refers to an amount sufficient to provide a therapeutic or diagnostic effect.
  • non-human animals of the invention includes all vertebrates, such as non-human primates, sheep, dogs, cows, chickens, amphibians, reptiles, etc.
  • FIGS. 1 to 25 show amino acid sequences and nucleotide sequences of antibodies and fragments thereof according to the invention.
  • FIG. 26 Analysis of affinity purified antigen by PAGE and Western blotting.
  • M r represents the molecular weight marker.
  • FIG. 27 Photomicrographs of A. fumigatus AF293 cells immuno-stained with JF5 and anti-mouse polyvalent immunoglobulin FITC.
  • FIG. 28 Immunogold localization of JF5 antigen in cells of A. fumigatus AF293. Longitudinal section of germling grown in human serum, showing localization of antigen in the cell walls of the germ tube (GT) and swollen conidium, in the septum (S), and in a surrounding capsular-like layer (C). Bar, 0.5 ⁇ m.
  • GT germ tube
  • S septum
  • C capsular-like layer
  • FIG. 29 Serum LFD tests.
  • FIG. 30 Analysis of flow-through and eluate fractions from lectin spin columns by using denaturing SDS-PAGE and Western blotting.
  • Lanes M molecular mass markers
  • lane PA untreated purified antigen
  • lanes LCH, ConA and GNA flow-through or eluate fractions from lentil lectin ( Lens culinaris haemagglutinin).
  • Concanavalin A lectin or snowdrop lectin Galanathus nivalis agglutinin
  • FIG. 31 Examples of results from (A) negative, (B) weakly positive, (C) moderately positive, and (D) strongly positive lateral-flow device assays. In the absence of the Aspergillus antigen, no complex was formed in the zone containing solid-phase JF5 antibody, and a single internal control line was observed (A).
  • FIG. 32 Results from serial serum samples collected over time from the same guinea pigs with invasive pulmonary aspergillosis as measured by lateral-flow technology (A), the galactomannan assay (B), and the (1 ⁇ 3)- ⁇ -D-glucan assay (C).
  • Each line represents the biomarker results from one animal at multiple time points.
  • Serial samples were available for measurement of each biomarker at the multiple time points in 6 guinea pigs.
  • + represents weakly positive results, ++ moderately positive results, and +++ strongly positive results.
  • mice were immunized with lyophilized mycelium (LM) of A. fumigatus AF293.
  • Minimal medium (19 mM (NH 4 ) 2 PO 4 , 0.5% (wt/vol) yeast extract, 7 mM sodium citrate, 2 mM MgSO 4 .7H 2 O, 0.5 mM CaCl 2 .2H 2 O and 50 mM glucose, adjusted to pH 5.5 with 1 N HCl) was sterilized by autoclaving at 121° C. for 15 min.
  • LM fetal calf serum
  • PBS phosphate buffered saline
  • 8 mM Na 2 HPO 4 8 mM Na 2 HPO 4
  • 1.5 mM KH 2 PO 4 [pH7.2] Six-week-old BALB/c female white mice were given four intraperitoneal injections (300- ⁇ l per injection) of immunogen at 2 wk intervals and a single booster injection five days before fusion.
  • Hybridoma cells were produced by the method described elsewhere (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N.J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford) and the supernatants were screened by enzyme-linked immunosorbent assay (ELISA) against soluble antigens extracted from LM in PBS and immobilized to the wells of Maxisorp microtiter plates (50 ⁇ l per well). For antibody specificity tests, fungi were grown on SA and surface washings prepared in PBS as described in Thornton (Thornton, C. R. 2001.
  • TCM tissue culture medium
  • fetal calf serum 10% (vol/vol) fetal calf serum. All incubation steps were performed at 23° C. in sealed plastic bags.
  • the threshold for detection of antigen in ELISA was determined from control means (2 ⁇ TCM absorbance values) (Sutula, C. L., J. M. Gillett, S. M. Morrisey, and D. C. Ramsdell. 1986. Interpreting ELISA data and establishing the positive-negative threshold. Plant Dis. 70:722-726). These values were consistently in the range 0.050-0.100. Consequently absorbance values >0.100 were considered as positive for the detection of antigen.
  • the Ig class of mAbs was determined with a commercial mouse mAb isotyping kit (ISO-1) according to the manufacturers instructions (Sigma). Hybridoma cells lines were cloned by limiting dilution, and cell lines were grown in bulk in a non-selective medium, preserved by slowly freezing in fetal bovine serum/dimethyl sulfoxide (92:8 [vol/vol]), and stored in liquid nitrogen.
  • ISO-1 commercial mouse mAb isotyping kit
  • Antigen was purified from PBS extracts of LM by affinity chromatography using a Protein A IgG Plus Orientation Kit (Pierce Biotechnology, Rockford, Ill., USA) containing immobilized JF5 mAb.
  • Ascites fluid was prepared from JF5 hybridoma cells in female BALB/c mice (Eurogentec s.a., Belgium). Mice were injected with 10 6 hybridoma cells washed in PBS and, after 3 wk, approximately 5 ml of ascites fluid was recovered from each mouse and was stored at ⁇ 20° C. prior to use.
  • 15 of ascites fluid was mixed with 2 ml of binding buffer and the solution applied to the Protein A-agarose matrix.
  • Immunolabelling was carried with mAb JF5 and goat anti-mouse 20-nm gold conjugate (British Biocell International, Cambridge, Wales) as the secondary reporter molecule. Control grids were incubated with TCM instead of mAb supernatant, but were otherwise treated the same. For IF studies, washed conidia were suspended in glucose solution and transferred to the wells of multiwell slides. After incubation at 37° C. for 16 h, slides were air-dried and fixed as described in Thornton (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N. J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford).
  • the LFD consisted of G&L Diecut 1734 backing card, Whatman 17chr and 1281 top and sample pads respectively, and Whatman Immunopore 5 ⁇ M nitocellulose membrane.
  • Monoclonal antibody JF5 was conjugated to 40 nm gold particles, applied to the release pad at 100 units of conjugate/cm, and dried for 16 h at 37° C.
  • the test line antibody consisted of JF5 mAb at 0.5 mg protein/ml of PBS containing 1% (wt/vol) BSA while a commercial rabbit anti-mouse Ig acted as the control line.
  • Candida albicans and Cryptococcus neoformans Tubes were incubated at 37° C. with shaking (100 rpm) for 48 h and fungal propagules precipitated by centrifugation. One hundred- ⁇ l samples of neat, cell-free, supernatants were applied to LFD devices and results recorded as described. Growth of filamentous fungi and the yeast Candida albicans was determined by visual appraisal of hypha) development or by increases in turbidity of serum samples ( C. neoformans ). Unspiked serum incubated under the same conditions acted as the negative control.
  • the cell line JF5 was selected and was sub-cloned three times.
  • the monoclonal antibody from the sub-cloned cell line JF5 belonged to the immunoglobulin class G3 (IgG3).
  • Monoclonal antibody JF5 was tested for specificity against a wide range of related and unrelated fungi (Table 1). It reacted with antigens from Aspergillus species and related fungi from the teleomorphic genera Emericella, Eurotium and Neosartorya . It cross-reacted with antigens from certain Penicillium species, but not with Penicillium species in the subgenus Biverticillium or teleomorphic Talaromyces species whose Penicillium anamorphs belong to this subgenus.
  • niveus Fennelia nivea 261.73 CBS 1.085 Subgenus Circumdati Section Wentii A. wentii 229.67 CBS 0.000 Section Flavi A. flavus 91856iii IMI 1.053 A. oryzae 29 CRT 0.963 Section Nigri A. niger 102.40 CBS 1.433 121.49 CBS 1.155 522.85 CBS 1.057 553.65 CBS 1.066 Section Circumdati A. ochraceous 625.78 CBS 1.249 Section Candidi A.
  • candidus 266.81 CBS 0.541 Aureobasidium pullulans 657.76 CBS 0.015 Botrytis cinerea R2 CRT 0.077 Candida albicans SC5314 SB 0.000 C. dubliniensis 8500 CBS 0.015 C. glabrata 4692 CBS 0.000 Chaetomium globosum 147.51 CBS 0.013 Cladosporium herbarum 159.59 CBS 0.067 Cryptococcus neoformans 5728 CBS 0.010 C. neoformans 7779 CBS 0.009 Cunninghamella bertholletiae 182.84 CBS 0.012 Exophiala dermatitidis 153.94 CBS 0.024 Fusarium oxysporum f.sp.
  • Antigen(s) were purified from Aspergillus fumigatus using the method described. Purified antigen solution was subjected to glycoprotein fractionation using a Qproteome Mannose Glycoprotein Kit (Catalog no. 37551; Qiagen Ltd., Crawley, UK) according to the manufacturer's instructions.
  • the ConA, GNA, and LCH lectin spin columns in the kit allow specific enrichment of glycoproteins with mannose-rich glycan moieties. The three lectins each bind different subclasses of these moieties.
  • ConA binds biantennary and triantennary complex type N-glycans
  • LCH binds biantennary and triantennary complex type N-glycans with core fucose
  • GNA binds ⁇ 1-3 and ⁇ 1-6 linked high mannose structures.
  • Mild alkaline hydrolysis ( ⁇ -elimination). Mild alkaline hydrolysis results in cleavage of glycans O-linked through the ⁇ -hydroxy amino acids serine and threonine. It does not cleave glycans N-linked through asparagine.
  • Chemical modification of the purified antigen was carried out according the procedure described in Thornton (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N. J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford). Briefly, purified antigen was immobilized to the wells of Maxisorp microtitre plates.
  • the wells were incubated with 50 ⁇ l of a 50 mM solution of NaOH or were incubated with 50 ⁇ l of dH 2 O only (control). After incubation for 24 h at 23° C., the wells were washed three times (3 min each time) with PBS and assayed by Enzyme-Linked Immunosorbent Assay (ELISA) with MAb JF5 as described.
  • ELISA Enzyme-Linked Immunosorbent Assay
  • N-terminal sequencing The N-terminal sequence (ALFALAKXV) of the protein component of the purified antigen was shown to have significant homology to the protein Cwplp from the yeast Saccharomyces cerevisiae (GenBank accession number EEU05173.1).
  • Cwp1p is a cell wall mannoprotein, linked to a ⁇ -1,3- and ⁇ -1,6-glucan heteropolymer through a phosphodiester bond (Van Der Vaart, J. M., L. H. P. Caro, J. W. Chapman, F. M. Klis, and C. T. Verrips, 1995. Identification of three mannoproteins in the cell wall of Saccharomyces cerevisiae . J.
  • JF5 IgG IgG monoclonal antibody
  • JF5 IgG was also conjugated to colloidal gold particles to serve as the detection reagent.
  • Serum was added to a release pad containing the antibody-gold conjugate, which bound the target antigen, then passed along the porous membrane and bound to JF5 IgG monoclonal antibody immobilized in the capture zone. Test results were available within 10-15 minutes after loading the sample.
  • Bound antigen-antibody-gold complex were observed as a red line with an intensity proportional to the antigen concentration, and were classified as negative, weakly positive, moderately positive, or strongly positive ( FIGS. 31A , B, C, and D).
  • Anti-mouse immunoglobulin immobilized to the membrane in a separate zone served as an internal control.
  • the (1 ⁇ 3)- ⁇ -D-glucan assay was performed using a commercially available kit (Fungitell, Associates of Cape Cod). Serum was transferred in duplicate to a 96-well cell culture tray and processed according to the manufacturer's instructions. The mean rate of change in optical density (OD) at 405 nm over time was measured using a microplate spectrophotometer (Synergy HT; Biotek Instruments) and unknowns were interpolated from a standard curve. Serum galactomannan was measured using a commercially available kit (Platelia Aspergillus EIA, Bio-Rad Laboratories). Serum was heat-treated following the addition of an EDTA acid solution.
  • OD optical density
  • Treated supernatant was added to microwells containing conjugate and the rat monoclonal antibody EB-A2. Following incubation, microwells were washed and the substrate solution added forming a complex with the monoclonal antibody.
  • the OD values of each sample, positive control, negative control, and cut-off control were measured using a microplate spectrophotometer at 450 and 630 nm, and the galactomannan index (GMI) was calculated as the OD of each sample divided by the mean cut-off of the control.
  • the lateral-flow assay and the (1 ⁇ 3)- ⁇ -D-glucan and galactomannan assays were performed in separate laboratories by different investigators blinded to the results of the other.
  • time to positivity was defined as the first time point at which three serum samples became positive. Time to positivity was plotted by Kaplan-Meier analysis, and differences in median time at which the assays became positive were analyzed by the log-rank test. Differences in the number of positive samples per time point between the assays were determined by Fisher's exact test. The overall specificity of each assay was also measured in uninfected controls. All statistical tests were performed using Prism 5.0 (GraphPad Software, Inc.).
  • the assays were negative 1 hour post-inoculation prior to the onset of invasive disease with the exception of a galactomannan test result (Table 3), which likely represents a false positive result, as invasive disease is not yet established.
  • Each biomarker became positive early with more than three samples positive for each assay by day 5 post-inoculation. In serial samples from the same animals, each biomarker continued to increase throughout the study ( FIGS. 32A , B, and C).
  • the weakly positive lateral-flow results were considered negative and only the moderately and strongly positive results positive, the time to positivity for each biomarker assay occurred at the day 5 time point.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Microbiology (AREA)
  • Cell Biology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Botany (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Veterinary Medicine (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The invention relates to antibodies to Aspergillus species and to methods of producing those antibodies. The invention also relates to the use of such antibodies in identifying the presence of the Aspergillus species and to methods of treating an infection with the Aspergillus species.

Description

    FIELD OF THE INVENTION
  • This invention relates to a method of diagnosing a fungal infection, and to antibodies and related molecules for use in such a method.
    • BACKGROUND
  • The dramatic increase in opportunistic infections of humans caused by Aspergillus species over the last decade is associated with a rise in the numbers of solid-organ transplants and the use of aggressive cancer therapies and other immuno-modulating treatments (Brakhage, A. A., and K. Langfelder. 2002. Menacing mold: the molecular biology of Aspergillus fumigatus. Annu. Rev. Microbiol. 56:433-455; Latgé, J.-P. 1999. Aspergillus fumigatus and Aspergillosis. Clin. Microbiol. Rev. 12:310-350). The mortality due to invasive aspergillosis (IA) has increased by 357% over the last 25 years and IA has become one of the leading causes of death in immuno-compromised patients, with mortality rates ranging from 60 to 90% (McNeil, M. M., S. L. Nash, R. A. Hajjeh, M. A. Phelan, L. A. Conn, B. D. Plikaytis, and D. L. Warnock. 2001. Trends in mortality due to invasive mycotic diseases in the United States, 1980-1997. Clin. Infect. Dis. 33:641-647), even following the recent introduction of new broad-spectrum antifungal agents. The most common species of Aspergillus causing invasive disease include A. fumigatus, A. flavus, A. niger, A. terreus, and A. nidulans. Other less common species can also cause the disease, but A. fumigatus accounts for ˜90% of cases of IA (Denning, D. W. 1998. Invasive Aspergillosis. Clin. Infect. Dis. 26:781-805).
  • In the absence of a single ‘gold standard’ test for the disease, definitive diagnosis of IA encompasses data from clinical, radiological, serological, molecular biological, mycological and histopathological sources. It is imperative that diagnosis is made without delay, since prognosis worsens significantly in the absence of recognition and effective treatment. Rapid detection of IA using immuno-diagnostics has centred around the detection of fungal galactomannan (GM) (Latge, J.-P., H. Kobayashi, J. P. Debeaupuis, M. Diaquin, J. Sarfati, J. M. Wieruszeski, E. Parra, J. P. Bouchara, and B. Fournet. 1994. Chemical and immunological characterization of the extracellular galactomannan secreted by Aspergillus fumigatus. Infect. Immun. 62:5424-5433, Pazos, C., J. Ponton, and A. Del Palacio. 2005. Contribution of (1→3)-β-D-glucan chromogenic assay to diagnosis and therapeutic monitoring of invasive aspergillosis in neutropenic adult patients: a comparison with serial screening for circulating galactomannan. J. Clin. Microbiol. 43:299-305, Quindos, G. 2006. New microbiological techniques for the diagnosis of invasive mycoses caused by filamentous fungi. Clin. Microbiol. Infect. 12:40-52). Monoclonal antibodies (mAbs) have been successfully used in the detection of GM, and they form the basis of commercial laboratory-based tests such as the Platelia Aspergillus ELISA kit that incorporates a rat mAb (EB-A2) directed against tetra (1→5)-β-D-galactofuranoside, the immunodominant epitope in the antigen (Morelle, W., M. Bernard, J.-P. Debeaupuis, M. Buitrago, M. Tabouret, and J.-P. Latgé. 2005. Galactomannoproteins of Aspergillus fumigatus. Euk. Cell 4:1308-1316, Stynen, D, A. Goris, J. Sarfati, and J.-P. Latge. 1995. A new sensitive sandwich enzyme-linked immunosorbent assay to detect galactofuran in patients with invasive aspergillosis. J. Clin. Microbiol. 33:497-500, Stynen, D., J. Sarfati, A. Goris, M.-E. Prevost, M. Lesourd, H. Kamphuis, V. Darras, and J.-P. Latgé. 1992. Rat monoclonal antibodies against Aspergillus galactomannan. Inf. Immun. 60:2237-2245). Immunoassays for GM detection are a significant asset for managing patients at risk from IA because of detection of the antigen in the early stages of disease progression. Despite their widespread use, recent studies have revealed significant variation in performance. While specificity of the GM assay is consistently >85%, sensitivity of the assay can vary considerably between 29% and 100% and false-positive reactivity can vary from 5% in adults to 83% in newborn babies (Verweij, P. E., and M. A. S. H. Mennink-Kersten. 2006. Issues with galactomannan testing. Med. Mycol. 44:179-183). False positive results have been attributed to cross-reaction of mAb EB-A2 with GM from non-Aspergillus fungi (Giacchino, M., N. Chiapello, S. Bezzio, F. Fagioli, P. Saracco, A. Alfarano, V. Martini, G. Cimino, P. Martino, and C. Girmenia. 2006. Aspergillus galactomannan enzyme-linked immunosorbent assay cross-reactivity caused by invasive Geotrichum capitatum. J. Clin. Microbiol. 44:3432-3434, Kappe, R., and A. Schulze-Berge. 1993. New cause for false-positive results with the Pastorex Aspergillus antigen latex agglutination test. J. Clin. Microbiol. 31:2489-2490, Quindos, G. 2006. New microbiological techniques for the diagnosis of invasive mycoses caused by filamentous fungi. Clin. Microbiol. Infect. 12:40-52, Swanink, C. M. A., J. F. G. M. Meis, A. J. M. M. Rijs, J. P. Donnelly, and P. E. Verweij. 1997. Specificity of the sandwich enzyme-linked immunosorbent assay for detecting Aspergillus galactomannan. J. Clin. Microbiol. 35:257-260, Verweij, P. E., and M. A. S. H. Mennink-Kersten. 2006. Issues with galactomannan testing. Med. Mycol. 44:179-183), with galactoxylomannan from Cryptococcus neoformans (Dalle, F., P. E. Charles, K. Blanc, D. Caillot, P. Chavanet, F. Dromer, and A. Bonnin. 2005. Cryptococcus neoformans galactoxylomannan contains an epitope(s) that is cross-reactive with Aspergillus galactomannan. J. Clin. Microbiol. 43:2929-2931, De Jesus, M., E. Hackett, M. Durkin, P. Connolly, A. Casadevall, R. Petraitiene, T. J. Walsh, and L. J. Wheat. 2007. Galactoxylomannan does not exhibit cross-reactivity in the Platelia Aspergillus enzyme immunoassay. Clin. Vacc. Immun. 14:624-627), with lipoteichoic acid from intestinal bifidobacteria in the gastrointestinal microbiota of neonates (Mennink-Kersten, M. A. S. H., R. R. Klont, A. Warris, H. J. M. Op den Camp, and P. E. Verweij. 2004. Bifidobacterium lipoteichoic acid and false ELISA reactivity in Aspergillus antigen detection. Lancet 363:325-327), with the cancer prodrug cyclophosphamide (Hashiguchi, K., Y. Niki, and R. Soejima. 1994. Cyclophosphamide induces false-positive results in detection of Aspergillus antigen in urine. Chest 105:975-976), and with GM in food, drink and infant milk formulas (Ansorg, R., R. Van den Boom, and P. M. Rath. 1997. Detection of Aspergillus galactomannan antigen in foods and antibiotics. Mycoses 40:353-357). Contamination of β-lactamantibiotics with Penicillium GM may account for serum reactivity of patients receiving piperacillin/tazobactam or amoxicillin/clavulanic acid (Aubry, A., R. Porcher, J. Bottero, S. Touratier, T. Leblanc, B. Brethon, P. Rousselot, E. Raffoux, J. Menotti, F. Derouin, P. Ribaud, and A. Sulahian. 2006. Occurrence and kinetics of false-positive Aspergillus galactomannan test results following treatment with β-lactam antibiotics in patients with hematological disorders. J. Clin. Microbiol. 44:389-394, Mattei, D., D. Rapezzi, N. Mordini, F. Cuda, C. Lo Nigro, M. Musso, A. Arnelli, S. Cagnassi, and A. Gallamini. 2004. False-positive Aspergillus galactomannan enzyme-linked immunosorbent assay results in vivo during amoxicillin-clavulanic acid treatment. J. Clin. Microbiol. 42:5362-5363, Verweij, P. E., and M. A. S. H. Mennink-Kersten. 2006. Issues with galactomannan testing. Med. Mycol. 44:179-183, Viscoli, C., M. Machetti, P. Cappellano, B. Bucci, P. Bruzzi, M. T. Van Lint, and A. Bacigalupo. 2004. False-positive galactomannan Platelia Aspergillus test results for patients receiving piperacillin-tazobactam. Clin. Infect. Dis. 38:913-916), although these reports have been disputed (Wu, D. H. 2004. Platelia Aspergillus assay and potential cross-reaction. Clin. Infect. Dis. 39:1402). There is therefore scope in IA immuno-diagnostics for tests that employ mAbs directed at epitopes other than those present on GM. While a ‘pan-fungal’ test that detects fungal (1→3)-β-D-glucan has been used for the diagnosis of invasive fungal infections (Pazos, C., J. Ponton, and A. Del Palacio. 2005. Contribution of (1→3)-β-D-glucan chromogenic assay to diagnosis and therapeutic monitoring of invasive aspergillosis in neutropenic adult patients: a comparison with serial screening for circulating galactomannan. J. Clin. Microbiol. 43:299-305, Quindos, G. 2006. New microbiological techniques for the diagnosis of invasive mycoses caused by filamentous fungi. Clin. Microbiol. Infect. 12:40-52), its lack of specificity means that it is unable to discriminate between Aspergillus species and other opportunistic pathogens, which compromises the ability to select the most appropriate antifungal agent. In contrast, an ELISA used to detect the Afmp1p cell wall antigen of A. fumigatus in patient's sera provides a high degree of specificity but does not allow the detection of IA caused by other Aspergillus species (Woo, P. C. Y., C-M. Chan, A. S. P. Leung, S. K. P. Lau, X-Y Che, S. S. Y. Wong, L. Cao, and K-Y. Yuen. 2002. Detection of cell wall galactomannoprotein Afmp1p in culture supernatants of Aspergillus fumigatus and in sera of aspergillosis patients. J. Clin. Microbiol. 40:4382-4387). Furthermore, combinations of antibody and antigen testing of serum samples are required to provide serodiagnostic sensitivities for A. fumigatus IA detection comparable to GM tests.
  • Development of a non-invasive immunodiagnostic test that is rapid, reliable and relatively inexpensive and that detects surrogate (non-GM and non-Afmp1p) markers for IA, would allow routine testing of vulnerable patients who have an elevated risk of infection, such as allogeneic haematopoietic stem-cell-transplant recipients, patients with haematological malignancies and recipients of solid organ transplants, especially of the lung. The inventors here report the development of a mouse hybridoma cell line secreting an Aspergillus glycoprotein-specific mAb (JF5) and its utilization in the development of a lateral flow device (LFD) for the rapid serodiagnosis of IA. The assay exploits lateral flow technology that has been used, to date, in diagnostic tests for viruses, bacteria and toxins (Iweala, O. I. 2004. HIV diagnostic tests: an overview. Contraception 70:141-147, Ketema, F., C. Zeh, D. C. Edelman, R. Saville, and N. T. Constantine. 2001. Assessment of the performance of a rapid, lateral flow assay for the detection of antibodies to HIV. J. Acquir. Immune. Defic. Syndr. 27:63-70, Sharma, S. K., B. S. Eblen, R. L. Bull, D. H. Burr, and R. C. Whiting. 2005. Evaluation of lateral-flow Clostridium botulinum neurotoxin detection kits for food analysis. Appl. Environ. Microbiol. 71:3935-3941, Shyu, R. H., H. F. Shyu, H. W. Liu, and S. S. Tang. 2002. Colloidal gold-based immunochromatographic assay for detection of ricin. Toxicon 40:255-258, Smits, H. L., C. K. Eapen, S. Sugathan, M. Kuriakose, M. H. Gasem, C. Yersin, D. Sasaki, B. Pujianto, M. Vestering, T. H. Abdoel, and G. C. Gussenhoven. 2001. Lateral-flow assay for rapid serodiagnosis of human leptospirosis. Clin. Diagn. Lab. Immunol. 8:66-169) and, most famously, for the home pregnancy tests first introduced by Unipath in 1988. While immunochromatographic assays have been developed for the identification of Candida species (Marot-Leblond, A., L. Grimaud, S. David, D. J. Sullivan, D. C. Coleman, J. Ponton, and R. Robert. 2004. Evaluation of a rapid immunochromatographic assay for identification of Candida albicans and Candida dubliniensis. J. Clin. Microbiol. 42:4956-4960) and for the detection of fungi in soil (Thornton, C. R. Tracking fungi in soil with monoclonal antibodies. Eur. J. Pl. Pathol. 121:347-353, Thornton, C. R., A. C. Groenhof, R. Forrest, and R. Lamotte. 2004. A one-step, immunochromatographic lateral flow device specific to Rhizoctonia solani and certain related species, and its use to detect and quantify R. solani in soil Phytopathol. 94:280-288) this is the first time, to the best of the inventor's knowledge, that an LFD has been developed for the detection of Aspergillus antigens in human serum.
  • Current diagnostic tests for IA are confined to laboratories equipped to perform GM, β-glucan or nucleic acid-based diagnostic tests. The simplicity of the LFD format allows it to be used with minimal training and provides an additional diagnostic platform for the management of IA in high-risk patient groups. The ability of the LFD to detect Aspergillus antigens in clinical samples is demonstrated using sera from IA patients. Furthermore, its superior sensitivity in detecting IA compared to current galactomannan and β-glucan tests is shown using sera from a guinea pig model of disease.
    • SUMMARY OF THE INVENTION
  • In order to provide a new diagnostic tool for use in diagnosing Aspergillus antigens, the inventors identified an Aspergillus antigen found in growing hyphae. The inventors then produced molecules that bind to that antigen. The particular binding molecules, especially antibodies, may be used to not only identify an Aspergillus infection, but also to distinguish between active, growing colonies of Aspergillus and quiescent or dead colonies.
  • According to a first aspect of the invention, there is provided a hybridoma deposited under accession number ECACC 08120202.
  • According to a second aspect of the invention, there is provided an antibody which may be obtained by culture of the hybridoma, or a functional fragment of such an antibody.
  • According to a third aspect of the invention, there is provided an antibody, or antibody fragment or other molecule capable of specifically binding to Aspergillus, that antibody, fragment or binding molecule comprising a CDR, light chain, heavy chain, light chain variable region, heavy chain variable region or antigen binding region, especially FAb region, that shows substantial homology with the corresponding region of the antibody according to the second aspect of the invention. Preferably, the antibody, fragment or binding molecule also exhibits similar binding properties to the antibody according to the second aspect of the invention.
  • According to a fourth aspect, there is provided an antibody comprising a CDR comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
      • 19 to 25.
  • In particular, there is provided an antibody comprising a first CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
      • 19;
        a second CDR comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
      • 21 or 22; and
        a third CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
      • 24.
  • In particular, there is provided an antibody comprising a first CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
      • 20;
        a second CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
      • 23; and
        a third CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
      • 25.
  • Also provided is an antibody comprising a heavy chain comprising one or more CDRs having an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
      • 19, 21, 22 and 24.
  • The invention further provides an antibody comprising a light chain comprising one or more CDRs having an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
      • 20, 23 and 25.
  • Additionally, there is provided an antibody comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
      • 2, 4, 6, 8, 10, 11, 13, 15, 17 and 18.
  • The invention also provides an antibody comprising a heavy chain variable region having substantial homology to an amino acid sequence selected from the sequences shown in figures:
      • 2, 4, 6, 8, 10 and 11.
  • Preferably the antibody has a light chain variable region having substantial homology to the amino acid sequence selected from the sequences shown in figures:
  • 13, 15, 17 and 18.
  • In the amino acid sequences X is any amino acid. Preferably it is a non-polar amino acid, especially glycine. n is an integer between 0 and 8, preferably between 0 and 5, more preferably between 0 and 3, more preferably between 0 and 2, more preferably 0. Where a sequence contains more than one X, for example where n is greater than one, X may represent the same or a number of different amino acids. Where a sequence contains more than one Xn, each X may represent the same or a number of different amino acids. Each n may represent the same or different integers.
  • The invention further provides an antibody encoded by a nucleotide sequence having substantial homology to a nucleotide sequence selected from the sequences shown in figures:
      • 1, 3, 5, 7, 9, 12, 14 and 16.
  • Also provided is an antibody comprising a heavy chain variable region encoded by a nucleotide sequence having substantial homology to a nucleotide sequence selected from the sequences shown in figures:
      • 1, 3, 5, 7 and 9.
  • Preferably the antibody comprises a light chain variable region encoded by a nucleotide sequence having substantial homology to the nucleotide sequence selected from the sequences shown in figures:
      • 12, 14 and 16.
  • In another embodiment, there is provided an antibody that binds to the same epitope as an antibody according to other aspects of the invention.
  • In order that the invention may be better understood, certain terms are defined. Additional definitions may be found throughout the specification.
  • The term “antibody” is well known in the art. Herein it means an immunoglobulin or any functional fragment thereof. It encompasses any polypeptide that has an antigen-binding site. It includes but is not limited to monoclonal, polyclonal, monospecific, polyspecific, non-specific, humanized, human, single-chain, chimeric, synthetic, recombinant, hybrid, mutated, grafted, and in vitro generated antibodies. The term “antibody” encompasses antibody fragments such as Fab, F(ab′) 2, Fv, scFv, Fd, dAb, and any other antibody fragments that retain antigen-binding function. Typically, such fragments would comprise an antigen-binding domain. When preceded by the word “intact” the term “antibody” means a whole antibody molecule, namely two heavy chains, each with one variable region and three constant regions, and two light chains, each with one variable region and one constant region.
  • Intact antibodies are also known as immunoglobulins (Ig). As indicated above, intact antibodies comprise light chains and heavy chains. Light chains are classified into two isotypes, and heavy chains are classified into five isotypes (A, D, E, G, and M). Some heavy chain isotypes are further divided into isotype subclasses, e.g., IgG1, IgG2, IgG3, and IgG4. It is particularly preferred that the antibodies of the invention are IgG antibodies. In particular, IgG2b and IgG2a antibodies are preferred.
  • The domain and three dimensional structures of different antibodies are known in the art. The light chain is composed of a constant domain (C) and an N-terminal variable domain (V). The heavy chain is composed of three or four constant domains (CH), a hinge region, and a N-terminal variable domain (VH). The CH adjacent to the VH domain is designated CH1. The VH and VL domains contain four regions of conserved sequence called framework (FR) regions (FR1, FR2, FR3, and FR4), which form a scaffold for three regions of hypervariable sequence called complementarity determining regions (CDR). The CDRs (CDR1, CDR2, and CDR3) contain most of the antibody amino acids that specifically binds antigen. Heavy chain CDRs are denoted H1, H2, and H3, while light chain CDRs are denoted L1, L2, and L3. The term CDR is well known in the art. One skilled in the art would be able to recognise CDRs in an antibody or fragment by using Kabat numbering and the amino acids found either side of the CDRs.
  • The Fab fragment (Fragment antigen-binding) consists of VH, CH1, VL and CL domains covalently linked by a disulfide bond between the constant regions. The Fv fragment is smaller and consists of VH and VL domains non-covalently linked. To overcome the tendency of non-covalently domains to dissociate, a single chain Fv fragment (scFv) can be constructed. The scFv contains a flexible polypeptide that links the C-terminus of VH to the N-terminus of VL, or the C-terminus of VL to the N-terminus of VH. A 15-mer (Gly4Ser)3 peptide may be used as a linker, but other linkers are well known.
  • The terms “antigen-binding site”, “antigen-binding domain” and “antigen-binding fragment” mean the part of an antibody that specifically binds antigen. The part of the antigen that is recognised and bound by the antibody is referred to as the “epitope”. An antigen-binding domain usually comprises variable regions from both the light chain (VL) and the heavy chain (VH), but it does not have to comprise both. Antigen-binding fragments include Fab fragments (monovalent fragments consisting of the VL, VH, CL and CH1 domains); F(ab′)2 fragments (bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region); Fd fragments (the two VH and CH1 domains); Fv fragments (VL or VH domains, dAb fragments (Ward et al., (1989) Nature 341: 544-546), one or more complementarity determining regions (CDR); and single chain Fvs. The various antibody fragments can be obtained using conventional techniques known to those with skill in the art. It is possible to screen for the functionality of the fragments, e.g. binding and agonising a receptor using techniques known in the art.
  • As is known in the art, it is possible to use murine antibodies from mice and rats for therapy in humans. However, rodent antibodies tend to provoke strong Human anti-Murine Antibody (HAMA) immune responses which restricts their usefulness for repeated application in the same patient. Hence, the antibodies according to the invention are preferably chimeric, humanised (CDR grafted or reshaped).
  • The term “chimeric” refers to antibodies in which the whole of the variable regions of a mouse or rat antibody are expressed along with human constant regions. This provides the antibody with human effector functions and also reduces immunogenicity (HAMA) caused by the murine Fc region.
  • “Humanised” antibodies (also called CDR grafted or “reshaped antibodies”) are an alternative to chimeric antibodies in which only the complimentarily determining regions from the rodent antibody V-regions are combined with framework regions from human V-regions. The idea is that these antibodies should be more human-like than chimeric and thus perhaps less immunogenic than chimeric antibodies.
  • It is also possible to obtain fully human antibodies from transgenic mice or other transgenic animals. Transgenic mice have been created which have a repertoire of human immunoglobulin germline gene segments. These mice when immunised thus make human like antibodies. B cells from such immunised mice may be used in the production of monoclonal antibodies.
  • All of these types of antibodies are encompassed by the invention.
  • As mentioned above, the invention also encompasses functional fragments of antibodies. Whilst certain fragments are mentioned specifically, any functional fragment, that is to say, any fragment that exhibits similar binding properties as the relevant whole antibody is encompassed by the invention.
  • The antibodies of the invention are preferably able to bind to an epitope from an Aspergillus cell, especially an Aspergillus fumigatus cell. It is particularly preferred that the epitope is from growing hyphae.
  • The antibodies and nucleic acids of the invention are preferably isolated. The term “isolated” refers to a molecule that is substantially free of its natural environment. For instance, an isolated protein is substantially free of cellular material or other proteins from the cell or tissue source from which it was derived. The term also refers to preparations where the isolated protein is sufficiently pure for pharmaceutical compositions; or at least 70-80% (w/w) pure; or at least 80-90% (w/w) pure; or at least 90-95% (w/w) pure; or at least 95%, 96%, 97%, 98%, 99%, or 100% (w/w) pure.
  • The phrase “substantially homologous” means that the relevant amino acid or nucleotide sequence (e.g., CDR (s), VH or VL domain) will be identical to or have minor differences to the specifically defined sequences. Minor differences include minor amino acid changes, such as 1 or 2 substitutions in a 5 amino acid sequence of a specified region. In the case of antibodies, the second antibody has the same specificity and has at least 50% of the affinity of the same.
  • Sequences substantially identical or homologous (e.g., at least about 85% sequence identity) to the sequences disclosed herein are also part of this application. In some embodiments, the sequence identity can be about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or higher. In particular, when dealing with sequences of CDRs, substantial homology preferably means at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homology. When dealing with longer sequences, such as the sequences of the light or heavy chain variable regions, homology may be at least 85%, 87%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%. Sequences including constant regions may have less homology, for example, 75%, 80%, 85%, 87%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or higher. Substantially identical or homologous sequences also include nucleic acid sequences that will hybridize under selective hybridization conditions (e.g., highly stringent hybridization conditions), to the complement of the specifically defined strand. The percent identity can be determined by standard alignment algorithms, for example, the Basic Local Alignment Tool (BLAST) described by Altshul et al. ((1990) J. Mol. Biol., 215: 403-410); the algorithm of Needleman et al. ((1970) J. Mol. Biol., 48: 444-453); or the algorithm of Meyers et al. ((1988) Comput. Appl. Biosci., 4: 11-17). The percent identity between two amino acid or nucleotide sequences can also be determined using the algorithm of E. Meyers and W. Miller ((1989) CABIOS, 4: 11-17) which has been incorporated into the ALIGN program (version 2.0). This would be known by those skilled in the art.
  • The term “stringent” describes conditions for hybridization and washing. Stringent conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6.
  • Antibodies can be made by any method known in the art. A preferred method is using traditional hybridoma techniques (Kohler and Milstein (1975) Nature, 256: 495-499). For additional antibody production techniques, see Antibodies: A Laboratory Manual, eds. Harlow et al., Cold Spring Harbor Laboratory, 1988. No limitation is placed on the present invention as to method of production or source of antibody.
  • The invention provides antibodies that bind to Aspergillus. It is further envisaged that one skilled in the art could create more antibodies by altering the VH and/or VL sequence(s) provided. Such antibodies may be derived by a skilled person using techniques known in the art and are also encompassed by the invention. For example, modifications such as amino acid substitutions, deletions, or additions can be introduced into any part of the antibody, providing functionality remains. Changes may be introduced into the framework regions, especially to, for example improve the stability of the antibody. Changes may also be introduced into the CDRs to alter the antibody's affinity for the epitope. The affinity of an antibody for the epitope may be tested using standard techniques known in the art.
  • Conservative modifications to the VH and VL sequences are envisaged in particular. Such changes will produce molecules having functional and chemical characteristics similar to those of the antibodies from which the modifications are made. Conservative modifications are modifications unlikely to dramatically change the shape or function of the antibody, such as replacing one amino acid with another amino acid that has similar characteristics, e.g. replacing a hydrophobic amino acid with another hydrophobic amino acid.
  • When substituting amino acids, natural amino acids may be used, as may non-naturally occurring amino acids that have been created by, for example, chemical synthesis.
  • The antibodies according to the invention may be linked to other molecules. For example, antibodies may be linked to a protein or to a nonproteinaceous polymer such as polyethylene glycol, polypropylene glycol, and polyoxyalkylenes. Linking antibodies to such molecules is well known in the art and may be carried out by standard methods. Linking antibodies to such molecules can have an effect on certain characteristics of the antibodies, for example half life in blood.
  • Other molecules that may be linked to the antibody include detectable or functional tags or labels, such as enzymatic labels, e.g. horseradish peroxidase or alkaline phosphatase, radiolabels and chemical moieties e.g. biotin. The antibodies may also be linked to toxic agents such as toxins, cytostatic or cytotoxic molecules and radioisotopes. Alternatively, the antibodies may be linked to other antibodies.
  • The invention also provides methods of making antibodies, including a method of generating an antibody or functional fragment thereof comprising:
  • a) providing a repertoire of nucleic acids encoding a variable domain that either includes a CDR1,
  • CDR2 or CDR3 encoding region to be replaced or lacks a CDR1, CDR2 or CDR3 encoding region;
  • b) combining the repertoire with a donor nucleic acid having a nucleotide sequence encoding a sequence selected from the sequences in figures:
      • 19 to 25 to provide a repertoire of nucleic acids encoding a variable domain; and
        c) expressing a nucleic acid from the repertoire.
  • When replacing or inserting a nucleotide sequence encoding a CDR, one skilled in the art would use standard techniques and would know whether the CDR sequence could be inserted in isolation or whether framework regions should also be inserted. The skilled person would be able to make appropriate changes to the framework region if necessary.
  • The term “repertoire” refers to a genetically diverse collection of nucleotide sequences derived wholly or partially from sequences encoding immunoglobulins. The sequences may be generated by the method given above, or by rearrangement in vivo of the V, D, and J segments of heavy chains, and the V and J segments of light chains. Alternatively, the sequences can be generated from a cell in response to which rearrangement occurs, e.g., in vitro stimulation. Alternatively, part or all of the sequences may be obtained by DNA splicing, nucleotide synthesis, mutagenesis, and other methods, see, e.g., U.S. Pat. No. 5,565,332.
  • The method may additionally comprise selecting an antibody that binds an Aspergillus epitope from the expressed antibodies and isolating it.
  • The invention also provides isolated nucleic acids encoding antibodies according to the invention including nucleotides encoding the CDRs, variable domains and other functional fragments of such antibodies, and substantially homologous sequences. The nucleic acids may comprise DNA or RNA, and they may be synthetic (completely or partially) or recombinant (completely or partially).
  • The nucleotide sequences provided and references thereto encompass DNA molecules with the specified sequence, and encompass RNA molecules with the specified sequence in which U is substituted for T.
  • A nucleic acid may encode any part of the antibody for example, a CDR, a variable region, a light chain, a heavy chain, an scFv, a Fab, the entire antibody or any other functional fragment thereof.
  • Particularly provided is an isolated nucleic acid having substantial homology to a sequence selected from the sequences shown in figures:
  • 1, 3, 5, 7, 9, 12, 14 and 16.
  • The nucleic acids of the invention are substantially homologous to the sequences provided. In particular, the sequences are preferably at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% homologous to the sequences provided.
  • The invention also provides constructs such as plasmids, vectors, transcription or expression cassettes, which comprise at least one nucleic acid according to the invention.
  • Also provided is a host cell comprising at least one such construct.
  • Further provided is a method of making an antibody comprising culturing host cells under appropriate conditions so they express the antibody from the nucleic acid. Following expression and production, any desired fragment or antibody may be isolated and/or purified using any suitable technique, then used as appropriate.
  • Systems for cloning and expressing polypeptides in a variety of host cells are known in the art. Suitable host cells include mammalian cells, insect cells, plant cells, yeast cells, or prokaryotic cells, e.g., E. coli. Mammalian cells available in the art for heterologous polypeptide expression include lymphocytic cell lines (e.g. NSO), HEK293 cells, Chinese Hamster Ovary (CHO) cells, COS cells, HeLa cells, baby hamster kidney cells, oocyte cells.
  • It is particularly preferred that the antibodies of the invention are monoclonal antibodies. Monoclonal antibodies may be produced by standard methods, as first described by Kohler and Milstein.
  • The antibodies may be produced using a hybridoma. A hybridoma is well known in the art, is a cell created artificially by fusion of a tumour cell with a B-lymphocyte. Such cells are produced in the standard method of producing monoclonal antibodies, as first described by Kohler and Milstein.
  • The antibodies of the invention have multiple uses. Firstly, they may be used to identify the presence of an Aspergillus species, especially Aspergillus fumigatus. This may be a diagnostic use, identifying the presence of the species in a sample obtained from a patient. Also the use may be to identify the presence of the species in a sample obtained from a location, such as a building where an Aspergillus species may be present. The sample may be a swab taken from a wall of such a building, for example.
  • Also provided is a method of assaying for the presence of an Aspergillus species in a sample, comprising:
  • a) contacting the sample with labeled antibodies according to the invention; and b) observing the sample for binding of the antibodies to epitopes in the sample;
    wherein binding of the antibodies is indicative of the presence of an Aspergillus species.
  • The sample may be a sample obtained from a human or animal, and may be any appropriate sample, for example blood, serum, urine, plasma or bronchoalveolar lavage (BAL). Alternatively, the sample may be obtained from a site thought to contain Aspergillus, for example a swab taken from a building wall.
  • A labeled antibody is an antibody to which a detectable label has been attached. Suitable labels are well known in the art and examples are discussed above.
  • Also provided is a device or kit for carrying out the assay method, comprising a labeled antibody according to the invention. Preferably the device or kit is in the form of a lateral flow device.
  • There is provided a pharmaceutical composition comprising an antibody according to the invention.
  • The composition is suitable for administration to patients. In addition to the antibody, it may comprise one or more appropriate pharmaceutical excipient(s) such as solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents. The preparation of pharmaceutical compositions and the use of excipients is well known in the art. Other active compounds may also be included. The pharmaceutical compositions may also be included in a container, pack, or dispenser together with instructions for administration.
  • A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Methods to accomplish the administration are known to those of ordinary skill in the art. It may be possible to create compositions which may be topically or orally administered, or which may be capable of transmission across mucous membranes. For example, the administration may be intravenous, intraperitoneal, intramuscular, intracavity, subcutaneous, or transdermal.
  • Solutions or suspensions used for intradermal or subcutaneous application typically include at least one of the following components: a sterile diluent such as water, saline solution, fixed oils, polyethylene glycol, glycerine, propylene glycol, or other synthetic solvent; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetate, citrate, or phosphate; and tonicity agents such as sodium chloride or dextrose. The pH can be adjusted with acids or bases. Such preparations may be enclosed in ampoules, disposable syringes, or multiple dose vials.
  • Solutions or suspensions used for intravenous administration include a carrier such as physiological saline, bacteriostatic water, CremophorELT“” (BASF, Parsippany, N.J.), ethanol, or polyol. In all cases, the composition must be sterile and fluid for easy syringability. Proper fluidity can often be obtained using lecithin or surfactants. The composition must also be stable under the conditions of manufacture and storage. Prevention of microorganisms can be achieved with antibacterial and antifungal agents, e.g., parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, etc. In many cases, isotonic agents (sugar), polyalcohols (mannitol and sorbitol), or sodium chloride may be included in the composition. Prolonged absorption of the composition can be accomplished by adding an agent which delays absorption, e.g., aluminium monostearate and gelatin.
  • Oral compositions include an inert diluent or edible carrier. The composition can be enclosed in gelatin or compressed into tablets. For the purpose of oral administration, the antibodies can be incorporated with excipients and prepared as tablets or capsules, for example. The oral composition may also contain, for example, a binder, an excipient, a lubricant and flavourings.
  • Compositions may also be administered by a transmucosal or transdermal route. For example, antibodies that comprise a Fc portion may be capable of crossing mucous membranes in the intestine, mouth, or lungs (via Fc receptors). Transmucosal administration can be accomplished through the use of lozenges, nasal sprays, inhalers, or suppositories. Transdermal administration can also be accomplished through the use of composition containing ointments, salves, gels, or creams known in the art. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used.
  • For administration by inhalation, antibodies are delivered in an aerosol spray from a pressured container or dispenser, which contains a propellant (e.g., liquid or gas) or a nebulizer.
  • In certain embodiments, antibodies of this invention are prepared with carriers to protect the antibodies against rapid elimination from the body. Biodegradable polymers (e.g., ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, polylactic acid) are often used.
  • Methods for the preparation of such pharmaceutical compositions are known by those skilled in the art.
  • Antibodies or compositions according to the invention may be administered in therapeutically effective amounts, as determined, based on, for example, the patient's weight, gender, age and medical condition. The antibodies or compositions may be administered in a single dose, as a bolus or as continuous therapy.
  • The term effective amount refers to an amount sufficient to provide a therapeutic or diagnostic effect.
  • The term “non-human animals” of the invention includes all vertebrates, such as non-human primates, sheep, dogs, cows, chickens, amphibians, reptiles, etc.
  • Additionally, there is provided an antibody or functional fragment thereof according to the invention for use in therapy. The antibody or fragment is especially for use in the treatment of an infection with an Aspergillus species.
  • Also provided is a method of treating an infection with an an Aspergillus species, comprising administering a therapeutic amount of an antibody or fragment thereof according to the invention to a subject in need thereof.
    • BRIEF DESCRIPTION OF THE DRAWINGS
  • FIGS. 1 to 25 show amino acid sequences and nucleotide sequences of antibodies and fragments thereof according to the invention.
  • FIG. 26. Analysis of affinity purified antigen by PAGE and Western blotting. Mr represents the molecular weight marker.
  • A. Western immunoblot with monoclonal antibody (mAb) JF5 after separation of purified antigen by SDS-PAGE under reducing conditions. Well was loaded with 0.2 μg of protein.
  • B. Western immunoblot with mAb JF5 after treatment of purified antigen with peptide-N-glycosidase and separation by SDS-PAGE under denaturing conditions. Well was loaded with 0.2 μg of protein.
  • FIG. 27. Photomicrographs of A. fumigatus AF293 cells immuno-stained with JF5 and anti-mouse polyvalent immunoglobulin FITC.
  • A. Germlings examined under bright-field microscopy
  • B. Same slide as in (A), but examined under epifluorescence. Note intense staining of the cell walls of germ tubes, but lack of staining in ungerminated conidia (arrowed)
  • C. Hypha examined under bright-field microscopy
  • D. Same slide as in (C), but examined under epifluorescence. Note intense staining of cell wall and secretion of the antigen at the growing tip (arrowed). Bar, 6 μm.
  • FIG. 28. Immunogold localization of JF5 antigen in cells of A. fumigatus AF293. Longitudinal section of germling grown in human serum, showing localization of antigen in the cell walls of the germ tube (GT) and swollen conidium, in the septum (S), and in a surrounding capsular-like layer (C). Bar, 0.5 μm.
  • FIG. 29. Serum LFD tests.
  • A. LFD tests with normal human serum following inoculation with fungi and incubation for 48 h at 37° C. Negative reactions (single control line only) exhibited by Candida albicans (1), Pseudallescheria boydii (2), Rhizopus oryzae (3), Fusarium solani (4) and positive reaction (two lines) with Aspergillus fumigatus (5) are shown.
  • B. LFD tests of normal human serum (1), and serum spiked with affinity purified antigen (2) at a concentration of 2.5 μg protein/ml.
  • C. Examples of results from LFD tests of serum samples from healthy individuals or patients confirmed with IA. Negative, weak and strong reactions exhibited with specimen numbers 90HD (1), 1657 (2), and 1131 (3) are shown. Specimen numbers relate to those shown in Table 4.
  • FIG. 30. Analysis of flow-through and eluate fractions from lectin spin columns by using denaturing SDS-PAGE and Western blotting. Lanes M, molecular mass markers; lane PA, untreated purified antigen; lanes LCH, ConA and GNA, flow-through or eluate fractions from lentil lectin (Lens culinaris haemagglutinin). Concanavalin A lectin or snowdrop lectin (Galanathus nivalis agglutinin) spin columns respectively. All wells were loaded with 0.5 μg of protein. Note strong binding of MAb JF5 to eluate fraction from GNA spin column showing that the JF5 glycoprotein antigen(s) comprises terminal non-reducing mannose residues linked α-3 and α1-6.
  • FIG. 31. Examples of results from (A) negative, (B) weakly positive, (C) moderately positive, and (D) strongly positive lateral-flow device assays. In the absence of the Aspergillus antigen, no complex was formed in the zone containing solid-phase JF5 antibody, and a single internal control line was observed (A).
  • FIG. 32. Results from serial serum samples collected over time from the same guinea pigs with invasive pulmonary aspergillosis as measured by lateral-flow technology (A), the galactomannan assay (B), and the (1→3)-β-D-glucan assay (C). Each line represents the biomarker results from one animal at multiple time points. Serial samples were available for measurement of each biomarker at the multiple time points in 6 guinea pigs. For the y-axis of the lateral-flow device graph (A), + represents weakly positive results, ++ moderately positive results, and +++ strongly positive results.
    •  DETAILED DISCLOSURE Example 1 Fungal Culture
  • All fungi were cultured on Sabouraud agar (SA) under a 16 h fluorescent light regime.
  • Development of mAb, preparation of immunogen, and immunization regime. Mice were immunized with lyophilized mycelium (LM) of A. fumigatus AF293. Minimal medium (19 mM (NH4)2PO4, 0.5% (wt/vol) yeast extract, 7 mM sodium citrate, 2 mM MgSO4.7H2O, 0.5 mM CaCl2.2H2O and 50 mM glucose, adjusted to pH 5.5 with 1 N HCl) was sterilized by autoclaving at 121° C. for 15 min. Three-wk-old SA Petri dish cultures of the fungus were flooded with 20 ml dH2O and the conidia suspended by gentle agitation using an inoculation loop. Spore suspensions were filtered through Miracloth to remove mycelium and the filtrate containing conidia transferred to 1.5 ml micro-centrifuge tubes. The conidia were washed three times with dH2O by repeated vortexing and centrifugation at 12 000 g for 5 min and finally suspended in dH2O to give a concentration of 106 conidia/ml solution. Flasks containing 150 ml of media were inoculated with 200 μl of conidial suspension and incubated with shaking (150 rpm) for 24 h at 37° C. Mycelium was collected by filtering the contents of each flask through Miracloth, snap frozen in liquid N2, and lyophilized.
  • One mg of LM was suspended in 1 ml of phosphate buffered saline (PBS: 137 mM NaCl, 2.7 mM KCl, 8 mM Na2HPO4, and 1.5 mM KH2PO4 [pH7.2]). Six-week-old BALB/c female white mice were given four intraperitoneal injections (300-μl per injection) of immunogen at 2 wk intervals and a single booster injection five days before fusion.
  • Production and screening of hybridomas and determination of antibody specificity. Hybridoma cells were produced by the method described elsewhere (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N.J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford) and the supernatants were screened by enzyme-linked immunosorbent assay (ELISA) against soluble antigens extracted from LM in PBS and immobilized to the wells of Maxisorp microtiter plates (50 μl per well). For antibody specificity tests, fungi were grown on SA and surface washings prepared in PBS as described in Thornton (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N.J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford). Protein concentrations, determined spectrophotometrically at 280 nm (Nanodrop, Agilent Technologies Limited, Berkshire, UK), were adjusted to 64 μg/ml buffer, and 50 μl volumes used to coat the wells of microtiter plates. After coating overnight at 4° C., wells were washed four times with PBST (PBS containing 0.05% [vol/vol] Tween 20) and once each with PBS and dH2O and air-dried at 23° C. in a laminar flow hood. The plates were stored in sealed plastic bags at 4° C. in preparation for screening of hybridoma supernatants by ELISA as described below.
    • ELISA.
  • Wells containing immobilized antigens were incubated successively with hybridoma supernatant for 1 h, followed with goat anti-mouse polyvalent (immunoglobulin classes IgG, IgA, and IgM) peroxidase conjugate (Sigma Chemical Company, Poole, United Kingdom) diluted 1 in 1000 in PBST for a further hour. Bound antibody was visualised by incubating wells with tetramethyl benzidine substrate solution for 30 min and reactions were stopped by the addition of 3 M H2SO4. Absorbance values were determined at 450 nm with an MRX automated microplate reader (Dynex Technologies, Billingshurst, UK). Wells were given four 5-min rinses with PBST between incubations. Working volumes were 50 μl per well, and control wells were incubated with tissue culture medium (TCM) containing 10% (vol/vol) fetal calf serum. All incubation steps were performed at 23° C. in sealed plastic bags. The threshold for detection of antigen in ELISA, was determined from control means (2×TCM absorbance values) (Sutula, C. L., J. M. Gillett, S. M. Morrisey, and D. C. Ramsdell. 1986. Interpreting ELISA data and establishing the positive-negative threshold. Plant Dis. 70:722-726). These values were consistently in the range 0.050-0.100. Consequently absorbance values >0.100 were considered as positive for the detection of antigen.
    • Determination of Ig Subclass and Cloning Procedure.
  • The Ig class of mAbs was determined with a commercial mouse mAb isotyping kit (ISO-1) according to the manufacturers instructions (Sigma). Hybridoma cells lines were cloned by limiting dilution, and cell lines were grown in bulk in a non-selective medium, preserved by slowly freezing in fetal bovine serum/dimethyl sulfoxide (92:8 [vol/vol]), and stored in liquid nitrogen.
  • Antigen Purification, Polyacrylamide Gel Electrophoresis and Western Blotting.
  • Antigen was purified from PBS extracts of LM by affinity chromatography using a Protein A IgG Plus Orientation Kit (Pierce Biotechnology, Rockford, Ill., USA) containing immobilized JF5 mAb. Ascites fluid was prepared from JF5 hybridoma cells in female BALB/c mice (Eurogentec s.a., Belgium). Mice were injected with 106 hybridoma cells washed in PBS and, after 3 wk, approximately 5 ml of ascites fluid was recovered from each mouse and was stored at −20° C. prior to use. For preparation of the affinity column, 15 of ascites fluid was mixed with 2 ml of binding buffer and the solution applied to the Protein A-agarose matrix. Crude PBS antigen extract was then incubated with the immobilized antibody and bound antigen was eluted with 0.1 M glycine-HCl (pH2.8) buffer. Polyacrylamide gel electrophoresis (PAGE) was carried out using the system of Laemmli (Laemmli, U.K. 1970. Cleavage of structural proteins during assembly of the head of bacteriophage T4. Nature 227:680-685), with 4-20% (wt/vol) gradient polyacrylamide gels (Bio-Rad Laboratories Limited, Hemel Hempstead, UK), under denaturing conditions. Purified antigen was mixed with Laemmli buffer and denatured by heating at 95° C. for 10 min in the presence of β-mercaptoethanol prior to gel loading. Proteins were separated for 1.5 h at 23° C. (165V). Pre-stained, broad range, markers (Bio-Rad) were used for molecular mass determinations. For westerns, separated proteins were transferred electrophoretically to a PVDF membrane (Bio-Rad). Membranes were washed three times with PBS and then blocked for 16 h at 4° C. with PBS containing 1% (wt/vol) bovine serum albumin (BSA). Blocked membranes were incubated with JF5 mAb supernatant diluted 1 in 2 with PBS containing 0.5% (wt/vol) BSA (PBSA) for 2 h at 23° C. After washing three times with PBS, membranes were incubated for 1 h with goat anti-mouse IgG (whole molecule) alkaline phosphatase conjugate (Sigma) diluted 1 in 15,000 in PBSA. Membranes were washed twice with PBS, once with PBST and bound antibody visualized by incubation in substrate solution. Reactions were stopped by immersion in dH2O and air-dried between sheets of Whatman filter paper. Modification of the JF5 antigen using peptide-N-glycosidase (PNGase) was carried out prior to electrophoresis and western blotting according to procedures described elsewhere (Bleddyn Hughes, H., R. Carzaniga, S. L. Rawlings, J. R. Green, and R. J. O'Connell. 1999. Spore surface glycoproteins of Colletotrichum lindemuthianum are recognized by a monoclonal antibody which inhibits binding to polystyrene. Microbiol. SGM. 145:1927-1936).
  • Immunofluorescence and immunogold electron microscopy of A. fumigatus conidia and germlings. Immunogold labelling was performed with germlings of A. fumigatus AF293. Germlings were prepared by incubating washed conidia in normal human serum (Biosera, Ringmer, UK) or in sterile filtered (0.2 μM) 1% (wt/vol) glucose solution for 16 h at 37° C. with gentle mixing. Germlings were pelleted by centrifugation and low temperature embedding of material was carried out as described elsewhere (Thornton, C. R., and N. J. Talbot. 2006. Immunofluorescence microscopy and immunogold EM for investigating fungal infections of plants. Nat. Prot. 5:2506-2511). Immunolabelling was carried with mAb JF5 and goat anti-mouse 20-nm gold conjugate (British Biocell International, Cardiff, Wales) as the secondary reporter molecule. Control grids were incubated with TCM instead of mAb supernatant, but were otherwise treated the same. For IF studies, washed conidia were suspended in glucose solution and transferred to the wells of multiwell slides. After incubation at 37° C. for 16 h, slides were air-dried and fixed as described in Thornton (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N. J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford). Wells were incubated for 1 h with 50 μl of mAb JF5 supernatant or TCM only. Slides were washed three times with PBS with gentle agitation and incubated for a further 30 min with goat anti-mouse polyvalent FITC conjugate (Sigma) diluted 1 in 40 in PBS. Slides were given three 5-min rinses with PBS and the wells overlaid with coverslips mounted in PBS-glycerol mounting medium (Sigma). Slides were examined with a Zeiss Axiophot microscope fitted with epifluorescence, using a UV excitation filter of 365 nm and an absorption filter of 420 nm. All incubation steps were performed at 23° C. in a moist environment and slides were stored at 4° C. in the dark in Petri dishes containing moistened Whatman filter paper no. 1.
  • Configuration of the LFD. The LFD consisted of G&L Diecut 1734 backing card, Whatman 17chr and 1281 top and sample pads respectively, and Whatman Immunopore 5 μM nitocellulose membrane. Monoclonal antibody JF5 was conjugated to 40 nm gold particles, applied to the release pad at 100 units of conjugate/cm, and dried for 16 h at 37° C. The test line antibody consisted of JF5 mAb at 0.5 mg protein/ml of PBS containing 1% (wt/vol) BSA while a commercial rabbit anti-mouse Ig acted as the control line.
  • Sensitivity and specificity of the LFD. Affinity purified antigen (protein concentrations determined as described) was diluted into normal human serum or PBS and 100 μl samples applied to the LFD. Unspiked serum and PBS acted as the negative controls. Results were recorded after 15 min as positive for the presence of Aspergillus antigen (two lines) or negative (single control line only). Specificity of the LFD was determined by growing fungi in normal human serum. Replicate 1 ml serum samples contained in 1.5-ml eppendorf tubes, were inoculated with 104 washed conidia from filamentous fungi (Aspergillus flavus, A. fumigatus, A. niger, A. terreus, Fusarium solani, Pseudallescheria boydii and Rhizopus wyzae), or an equivalent number of washed yeast cells (Candida albicans and Cryptococcus neoformans). Tubes were incubated at 37° C. with shaking (100 rpm) for 48 h and fungal propagules precipitated by centrifugation. One hundred-μl samples of neat, cell-free, supernatants were applied to LFD devices and results recorded as described. Growth of filamentous fungi and the yeast Candida albicans was determined by visual appraisal of hypha) development or by increases in turbidity of serum samples (C. neoformans). Unspiked serum incubated under the same conditions acted as the negative control.
  • Further tests of LFD specificity were conducted using serum containing the β-lactam antibiotics penicillin-G (Melford Laboratories Limited, Ipswich, UK), amoxicillin (Fluka) and piperacillin (Sigma), the β-lactamase inhibitor tazobactam (Sigma), the cancer prodrug cyclophosphamide (Sigma), and lipoteichoic acids from the bacteria Enterococcus faecalis and Staphylococcus aureus (both from Sigma). Following reconstitution, 100 μl volumes of solutions containing 5 mg of solid/ml serum (lipoteichoic acids) or 50 mg solid/ml serum (antibiotics, tazobactam and cyclophosphamide) were applied to LFD devices and results recorded as described. Unspiked serum acted as the negative control, while serum samples containing purified antigen and test chemicals acted as positive controls. Three replicates were performed for each test.
  • LFD detection of antigen in IA sera. The ability of the LFD to detect circulating antigen in humans with IA was tested with sera collected from known or suspected IA patients and from healthy controls. The samples were kindly provided during a blind assessment of assay sensitivity and specificity conducted in collaboration with Dr Elizabeth Johnson (Bristol Health Protection Agency). The samples had previously been tested using the Platelia GM EIA and a pan-fungal β-glucan test (Fungitell). One hundred-1 samples of undiluted serum or serum diluted 1 in 10 in normal human serum were applied to LFD devices and the results recorded as described. Three replicates were performed for each sample.
    • Production of Hybridoma Cell Lines and Isotyping of Mabs.
  • A single fusion was performed. Cell lines were selected for further study based on the strength of mAb reaction in ELISA. The cell line JF5 was selected and was sub-cloned three times. The monoclonal antibody from the sub-cloned cell line JF5 belonged to the immunoglobulin class G3 (IgG3).
    • Monoclonal Antibody Specificity Tests.
  • Monoclonal antibody JF5 was tested for specificity against a wide range of related and unrelated fungi (Table 1). It reacted with antigens from Aspergillus species and related fungi from the teleomorphic genera Emericella, Eurotium and Neosartorya. It cross-reacted with antigens from certain Penicillium species, but not with Penicillium species in the subgenus Biverticillium or teleomorphic Talaromyces species whose Penicillium anamorphs belong to this subgenus. It cross-reacted weakly with antigens from the closely related fungus Paecilomyces variotii, but did not react with antigens from a wide range of unrelated fungi including the well-documented invasive pathogens Candida albicans, Cryptococcus neoformans, and the emerging pathogens Fusarium solani, Pseudallescheria boydii and Rhizopus oryzae (Groll, A. H, and T. J. Walsh. 2001. Uncommon opportunistic fungi: new nosocomial threats. Clin. Microbiol. Infect. 7:8-24, Ribes, J. E., C. L. Vanover-Sams, D. J. Baker. 2000. Zygomycetes in human disease. Clin. Microbiol. Rev. 13:236-301, Walsh, T. J., and A. H. Groll. 1999. Emerging fungal pathogens: evolving challenges to immunocompromised patients for the twenty-first century. Transpl. Infect. Dis. 1: 247-261, Walsh, T. J., A. Groll, and J. Hiemenz. 2004. Infections due to emerging and uncommon medically important fungal pathogens. Clin. Microbiol. Infect. 10: 48-66).
    • Characterisation of the Antigen.
  • Polyacrylamide gel electrophoresis and Western blotting. The affinity purified antigen eluted from the column as a single peak containing 0.340 mg protein/ml of buffer. The diffuse binding pattern in Western blotting studies (FIG. 26A) showed that antigen bound by JF5 is glycosylated and is a pattern consistent with binding of mAbs to extracellular glycoproteins in A. fumigatus (Stynen, D., J. Sarfati, A. Goris, M.-E. Prevost, M. Lesourd, H. Kamphuis, V. Darras, and J.-P. Latgé. 1992. Rat monoclonal antibodies against Aspergillus galactomannan. Inf. Immun. 60:2237-2245). De-glycosylation of the antigen with the enzyme PNGase showed that the protein moiety of the glycoprotein bound by mAb JF5 has an approximate molecular weight of 40 kDa and has an N-glycosylated component (FIG. 26B).
  • Immunofluorescence and immunogold electron microscopy of conidia and germlings. Immunofluorescence studies showed that the antigen was absent from the surface of ungerminated spores, but was present on the hyphal surface of germlings and was secreted from the hyphal tip (FIG. 27). Immunogold electron microscopy showed that the antigen was present in the hyphal cell wall and in septa and in a capsule-like layer surrounding cells (FIG. 28).
  • Sensitivity and specificity of the LFD. There was strong detection of the affinity purified antigen in LFD tests (FIG. 29) with an assay sensitivity of 37 ng protein per ml of serum. In PBS only, the sensitivity of the assay was 1.25 ng protein per ml. After 48 h growth of fungi in human serum, there was strong detection of the antigen in serum spiked with 104 conidia of A. fumigatus AF293 (FIG. 29) and with other Aspergillus species (results not shown). No antigen was detected in serum inoculated with the other fungi tested (FIG. 29), despite prolific growth. No false-positive reactions were exhibited with the β-lactam antibiotics tested or with tazobactam, cyclophosphamide, and bacterial lipoteichoic acids. The chemicals did not inhibit detection of purified antigen (results not shown).
  • Detection of antigen in IA sera. The JF5 antigen was detected in sera from patients with known or probable IA infection (Table 2). No false negatives were found with sera from healthy individuals. LFD test results were similar to those for GM detection using the Platelia EIA. However, three of the samples (1655, 1665 and 1667) from patients diagnosed with IA on the basis of clinical symptoms gave positive reactions with the LFD but were negative in the GM test. One of these samples (1655) and two others (samples 1537 and 1538) gave negative LFD reactions when used undiluted but gave positive reactions when diluted ten-fold in normal serum. This was likely due to a high-dose hook effect where high serum antigen concentrations impaired antigen-antibody binding. Results for all other samples were the same when used neat or diluted. Examples of negative and positive reactions with sera are shown in FIG. 29.
  • TABLE 1
    Details of organisms and results of ELISA specificity tests
    Absorbance
    Organism Isolate no. Sourcea (450 nm)b
    Absidia corymbifera 101040 CBS 0.027
    A. glauca 1 CRT 0.032
    A. spinosa 3 CRT 0.000
    Acremonium atrogriseum 306.85 CBS 0.083
    A. blochii 424.93 CBS 0.006
    Alternaria alternata 42 CRT 0.000
    Apophysomyces elegans 658.93 CBS 0.007
    Subgenus Aspergillus
    Section Aspergillus
    Eurotium amstelodami 34 CRT 0.866
    Section Restricti
    Aspergillus restrictus 116.50 CBS 0.938
    Subgenus Fumigati
    Section Fumigati
    Aspergillus fumigatus 181 CRT 1.020
    AFC CRT 0.935
    AF293 SK 1.213
    Neosartorya fischeri var. fischeri 681.77 CBS 1.105
    Section Cervini
    A. cervinus 537.65 CBS 0.667
    Subgenus Ornati
    Section Ornati
    A. ornatus 184 CRT 1.381
    (Hemicarpenteles ornatus)
    Subgenus Clavati
    Section Clavati
    A. clavatus 514.65 CBS 1.307
    Subgenus Nidulantes
    Section Nidulantes
    A. nidulans 542.83 CBS 1.133
    (Emericella nidulans var. nidulans) A4 FGSC 1.237
    A26 FGSC 1.075
    Emericella quadrilineata 591.65 CBS 1.045
    Section Versicolores
    Aspergillus versicolor 599.65 CBS 1.120
    Section Usti
    A. ustus 209.92 CBS 0.510
    Section Terrei
    A. terreus var. terreus 601.65 CBS 1.186
    Section Flavipedes
    A. niveus (Fennelia nivea) 261.73 CBS 1.085
    Subgenus Circumdati
    Section Wentii
    A. wentii 229.67 CBS 0.000
    Section Flavi
    A. flavus 91856iii IMI 1.053
    A. oryzae 29 CRT 0.963
    Section Nigri
    A. niger 102.40 CBS 1.433
    121.49 CBS 1.155
    522.85 CBS 1.057
    553.65 CBS 1.066
    Section Circumdati
    A. ochraceous 625.78 CBS 1.249
    Section Candidi
    A. candidus 266.81 CBS 0.541
    Aureobasidium pullulans 657.76 CBS 0.015
    Botrytis cinerea R2 CRT 0.077
    Candida albicans SC5314 SB 0.000
    C. dubliniensis 8500 CBS 0.015
    C. glabrata 4692 CBS 0.000
    Chaetomium globosum 147.51 CBS 0.013
    Cladosporium herbarum 159.59 CBS 0.067
    Cryptococcus neoformans 5728 CBS 0.010
    C. neoformans 7779 CBS 0.009
    Cunninghamella bertholletiae 182.84 CBS 0.012
    Exophiala dermatitidis 153.94 CBS 0.024
    Fusarium oxysporum f.sp. melonis 422.90 CBS 0.000
    F. oxysporum f.sp. pisi 260.50 CBS 0.005
    F. solani 224.34 CBS 0.034
    F. solani 80 CRT 0.056
    F. solani var. petrophilum 102256 CBS 0.006
    F. verticillioides 539.79 CBS 0.000
    Geotrichum capitatum 327.86 CBS 0.014
    Mucor fragilis 4 CRT 0.033
    M. hiemalis var. silvaticus 50 CRT 0.002
    Paecilomyces variotii 339.51 CBS 0.163
    P. variotii 17.1 CRT 0.143
    Penicillium brevicompactum 210.28 CBS 0.571
    P. cinnabarinum 39 CRT 0.885
    P. chrysogenum 105 CRT 1.248
    P. citrinum 139.45 CBS 0.556
    P. cyclopium 123.14 CBS 0.630
    P. dierckxii 250.66 CBS 0.629
    P. expansum 106 CRT 1.141
    P. jensenii 43 CRT 1.115
    P. islandicum 338.48 CBS 0.004
    P. marneffei 101038 CBS 0.093
    669.95 CBS 0.057
    P. melinii 218.30 CBS 0.486
    P. purpurogenum 364.48 CBS 0.006
    P. roqueforti 221.30 CBS 0.347
    P. simplicissimum 220.30 CBS 0.500
    P. spinulosum 108 CRT 1.290
    P. variabile 385.48 CBS 0.037
    Phialophora verrucosa 225.97 CBS 0.021
    Pseudallescheria boydii 835.96 CBS 0.004
    Rhizomucor miehei 360.92 CBS 0.005
    Rhizopus microsporus var.
    rhizopodiformis 102277 CBS 0.020
    R. oryzae 146.90 CBS 0.016
    R. oryzae 395.54 CBS 0.010
    R. sexualis var. sexualis 209090 IMI 0.000
    R. stolonifer G1 CRT 0.000
    Saksenaea vasiformis 133.90 CBS 0.030
    Scedosporium prolificans 742.96 CBS 0.010
    S. prolificans 100391 CBS 0.025
    Stachybotrys chartarum 485.48 CBS 0.017
    Talaromyces flavus 437.62 CBS 0.051
    T. stipitatus 266.91 CBS 0.046
    Trichoderma longibrachiatum 446.95 CBS 0.000
    T. pseudokoningii 500.94 CBS 0.000
    Verticillium coccosporum GD2/B8 CRT 0.000
    Wallemia sebi 196.56 CBS 0.043
    aCBS = Centraalbureau voor Schimmelcultures, PO Box 85167, 3508 AD Utrecht, The Netherlands; FGSC = Fungal Genetics Stock Centre, University of Missouri, 5007 Rockhill Road, Kansas City, MO 64110, USA; CRT = C.R. Thornton; IMI = International Mycological Institute, Egham, England; SB = S. Bates, School of Biosciences, University of Exeter; SV = S. Krappman, Institute of Microbiology and Genetics, Department of Molecular Microbiology and Genetics, Georg-August-University, Gottingen, Germany.
    bEach value represents the mean of replicated values. Threshold absorbance value for detection of antigen: ≧0.100.
  • TABLE 2
    Results of LFD tests of serum samples from healthy individuals
    or from patients with known or suspected invasive aspergillosis
    Specimen Invasive Platelia GM Platelia Fungitell β-glucan Fungitell LFD
    number Aspergillosisa index value GM result concentration (pg/mL) result resultb
    6OHD No — — 45.90 Negative −
    7OHD No — — 42.40 Negative −
    8OHD No — — 44.30 Negative −
    9OHD No — — 44.09 Negative −
     813 Yes 0.12 Negative 128.35 Positive −
     815 Yes 0.36 Negative 360.49 Positive −
    1263 Yes 0.16 Negative 111.72 Positive −
    1652 Yes 0.32 Negative 111.94 Positive −
    1655 Yes 0.35 Negative 104.13 Positive +c
    1657 Yes 0.71 Positive 122.23 Positive +/−
    1665 Yes 0.16 Negative 108.28 Positive +/−
    1667 Yes 0.30 Negative 142.19 Positive +/−
    1130 Probable 2.04 Positive 85.51 Equivocal + 
    1131 Probable 1.52 Positive 219.61 Positive + 
    1537 Probable 4.64 Positive 782.95 Positive +c
    1538 Probable 4.64 Positive >500 Positive +c
    aProven or probable cases of disease formally classified according to EORTC criteria
    bReactions in LFD tests: − (no antigen detected), +/− (weak reaction), + (strong reaction). Results from specimens 9OHD, 1657 and 1131 are shown in FIG. 29.
    cSamples with a strong reaction at a 1 in 10 dilution in normal serum, but negative undiluted
    • Example 2 Summary
  • Lectin binding studies show that the antigen(s) bound by MAb JF5 is/are immunogenic N-linked mannoprotein(s) comprising terminal non-reducing mannose residues linked α1-3 and α1-6. Insensitivity of the antigen(s) in ELISA to mild alkaline hydrolysis (β-elimination) shows that the MAb does not bind to glycan structures O-linked through serine and threonine.
    • Methodology
  • Lectin binding studies. Antigen(s) were purified from Aspergillus fumigatus using the method described. Purified antigen solution was subjected to glycoprotein fractionation using a Qproteome Mannose Glycoprotein Kit (Catalog no. 37551; Qiagen Ltd., Crawley, UK) according to the manufacturer's instructions. The ConA, GNA, and LCH lectin spin columns in the kit allow specific enrichment of glycoproteins with mannose-rich glycan moieties. The three lectins each bind different subclasses of these moieties. ConA binds biantennary and triantennary complex type N-glycans; LCH binds biantennary and triantennary complex type N-glycans with core fucose. GNA binds α1-3 and α1-6 linked high mannose structures.
  • Flow-through and eluted fractions from the lectin spin columns were assayed by Western blotting. Polyacrylamide gel electrophoresis (PAGE) was carried under denaturing conditions, with 4-20% (wt/vol) gradient polyacrylamide gels (Bio-Rad Laboratories Limited, Hemel Hempstead, UK). Fractions were mixed with Laemmli buffer and denatured by heating at 95° C. for 10 min in the presence of β-mercaptoethanol prior to gel loading. Each well was loaded with 0.5 mg of protein. Glycoproteins were separated for 1.5 h at 23° C. (165V) and pre-stained, broad range, markers (Bio-Rad) were used for molecular mass determinations. For Westerns, separated proteins were transferred electrophoretically to a PVDF membrane (Bio-Rad). The membranes were blocked for 16 h at 4° C. with PBS containing 1% (wt/vol) bovine serum albumin (BSA) and incubated with JF5 MAb supernatant diluted 1 in 2 with PBS containing 0.5% (wt/vol) BSA (PBSA) for 2 h at 23° C. After washing three times with PBS, the membrane was incubated for 1 h with goat anti-mouse IgG (whole molecule) alkaline phosphatase conjugate (Sigma) diluted 1 in 15,000 in PBSA. The membrane was washed twice with PBS, once with PBST and bound antibody visualized by incubation in substrate solution. Reactions were stopped by immersion in dH2O and air-dried between sheets of Whatman filter paper.
  • Mild alkaline hydrolysis (β-elimination). Mild alkaline hydrolysis results in cleavage of glycans O-linked through the β-hydroxy amino acids serine and threonine. It does not cleave glycans N-linked through asparagine. Chemical modification of the purified antigen was carried out according the procedure described in Thornton (Thornton, C. R. 2001. Immunological methods for fungi, p. 227-257. In N. J. Talbot (ed.), Molecular and Cellular Biology of Filamentous Fungi, A Practical Approach. University Press, Oxford). Briefly, purified antigen was immobilized to the wells of Maxisorp microtitre plates. The wells were incubated with 50 μl of a 50 mM solution of NaOH or were incubated with 50 μl of dH2O only (control). After incubation for 24 h at 23° C., the wells were washed three times (3 min each time) with PBS and assayed by Enzyme-Linked Immunosorbent Assay (ELISA) with MAb JF5 as described.
    • Results and Discussion
  • Lectin binding studies. Western blotting analysis of flow-through and eluate fractions from lectin spin columns show that the JF5 antigen(s) has/have a high affinity for the mannose-binding lectin (GNA) from Galanthus nivalis (snowdrop) (FIG. 30). No binding or very weak binding only was found with the other two mannose-binding lectins, ConA from Canavalia ensiformis (jack bean) or LCH from Lens culinaris (lentil), respectively. GNA lectin is unique in that it is specific for D-mannose groups only (unlike ConA that is a mannose/glucose-specific lectin), especially those possessing Man(α1-3)Man units. It displays selective reactivity with mannans or mannose-containing glycoproteins and has a strict requirement for non-reducing terminal mannose units (Shibuya, N., I. J. Goldstein, E. J. M. Van Damme, and W. J. Peumans, 1988. Binding Properties of a Mannose-specific Lectin from the Snowdrop (Galanthus nivalis) Bulb. J. Biol. Chem. 263:728-734). Poor binding of the JF5 antigen to LCH and ConA lectins shows that the antigen(s) is/are not hybrid type or bi- and tri-antennary complex type N-linked glycoproteins.
  • Mild alkaline hydrolysis (β-elimination). ELISA studies using chemical modification of the purified antigen with mild alkali show that the MAb does not bind to glycan structures O-linked through serine and threonine. There was no significant difference (Student's t-test; t=0.113, not significant) between the absorbance values obtained with treated antigen(s) (1.378±0.009) compared to the control (1.376±0.013).
  • N-terminal sequencing. The N-terminal sequence (ALFALAKXV) of the protein component of the purified antigen was shown to have significant homology to the protein Cwplp from the yeast Saccharomyces cerevisiae (GenBank accession number EEU05173.1). Cwp1p is a cell wall mannoprotein, linked to a β-1,3- and β-1,6-glucan heteropolymer through a phosphodiester bond (Van Der Vaart, J. M., L. H. P. Caro, J. W. Chapman, F. M. Klis, and C. T. Verrips, 1995. Identification of three mannoproteins in the cell wall of Saccharomyces cerevisiae. J. Bacteriol. 177:3104-3110). Using protein subcellular localization prediction software ((http://wolfpsort.org/) and (http://www.cbs.dtu.dk/services/SignalP/)), the Cwp1p glycoprotein is predicted to have a signal peptide, to be secreted and to be extracellular. Despite homology of the protein component to yeast Cwp1p, monoclonal antibody JF5 retains its specificity for Aspergillus species. It does not cross-react with S. cerevisiae.
    • Example 3 Detection of Invasive Pulmonary Aspergillosis by Lateral Flow Technology Compared to Galactomannan and (1→0)-β-D-Glucan
  • Early diagnosis of invasive aspergillosis is critical for the initiation of appropriate antifungal therapy and may improve outcomes in high-risk patients. The use of sensitive biomarkers, including the non-invasive assays for galactomannan and (1→3)-β-D-glucan, also reduces the use of unnecessary antifungal agents. Despite their advantages, the galactomannan and the (1→3)-β-D-glucan assays are confined to laboratories equipped for these tests or require samples be sent to reference laboratories. Lateral-flow technology incorporates immunochromatographic assays into simple devices for point-of-care diagnosis. When coupled to a monoclonal antibody specific to an extracellular glycoprotein of Aspergillus this technology is a sensitive and specific biomarker (Thornton, C. R. 2008. Development of an Immunochromatographic Lateral-Flow Device for Rapid Serodiagnosis of Invasive Aspergillosis. Clin. Vacc. Immunol. 15:1095-1105). Our objective was to evaluate the time to positivity and sensitivity of a lateral-flow device in an established guinea pig model of invasive pulmonary aspergillosis, and directly compare these results to those obtained using the galactomannan and (1→3)-β-D-glucan assays.
  • Immunosuppressed male Hartley guinea pigs (Charles River Laboratories) were exposed to conidia for 1 hour in an aerosol chamber. Serum samples were collected on days 3, 5, and 7 post-inoculation. A previously described lateral-flow device was used for the serodiagnosis of invasive aspergillosis (Thornton, C. R. 2008. Development of an Immunochromatographic Lateral-Flow Device for Rapid Serodiagnosis of Invasive Aspergillosis. Clin. Vacc. Immunol. 15:1095-1105). Briefly, an IgG monoclonal antibody (JF5) to an epitope on an extracellular antigen secreted constitutively during active growth of Aspergillus was immobilized to a capture zone on a porous nitrocellulose membrane. JF5 IgG was also conjugated to colloidal gold particles to serve as the detection reagent. Serum was added to a release pad containing the antibody-gold conjugate, which bound the target antigen, then passed along the porous membrane and bound to JF5 IgG monoclonal antibody immobilized in the capture zone. Test results were available within 10-15 minutes after loading the sample. Bound antigen-antibody-gold complex were observed as a red line with an intensity proportional to the antigen concentration, and were classified as negative, weakly positive, moderately positive, or strongly positive (FIGS. 31A, B, C, and D). Anti-mouse immunoglobulin immobilized to the membrane in a separate zone served as an internal control.
  • The (1→3)-β-D-glucan assay was performed using a commercially available kit (Fungitell, Associates of Cape Cod). Serum was transferred in duplicate to a 96-well cell culture tray and processed according to the manufacturer's instructions. The mean rate of change in optical density (OD) at 405 nm over time was measured using a microplate spectrophotometer (Synergy HT; Biotek Instruments) and unknowns were interpolated from a standard curve. Serum galactomannan was measured using a commercially available kit (Platelia Aspergillus EIA, Bio-Rad Laboratories). Serum was heat-treated following the addition of an EDTA acid solution. Treated supernatant was added to microwells containing conjugate and the rat monoclonal antibody EB-A2. Following incubation, microwells were washed and the substrate solution added forming a complex with the monoclonal antibody. The OD values of each sample, positive control, negative control, and cut-off control were measured using a microplate spectrophotometer at 450 and 630 nm, and the galactomannan index (GMI) was calculated as the OD of each sample divided by the mean cut-off of the control. The lateral-flow assay and the (1→3)-β-D-glucan and galactomannan assays were performed in separate laboratories by different investigators blinded to the results of the other.
  • For each biomarker, the time to positivity was defined as the first time point at which three serum samples became positive. Time to positivity was plotted by Kaplan-Meier analysis, and differences in median time at which the assays became positive were analyzed by the log-rank test. Differences in the number of positive samples per time point between the assays were determined by Fisher's exact test. The overall specificity of each assay was also measured in uninfected controls. All statistical tests were performed using Prism 5.0 (GraphPad Software, Inc.).
  • The assays were negative 1 hour post-inoculation prior to the onset of invasive disease with the exception of a galactomannan test result (Table 3), which likely represents a false positive result, as invasive disease is not yet established. Each biomarker became positive early with more than three samples positive for each assay by day 5 post-inoculation. In serial samples from the same animals, each biomarker continued to increase throughout the study (FIGS. 32A, B, and C). When the weakly positive lateral-flow device results were considered positive, this assay became positive on day 3, which was significantly shorter compared to the galactomannan (day 5, p=0.03) and (1→3)-β-D-glucan assays (day 7, p<0.001). When the weakly positive lateral-flow results were considered negative and only the moderately and strongly positive results positive, the time to positivity for each biomarker assay occurred at the day 5 time point.
  • The sensitivity of each biomarker increased throughout the study period (Table 3). Similar to the time to positivity results, when the weakly positive results were considered positive, the sensitivity of the lateral-flow device on day 3 (48%) was greater than the galactomannan (4%, p<0.001) and (1→3)-β-D-glucan assays (0%, p<0.001). The sensitivity of the lateral-flow device also remained higher than the (1→3)-β-D-glucan assay on day 5 (82% vs. 23%, respectively; p<0.001), but was not significantly different than the galactomannan assay (59%). When the weakly positive lateral-flow device results were considered negative and only the moderately to strongly positive results positive, the sensitivity of this biomarker was similar to that of the galactomannan and (1→3)-β-D-glucan assays (35%, 59%, and 23%, respectively; p>0.05). Each biomarker was 100% sensitive at the day 7 time point. Excellent specificity was also observed for each biomarker with only two false positives observed in uninfected animals with the (1→3)-β-D-glucan assay (Table 3).
  • TABLE 3
    Comparison of the lateral flow device and galactomannan and
    (1→3)-β-D-glucan assays
    Lateral-Flow Beta-glucan Galactomannan
    Time Point Device (+) (≧80 pg/mL) Index (≧0.5)
    1 hour
    Number positive 0/5 0/5  1/5
    Day 3
    Number positive 12/25 0/25  1/25
    Sensitivity  48%  0%  4%
    Day
    5
    Number positive 14/17 4/17 10/17
    Sensitivity  82% 23%  59%
    Day
    7
    Number positive 6/6 6/6  6/6
    Sensitivity 100% 100%  100%
    Uninfected Specificity  0/10 2/10  0/10
    100% 80% 100%
  • Reference DNA Sequence Amino Acid Sequence
    VH3-1 ATGGATTTTGGGCTGATTTTTTTTATTGTTGCTCTTTTAAAAGGGGTCCAGTGTGAGGT MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    GAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAACTCTCCT PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    GTGCAGCCTCAGGATTCGATTTTAGTAGATACTGGATGAGTTGGGTCCGGCAGGCTCCA GLEWIGEINPDSSKINYMPSLKDKFIISRDNA
    GGGAAAGGGCTAGAATGGATTGGAGAAATTAATCCAGATAGCAGTAAGATAAACTATAT KNTLYLQMSKVRSEDTALYYCARPRGYYA
    GCCATCTCTAAAGGATAAATTCATCATCTCCAGAGACAACGCCAAAAATACGCTGTACC MDFWGQGTSVTVSSATTTAPSVFPLA
    TGCAAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGTGCAAGACCTCGG
    GGTTACTACGCTATGGACTTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCTAC
    AACAACAGCCCCATCCGTCTTCCCCCTGGCAC
    VH3-2 ATGGATTTTGGGCTGATTTTTTTTATTGTTGCTCTTTTAAAAGGGGTCCAGTGTGAGGT MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    GAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAACTCTCCT PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    GTGCAGCCTCAGGATTCGATTTTAGTAGATACTGGATGAGTTGGGTCCGGCAGGCTCCA GLEWIGEINPDSSKINYMPSLKDKFIISRDNA
    GGGAAAGGGCTAGAATGGATTGGAGAAATTAATCCAGATAGCAGTAAGATAAACTATAT KNTLYLQMSKVRSEDTALYYCARPRGYYA
    GCCATCTCTAAAGGATAAATTCATCATCTCCAGAGACAACGCCAAAAATACGCTGTACC MDFWGQGTSVTVSSATTTAPSVFPLA
    TGCAAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGTGCAAGACCTCGG
    GGTTACTACGCTATGGACTTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCTAC
    AACAACAGCCCCATCCGTCTTCCCCCTGGCAC
    VH3-4 ATGGATTTTGGGCTGATTTTTTTTATTGTTGCTCTTTTAAAAGGGGTCCAGTGTGAGGT MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    GAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAACTCTCCT PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    GTGCAGCCTCAGGATTCGATTTTAGTAGATACTGGATGAGTTGGGTCCGGCAGGCTCCA GLEWIGEINPDSSKINYMPSLKDKFIISRDNA
    GGGAAAGGGCTAGAATGGATTGGAGAAATTAATCCAGATAGCAGTAAGATAAACTATAT KNTLYLQMSKVRSEDTALYYCARPRGYYA
    GCCATCTCTAAAGGATAAATTCATCATCTCCAGAGACAACGCCAAAAATACGCTGTACC MDFWGQGTSVTVSSATTTAPSVFPLA
    TGCAAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGTGCAAGACCTCGG
    GGTTACTACGCTATGGACTTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCTAC
    AACAACAGCCCCATCCGTCTTCCCCCTGGCAC
    VH3-8 ATGGATTTTGGGCTGATTTTTTTTATTGTTGCTCTTTTAAAAGGGGTCCAGTGTGAGGT MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    GAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAACTCTCCT PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    GTGCAGCCTCAGGATTCGATTTTAGTAGATACTGGATGAGTTGGGTCCGGCAGGCTCCA GLEWIGEINPDSSKINYMPSLKDKFIISRDNA
    GGGAAAGGGCTAGAATGGATTGGAGAAATTAATCCAGATAGCAGTAAGATAAACTATAT KNTLYLQMSKVRSEDTALYYCARPRGYYA
    GCCATCTCTAAAGGATAAATTCATCATCTCCAGAGACAACGCCAAAAATACGCTGTACC MDFWGQGTSVTVSSATTTAPSVSPWR
    ATGCAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGTGCAAGACCTCGA
    GGTTACTACGCTATGGACTTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCTAC
    AACAACAGCCCCATCGGTCTCCCCCTGGCGC
    VH5-1 ATGGATTTTGGGCTGATTTTTTTTATTGTTGCTCTTTTAAAAGGGGTCCAGTGTGAGGT MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    GAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAACTCTCCT PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    GTGCAGCCTCAGGATTCGATTTTAGTAGATACTGGATGAGTTGGGTCCGGCAGGCTCCA GLEWIGEINPDGSKINYMPSLKDKFIISRDNA
    GGGAAAGGGCTAGAATGGATTGGAGAAATTAATCCAGATGGCAGTAAGATAAACTATAT KNTLYLQMSKVRSEDTALYYCARPRGYYA
    GCCATCTCTAAAGGATAAATTCATCATCTCCAGAGACAACGCCAAAAATACGCTGTACC MDFWGQGTSVTVSSATTTAPPVYPLVPEAW
    TGCAAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGTGCAAGACCTCGG
    GGTTACTACGCTATGGACTTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCTAC
    AACAACAGCCCCACCCGTCTATCCACTGGTCCCTGAAGCTTGGG
    VH5-2 ATGGATTTTGGGCTGATTTTTTTTATTGTTGCTCTTTTAAAAGGGGTCCAGTGTGAGGT MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    GAAGCTTCTCGAGTCTGGAGGTGGCCTGGTGCAGCCTGGAGGATCCCTGAAACTCTCCT PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    GTGCAGCCTCAGGATTCGATTTTAGTAGATACTGGATGAGTTGGGTCCGGCAGGCTCCA GLEWIGEINPDSSKINYMPSLKDKFIISRDNA
    GGGAAAGGGCTAGAATGGATTGGAGAAATTAATCCAGATAGCAGTAAGATAAACTATAT KNTLYLQMSKVRSEDTALYYCARPRGYYA
    GCCATCTCTAAAGGATAAATTCATCATCTCCAGAGACAACGCCAAAAATACGCTGTACC MDFWGQGTSVTVSSATTTAPPVYPLAP
    TGCAAATGAGCAAAGTGAGATCTGAGGACACAGCCCTTTATTACTGTGCAAGACCTCGG
    GGTTACTACGCTATGGACTTCTGGGGTCAAGGAACCTCAGTCACCGTCTCCTCAGCTAC
    AACAACAGCCCCACCCGTCTATCCCCTGGCCCCTGG
    JF5VH MDFGLIFFIVALLKGVQCEVKLLESGGGLVQ
    Consensus PGGSLKLSCAASGFDFSRYWMSWVRQAPGK
    Sequence GLEWIGEINPDSSKINYMPSLKDKFIISRDNA
    KNTLYLQMSKVRSEDTALYYCARPRGYYA
    MDFWGQGTSVTVSSATTTAPSVFPLA
    VL4-1 ATGGAGTCACATACCCAGGTCTTTATATTCGTGTTTCTCTGGTTGTCTGGTGTTGACGG MESHTQVFIFVFLWLSGVDGDIVMTQSHKV
    AGACATTGTGATGACCCAGTCTCACAAAGTCATGTCCACATCAGTAGGAGACAGGGTCA MSTSVGDRVSITCKASQDVSTAVAWHQQKP
    GCATCACCTGCAAGGCCAGTCAGGATGTGAGTACTGCTGTAGCCTGGCATCAACAGAAA GQSPKPLIYSASYQYTGVPDRFTGSGSGTDFT
    CCAGGACAATCTCCTAAACCACTGATTTACTCGGCATCCTACCAGTACACTGGAGTCCC FTISSVQAEDLAVYYCQQHYSIPWTFGGGTK
    TGATCGCTTCACTGGCAGTGGATCTGGGACGGATTTCACTTTCACCATCAGCAGTGTGC LEIKRADAAPTVSIFPPSSKLG
    AGGCTGAAGACCTGGCAGTTTATTACTGTCAGCAACATTACAGTATTCCGTGGACGTTC
    GGTGGAGGCACCAAGCTGGAAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTT
    CCCACCATCCAGTAAGCTTGGG
    VL4-8 ATGGAGACACAGTCTCAGGTCTTTGTATTCGTGTTTCTCTGGTTGTCTGGTGTTGACGG METQSQVFVFVFLWLSGVDGDIVMTQSHKV
    AGACATTGTGATGACCCAGTCTCACAAAGTCATGTCCACATCAGTAGGAGACAGGGTCA MSTSVGDRVSITCKASQDVSTAVAWHQQKP
    GCATCACCTGCAAGGCCAGTCAGGATGTGAGTACTGCTGTAGCCTGGCATCAACAGAAA GQSPKPLIYSASYQYTGVPDRFTGSGSGTDFT
    CCAGGACAATCTCCTAAACCACTGATTTACTCGGCATCCTACCAGTACACTGGAGTCCC FTISSVQAEDLAVYYCQQHYSIPWTFGGGTK
    TGATCGCTTCACTGGCAGTGGATCTGGGACGGATTTCACTTTCACCATCAGCAGTGTGC LEIKRADAAPTVSIFPPSSKLG
    AGGCTGAAGACCTGGCAGTTTATTACTGTCAGCAACATTACAGTATTCCGTGGACGTTC
    GGTGGAGGCACCAAGCTGGAAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTT
    CCCACCATCCAGTAAGCTTGGG
    VL4-18 CCCAGGTCTTTGTATTGGTGTTTCTCTGGTTGTCTGGTGTTGACGGAGACATTGTGATG QVFVLVFLWLSGVDGDIVMTQSHKVMSTSV
    ACCCAGTCTCACAAAGTCATGTCCACATCAGTAGGAGACAGGGTCAGCATCACCTGCAA GDRVSITCKASQDVSTAVAWHQQKPGQSPK
    GGCCAGTCAGGATGTGAGTACTGCTGTAGCCTGGCATCAACAGAAACCAGGACAATCTC PLIYSASYQYTGVPDRFTGSGSGTDFTFTISSV
    CTAAACCACTGATTTACTCGGCATCCTACCAGTACACTGGAGTCCCTGATCGCTTCACT QAEDLAVYYCQQHYSIPWTFGGGTKLEIKR
    GGCAGTGGATCTGGGACGGATTTCACTTTCACCATCAGCAGTGTGCAGGCTGAAGACCT ADAAPTVSIFPPSSKLG
    GGCAGTTTATTACTGTCAGCAACATTACAGTATTCCGTGGACGTTCGGTGGAGGCACCA
    AGCTGGAAATCAAACGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCATCCAGT
    AAGCTTGGG
    JF5VL MESXSQVFVFVFLWLSGVDGDIVMTQSHKV
    Consensus MSTSVGDRVSITCKASQDVSTAVAWHQQKP
    Sequence GQSPKPLIYSASYQYTGVPDRFTGSGSGTDFT
    FTISSVQAEDLAVYYCQQHYSIPWTFGGGTK
    LEIKRADAAPTVSIFPPSSKLG

Claims (25)

1. A hybridoma deposited under accession number ECACC 08120202.
2. An antibody which may be obtained by culture of the hybridoma of claim 1, or a functional fragment of such an antibody.
3. An antibody, or antibody fragment or other molecule capable of specifically binding to Aspergillus, the antibody, fragment or binding molecule comprising a CDR, light chain, heavy chain, light chain variable region, heavy chain variable region or antigen binding region that shows substantial homology with the corresponding region of the antibody according to claim 2.
4. An antibody according to claim 3 comprising a CDR comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
19 to 25.
5. An antibody according to claim 4, comprising a first CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
19;
a second CDR comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
21 or 22; and
a third CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
24.
6. An antibody according to claim 4 comprising a first CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
20;
a second CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
23; and
a third CDR comprising an amino acid sequence having substantial homology to the amino acid sequence shown in figure:
25.
7. An antibody according to claim 3 comprising a heavy chain comprising one or more CDRs having an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
19, 21, 22 and 24.
8. An antibody according to claim 3 comprising a light chain comprising one or more CDRs having an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
20, 23 and 25.
9. An antibody according to claim 3 comprising an amino acid sequence having substantial homology to an amino acid sequence selected from the sequences shown in figures:
2, 4, 6, 8, 10, 11, 13, 15, 17 and 18.
10. An antibody according to claim 3 comprising a heavy chain variable region having substantial homology to an amino acid sequence selected from the sequences shown in figures:
2, 4, 6, 8, 10 and 11.
11. An antibody according to claim 3 comprising a light chain variable region having substantial homology to the amino acid sequence selected from the sequences shown in figures:
13, 15, 17 and 18.
12. An antibody according to claim 3 encoded by a nucleotide sequence having substantial homology to a nucleotide sequence selected from the sequences shown in figures:
1, 3, 5, 7, 9, 12, 14 and 16.
13. An antibody according to claim 3 comprising a heavy chain variable region encoded by a nucleotide sequence having substantial homology to a nucleotide sequence selected from the sequences shown in figures:
1, 3, 5, 7 and 9.
14. An antibody according to claim 3 comprising a light chain variable region encoded by a nucleotide sequence having substantial homology to the nucleotide sequence selected from the sequences shown in figures:
12, 14 and 16.
15. An antibody that binds to the same epitope as an antibody according to claim 3.
16. A method of making antibodies, including a method of generating an antibody or functional fragment thereof comprising:
a) providing a repertoire of nucleic acids encoding a variable domain that either includes a CDR1, CDR2 or CDR3 encoding region to be replaced or lacks a CDR1, CDR2 or CDR3 encoding region;
b) combining the repertoire with a donor nucleic acid having a nucleotide sequence encoding a sequence selected from the sequences in figures:
19 to 25 to provide a repertoire of nucleic acids encoding a variable domain; and
c) expressing a nucleic acid from the repertoire.
17. An isolated nucleic acids encoding an antibody or functional fragment thereof according to claim 3.
18. An isolated nucleic acid having substantial homology to a sequence selected from the sequences shown in figures:
1, 3, 5, 7, 9, 12, 14 and 16.
19. A construct comprising a nucleic acid molecule according to claim 18.
20. A host cell comprising at least one construct according to claim 19.
21. A the method of making an antibody comprising culturing a host cell according to claim 20 under appropriate conditions to express the antibody from the nucleic acid.
22. A method of assaying for the presence of an Aspergillus species in a sample, comprising:
a) contacting the sample with a labeled antibody according to claim 2; and
b) observing the sample for binding of the antibody to epitopes in the sample;
wherein binding of the antibodies is indicative of the presence of an Aspergillus species.
23. A pharmaceutical composition comprising an antibody according to claim 3 or functional fragment thereof.
24. An antibody according to claim 3 or functional fragment thereof for use in therapy.
25. A method of treating an infection with an Aspergillus species, comprising administering a therapeutic amount of an antibody according to claim 3 or fragment thereof to a subject in need thereof.
US13/144,872 2009-01-16 2010-01-18 Antibody Abandoned US20120064093A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US13/144,872 US20120064093A1 (en) 2009-01-16 2010-01-18 Antibody

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US14528209P 2009-01-16 2009-01-16
US13/144,872 US20120064093A1 (en) 2009-01-16 2010-01-18 Antibody
PCT/GB2010/000064 WO2010082034A1 (en) 2009-01-16 2010-01-18 Antibody

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2010/000064 A-371-Of-International WO2010082034A1 (en) 2009-01-16 2010-01-18 Antibody

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US14/298,695 Continuation US20150018532A1 (en) 2009-01-16 2014-06-06 Antibody

Publications (1)

Publication Number Publication Date
US20120064093A1 true US20120064093A1 (en) 2012-03-15

Family

ID=42124706

Family Applications (3)

Application Number Title Priority Date Filing Date
US13/144,872 Abandoned US20120064093A1 (en) 2009-01-16 2010-01-18 Antibody
US14/298,695 Abandoned US20150018532A1 (en) 2009-01-16 2014-06-06 Antibody
US16/518,565 Active US11142568B2 (en) 2009-01-16 2019-07-22 Antibody

Family Applications After (2)

Application Number Title Priority Date Filing Date
US14/298,695 Abandoned US20150018532A1 (en) 2009-01-16 2014-06-06 Antibody
US16/518,565 Active US11142568B2 (en) 2009-01-16 2019-07-22 Antibody

Country Status (4)

Country Link
US (3) US20120064093A1 (en)
EP (2) EP3617228A1 (en)
CN (1) CN102439038A (en)
WO (1) WO2010082034A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150192581A1 (en) * 2009-11-23 2015-07-09 Yeshiva University Lateral Flow Device for Diagnosing Microbial Infections
US10107822B2 (en) 2013-12-16 2018-10-23 The Johns Hopkins University Interferon-gamma release assays for diagnosis of invasive fungal infections
US10585098B2 (en) 2009-11-23 2020-03-10 The Johns Hopkins University Optimizing diagnostics for galactofuranose containing antigens
WO2021158660A3 (en) * 2020-02-05 2021-09-23 Navaux, Inc. Anti-hepsin antibodies and uses thereof
WO2023142410A1 (en) * 2022-01-26 2023-08-03 丹娜(天津)生物科技股份有限公司 Talaromyces marneffei mannan protein and use thereof in preparation of talaromyces marneffei antibody test kit

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN107466319B (en) * 2017-06-28 2020-08-14 丹娜(天津)生物科技股份有限公司 GM hybridoma cell, monoclonal antibody, kit, preparation method and application thereof
EP3495819A1 (en) 2017-12-11 2019-06-12 Euroimmun Medizinische Labordiagnostika AG An improved method for diagnosing a fungal infection
CA3132872A1 (en) * 2019-02-07 2020-08-13 Board Of Regents, The University Of Texas System Aspergillus antigen chimeric receptors and use thereof
US11230594B2 (en) 2020-03-23 2022-01-25 The Royal Institution For The Advancement Of Learning/Mcgill University Anti-galactofuranose antibodies for detecting and treating aspergillosis

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2136092T3 (en) 1991-09-23 1999-11-16 Medical Res Council PROCEDURES FOR THE PRODUCTION OF HUMANIZED ANTIBODIES.

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150192581A1 (en) * 2009-11-23 2015-07-09 Yeshiva University Lateral Flow Device for Diagnosing Microbial Infections
US9915657B2 (en) * 2009-11-23 2018-03-13 Yeshiva Universtiy Lateral flow device for diagnosing microbial infections
US10288611B2 (en) 2009-11-23 2019-05-14 The Johns Hopkins University Lateral flow device for diagnosing microbial infections
US10585098B2 (en) 2009-11-23 2020-03-10 The Johns Hopkins University Optimizing diagnostics for galactofuranose containing antigens
US11079380B2 (en) 2009-11-23 2021-08-03 The Johns Hopkins University Optimizing diagnostics for galactofuranose containing antigens
US10107822B2 (en) 2013-12-16 2018-10-23 The Johns Hopkins University Interferon-gamma release assays for diagnosis of invasive fungal infections
WO2021158660A3 (en) * 2020-02-05 2021-09-23 Navaux, Inc. Anti-hepsin antibodies and uses thereof
WO2023142410A1 (en) * 2022-01-26 2023-08-03 丹娜(天津)生物科技股份有限公司 Talaromyces marneffei mannan protein and use thereof in preparation of talaromyces marneffei antibody test kit

Also Published As

Publication number Publication date
EP2387585A1 (en) 2011-11-23
US20200024332A1 (en) 2020-01-23
EP3617228A1 (en) 2020-03-04
US11142568B2 (en) 2021-10-12
CN102439038A (en) 2012-05-02
WO2010082034A1 (en) 2010-07-22
US20150018532A1 (en) 2015-01-15

Similar Documents

Publication Publication Date Title
US11142568B2 (en) Antibody
Thornton Development of an immunochromatographic lateral-flow device for rapid serodiagnosis of invasive aspergillosis
Deckers et al. Nanobodies, a promising tool for species-specific diagnosis of Taenia solium cysticercosis
US7732579B2 (en) High-affinity monoclonal antibodies for botulinum toxin type A
WO2009137677A2 (en) Reagents, methods, and systems for detecting methicillin-resistant staphylococcus
Thornton Tracking the emerging human pathogen Pseudallescheria boydii by using highly specific monoclonal antibodies
WO2020184409A1 (en) METHOD FOR IMMUNOLOGIC ANALYSIS OF β-D-GLUCAN IN BIOLOGICAL SAMPLE, AND β-D-GLUCAN ANALYSIS KIT
KR102686392B1 (en) Anti-species-specific malaria parasite lactate dehydrogenase antibody
Berzaghi et al. New approach for diagnosis of candidemia based on detection of a 65-kilodalton antigen
WO2016172660A1 (en) Fungal detection using mannan epitope
AU2019355429B2 (en) Methods, devices, kits and compositions for detecting tapeworm
Hannachi et al. Enhancing the detection of Toxoplasma gondii via an anti-SAG1 scFv-alkaline phosphatase immunoconjugate
US7772374B2 (en) Spore specific antibodies
JP2005523017A (en) Candida albicans cell wall mannoprotein and active epitopes and antibodies recognizing these
US7928204B2 (en) Spore specific antigen
KR20120029137A (en) Antibody specifically binding to c. perfringens enterotoxin protein and composition for detecting said protein comprising the same
US7368256B2 (en) Antibodies against Stachybotrys chartarum and methods for their use
KR20140132410A (en) Interfering peptides and method for detecting micro-organisms
US20220381779A1 (en) Methods for the diagnosis of buruli ulcer
US20240124562A1 (en) Monoclonal antibodies and uses thereof
KR102163241B1 (en) Monoclonal antibody against immunoglobulin m of rock bream and use thereof
Ansari et al. Fungal Biology
CN118440189A (en) Anti-P24 antibody, and reagent and kit for detecting P24
WO2021252722A1 (en) Sars-cov-2 polypeptides, ant-sars-cov-2 antibodies and uses thereof
KR20200049387A (en) Monoclonal antibody specifically binding to OMP28 in Brucella suis, Hybridoma cell line procuding the same and use thereof

Legal Events

Date Code Title Description
AS Assignment

Owner name: THE UNIVERSITY OF EXETER, UNITED KINGDOM

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:THORNTON, CHRISTOPHER;REEL/FRAME:027200/0638

Effective date: 20110922

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION